slc10a-2

Overview
Nameslc10a-2 (AKN21469.1)
Smed IDSMED30030586
Length (bp)1546
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc10a-2 (SMED30030586) t-SNE clustered cells

Violin plots show distribution of expression levels for slc10a-2 (SMED30030586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc10a-2 (SMED30030586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc10a-2 (SMED30030586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030586h1SMcG0010174 dd_Smed_v4_10199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030586h1SMcG0010174 dd_Smed_v4_10199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030586h1SMcG0010174 dd_Smed_v4_10199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030586h1SMcG0010174 dd_Smed_v4_10199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030586h1SMcG0010174 dd_Smed_v4_10199_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30030586h1SMcG0010174 Smed-slc10a-2smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc10a-2 vs. Ensembl Human
Match: SLC10A2 (solute carrier family 10 member 2 [Source:HGNC Symbol;Acc:HGNC:10906])

HSP 1 Score: 127.872 bits (320), Expect = 3.440e-32
Identity = 99/294 (33.67%), Postives = 156/294 (53.06%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG--TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKN 1450
            F MGC ++    L ++K+P    +GF+ QF  MPL    L     I    A+ +L+IGC PGG ASNI      GD++LS++MT  S+  ALGMMPL L    ++++D  ++VIPYD+I  +L+ +V+PV IG+FV  KW +K+K+++K   I G I I+ +   G   Y + +I   I   +++  IG   P  G+  G+LLA        +   +A ETG QN  +   I++ S    + ++    PLI ++F  L     +    +  K C    ++E  E K N  E ++
Sbjct:   47 FSMGCNVEIKKFLGHIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWI---IAPKLWI--IGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQ-LAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPES 334          
BLAST of slc10a-2 vs. Ensembl Human
Match: SLC10A6 (solute carrier family 10 member 6 [Source:HGNC Symbol;Acc:HGNC:30603])

HSP 1 Score: 115.161 bits (287), Expect = 1.651e-27
Identity = 75/239 (31.38%), Postives = 129/239 (53.97%), Query Frame = 2
Query:  569 LTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDY---IFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFS 1276
            L F +GC ++   + +++++P    +G + QF  MP  +  L     ++   A+ +L++GC PGG  SNI+T    GD++LS++MT  S+ AALGMMPL ++     +   +N+ IPY +I I L+ + +PV  G++V        +   +   I+ I  ++  +     A   +    G +   I LL I    P +G + G+LLAL T ++ ++   I+LETG QNI + I +L+ S
Sbjct:   45 LMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVN------YRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLS 277          
BLAST of slc10a-2 vs. Ensembl Human
Match: SLC10A1 (solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905])

HSP 1 Score: 112.849 bits (281), Expect = 8.486e-27
Identity = 78/239 (32.64%), Postives = 126/239 (52.72%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPK-NVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG----TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC ++   I  +L KP    I  V+Q+  MPL +  LGK+  ++N  AL +LV GCSPGG  SN++++   GD+NLS+ MT  S+  ALGMMPL L+   R   D      +PY  I I+L+ V++P  IGI ++       +    +  I G + II + S      +  N+    +      L+   + +P++GF+ GY+L+     N +    +++ETG QN+ +   IL  + P
Sbjct:   42 LGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLK-----SKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFP 275          
BLAST of slc10a-2 vs. Ensembl Human
Match: SLC10A3 (solute carrier family 10 member 3 [Source:HGNC Symbol;Acc:HGNC:22979])

HSP 1 Score: 105.916 bits (263), Expect = 6.970e-24
Identity = 72/249 (28.92%), Postives = 138/249 (55.42%), Query Frame = 2
Query:  584 GCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAM 1330
            GC ++ +++   ++ P    +G + QFL MPL +  + K+  +  + ALGL++   SPGGG S ++++L GGD+ L+++MTF+S+ AA G +PL      RL    + + +P   I   LL + +P+ +G+ ++ K  + S++L++ VK    + ++  L       ++I  L G  + ++ +G  +P +G + GY LA   +    Q   +++E G QN  +A+ +L+ S+ +   D  +  P IVA+
Sbjct:  179 GCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFI--LAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVAL 425          
BLAST of slc10a-2 vs. Ensembl Human
Match: SLC10A3 (solute carrier family 10 member 3 [Source:HGNC Symbol;Acc:HGNC:22979])

HSP 1 Score: 105.145 bits (261), Expect = 1.525e-23
Identity = 72/249 (28.92%), Postives = 138/249 (55.42%), Query Frame = 2
Query:  584 GCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAM 1330
            GC ++ +++   ++ P    +G + QFL MPL +  + K+  +  + ALGL++   SPGGG S ++++L GGD+ L+++MTF+S+ AA G +PL      RL    + + +P   I   LL + +P+ +G+ ++ K  + S++L++ VK    + ++  L       ++I  L G  + ++ +G  +P +G + GY LA   +    Q   +++E G QN  +A+ +L+ S+ +   D  +  P IVA+
Sbjct:  208 GCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFI--LAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVAL 454          
BLAST of slc10a-2 vs. Ensembl Celegans
Match: Y71G10AR.4 (pep chromosome:WBcel235:IV:2199041:2209051:1 gene:WBGene00044650.1 transcript:Y71G10AR.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71G10AR.4)

HSP 1 Score: 215.698 bits (548), Expect = 2.099e-63
Identity = 123/269 (45.72%), Postives = 171/269 (63.57%), Query Frame = 2
Query:  578 VMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIEN---SFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKN----VVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYA 1363
            +MGC LD D +L  LKKP++P IG  +QF+ MPL+S  +     +     S ALGL V GCSPGGGASN WT+L  G+LNLS+TMTFIS+  +L MMP WL+ LG  F+   N    + +PY  IA  L+ ++LP+ IGI ++      +    K ++   I  +IFV+ +G+  NLY+++++     +   G  LPW GF+FG   AL T+R  +   AIA+ETG QN GIAIL+LK S  QPD D+G+++P+IVA FTP PL +G A
Sbjct:  198 MMGCELDIDAVLATLKKPVAPGIGLFAQFIIMPLLSYLIAYAIFMPRGLYSMALGLFVTGCSPGGGASNFWTLLLDGNLNLSVTMTFISTICSLVMMPAWLYFLGHPFLQGFNSTAVIKVPYGKIASQLVTLILPLLIGIAIKKFKPTWAAKARKIMRPFVIFVMIFVVIFGSLTNLYMFRMLTGPALI--GGLALPWCGFMFGCFAALLTKRKPEDVTAIAVETGIQNTGIAILLLKASFGQPDADIGSLIPVIVAAFTPGPLLLGAA 464          
BLAST of slc10a-2 vs. Ensembl Fly
Match: CG11655 (gene:FBgn0030638 transcript:FBtr0074031)

HSP 1 Score: 150.214 bits (378), Expect = 1.087e-39
Identity = 97/256 (37.89%), Postives = 151/256 (58.98%), Query Frame = 2
Query:  584 GCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIEN-SFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPL 1348
            G  L+ D++   + +P  P IGFV Q + MPL+S ALG     +  +  LGL   G SP GGASN W+ + GG+++LS+ MT +S+ AA   +PLW   LG+L  +   + +PY  IA     +VLP+ +G+ V+ +  + ++VLV+ +K +    I+F++ +    N Y++ L    I +   G  LP LG+IF +L A    +N   A+ IA+ETG QN GIAI +L  ++  P+ D+  V+P+ VA+ TPLPL
Sbjct:  169 GAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAMQLGLFFTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPLWTITLGQLIFERAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFYLFYLFSWQIVV--AGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLLTTTLESPEADITTVVPVSVAVMTPLPL 422          
BLAST of slc10a-2 vs. Ensembl Fly
Match: CG9903 (gene:FBgn0030756 transcript:FBtr0074297)

HSP 1 Score: 69.707 bits (169), Expect = 2.005e-12
Identity = 78/361 (21.61%), Postives = 165/361 (45.71%), Query Frame = 2
Query:  203 LKTFEMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKL------NFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIEN-SFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAF-LPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAIL 1261
            L  ++ D +   E  T+ ++    NV     +   DY  V Y  +      PP+ ++     L         V   R G S++   + L     T+ + + +  + VLR   + E +   + +   + +   +G  LD   +   + +P+ P +G VS+F+ MP +   LG+    ++    L L     SP GG +N+  V   G++NLS+  T I+S  AL ++P+W+  LGR+  +   + +P+  ++     +V  + IG+ +R      ++ + + +K + ++  + ++      N +++    ++ + + + A  LP  G++  YLL+    R+   A+ +A+E    N+ + I+
Sbjct:   38 LVDYDRDELNFFEDSTWSVDLHIYNV--LPKDSSLDYYFVVYSKDDRRASSPPLEIKKEDFDLLGSWRGALYVTGVRFGYSSL--EVELKSGAVTETYPKPL-PITVLRTQVVDERITTYVSAALALLMFLNLGTVLDMQRLAGIICRPVGPVVGVVSRFVLMPAVGFGLGRALWPDSWPLQLALFYTALSPSGGLANVCAVFLKGNINLSVATTTINSLLALALLPIWILVLGRILYEDDELTVPFGQLSGGAAALVACLAIGVLLRLCLPRTTRFIFRFLKPLSVVLSLCLVGLTVGLNSFVFY---EFTWQILVAAVCLPLAGYLSTYLLSKILCRSSTDALTLAIEASVLNMTMPIV 390          
BLAST of slc10a-2 vs. Ensembl Zebrafish
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 115.546 bits (288), Expect = 6.606e-28
Identity = 93/308 (30.19%), Postives = 159/308 (51.62%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIF---------IIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQS---EDTEMKSNTDEQKNVLLD 1462
            F MGC ++   +  ++++P   FIGF+ QF  MP  +  L  L  +    A+ ++++GC PGG +SN++     GD++LS++MT  SS  ALGMMPL L     ++     + IPYD+I I L+ +++PVG+G+ V+ KW + +K ++K   ++GI+          +++  S+    +L+I            IG   P++GF  G+LLA    +   +   IALETG QN  +A  I + S    + ++    PLI ++F    L V   A+ I     +   Q+   ED E  +   ++ +  L+
Sbjct:   48 FSMGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSLLFNVLPVQAVVIIIMGCCPGGSSSNVFCYWLDGDMDLSISMTACSSILALGMMPLCLLIYTTIWTAGDAIQIPYDNIGITLVSLLVPVGLGMLVKHKWPKAAKKILKVGSVVGIVLIIVIAVIGGVLYQSSWTIAPSLWI------------IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGMQNAQLASTITQLSFSPAELEVMFAFPLIYSIFQ---LVVAGIAVSIHYSIKRCRHQTLVEEDGEGTTEDCDKHSYSLE 340          
BLAST of slc10a-2 vs. Ensembl Zebrafish
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 115.546 bits (288), Expect = 7.866e-28
Identity = 95/317 (29.97%), Postives = 159/317 (50.16%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIF---------IIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQS----------EDTEMKSNTDEQKNVLLDES 1468
            F MGC ++   +  ++++P   FIGF+ QF  MP  +  L  L  +    A+ ++++GC PGG +SN++     GD++LS++MT  SS  ALGMMPL L     ++     + IPYD+I I L+ +++PVG+G+ V+ KW + +K ++K   ++GI+          +++  S+    +L+I            IG   P++GF  G+LLA    +   +   IALETG QN  +A  I + S    + ++    PLI ++F    L V   A+ I     +   Q+          ED +  S + E      DE+
Sbjct:   48 FSMGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSLLFNVLPVQAVVIIIMGCCPGGSSSNVFCYWLDGDMDLSISMTACSSILALGMMPLCLLIYTTIWTAGDAIQIPYDNIGITLVSLLVPVGLGMLVKHKWPKAAKKILKVGSVVGIVLIIVIAVIGGVLYQSSWTIAPSLWI------------IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGMQNAQLASTITQLSFSPAELEVMFAFPLIYSIFQ---LVVAGIAVSIHYSIKRCRHQTLVEEDGEGTIEDCDKHSYSLENGGFSCDEN 349          
BLAST of slc10a-2 vs. Ensembl Zebrafish
Match: slc10a4 (solute carrier family 10 member 4 [Source:ZFIN;Acc:ZDB-GENE-041014-249])

HSP 1 Score: 110.153 bits (274), Expect = 9.875e-26
Identity = 80/255 (31.37%), Postives = 141/255 (55.29%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFID-PKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXX--XIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSM-PQPDGDMGAVMPLIVAMF 1333
            +GC ++   +  +++KPI   +  V QF+ MPLI+  L     + +  A+ +L+ GC PGG  SNI T+L  GD+NLS+ MT  S+  AL +MPL L+   R +I+ P   ++P+  I + L   ++P+G+G+++R ++   ++V++K     ++  + ++F+++ GT     +   I   ++L  +   +P  G+  GY LA            ++LETG QNI +   ILK +  PQ  G M  + PL+ A+F
Sbjct:   91 LGCTVELSQLGEHIRKPIGVLLAAVCQFVLMPLIAFLLALAFSLNDVAAMAVLLCGCCPGGNLSNIMTLLVNGDMNLSIIMTISSTLLALVLMPLCLWMYSRAWINTPVVDLLPFGPIILTLCSTLIPIGLGVWLRQRYIHVAEVIIKVSLWSLLVTLLMLFIMT-GTMLGPELLATIPASVYL--VAVLMPMAGYTAGYGLATLFDLPPNSRRTVSLETGCQNIQLCTAILKLAFPPQLMGGM-YMFPLLYALF 341          
BLAST of slc10a-2 vs. Ensembl Zebrafish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 93.2041 bits (230), Expect = 2.584e-20
Identity = 72/239 (30.13%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSC--AALGMMPLWLFALGRLFIDPKNVV--IPYDSIAINLLQVVLPVGIGIFVRXXX-XXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC +D   I ++L KP    I   +Q+  MP  +  L KL  +    +L +L+ GC PGG  SNI+ +   GD+NLS+ MT  S+    A+  + L+L++ G       N+V  +P+  I  +L+ +++P GIGI + ++  +    +    + +M I  I+  +  G      I+K++     L+   A +P  G+IFGY+L+   R N+     +++E G QNI +   ILK + P
Sbjct:   52 LGCTMDISKIKDHLMKPKGVVIAVGAQYGIMPFTAFCLAKLFRLSPMESLSVLICGCCPGGNLSNIFALALQGDMNLSIVMTACSTVLALAMMPLLLYLYSWGF-----SNLVDFVPFTGIIFSLILILVPCGIGILLNYRVPQYSKIITQAGLTLMLISCIVIGVLAGVADGGQIFKVLSSQ--LVATAALMPLTGYIFGYILSALFRMNEPCRRTVSMEVGCQNIQLCTTILKVAFP 283          
BLAST of slc10a-2 vs. Ensembl Zebrafish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 93.2041 bits (230), Expect = 2.584e-20
Identity = 72/239 (30.13%), Postives = 124/239 (51.88%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSC--AALGMMPLWLFALGRLFIDPKNVV--IPYDSIAINLLQVVLPVGIGIFVRXXX-XXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC +D   I ++L KP    I   +Q+  MP  +  L KL  +    +L +L+ GC PGG  SNI+ +   GD+NLS+ MT  S+    A+  + L+L++ G       N+V  +P+  I  +L+ +++P GIGI + ++  +    +    + +M I  I+  +  G      I+K++     L+   A +P  G+IFGY+L+   R N+     +++E G QNI +   ILK + P
Sbjct:   52 LGCTMDISKIKDHLMKPKGVVIAVGAQYGIMPFTAFCLAKLFRLSPMESLSVLICGCCPGGNLSNIFALALQGDMNLSIVMTACSTVLALAMMPLLLYLYSWGF-----SNLVDFVPFTGIIFSLILILVPCGIGILLNYRVPQYSKIITQAGLTLMLISCIVIGVLAGVADGGQIFKVLSSQ--LVATAALMPLTGYIFGYILSALFRMNEPCRRTVSMEVGCQNIQLCTTILKVAFP 283          
BLAST of slc10a-2 vs. Ensembl Xenopus
Match: ENSXETT00000008686.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 146.362 bits (368), Expect = 9.728e-39
Identity = 94/256 (36.72%), Postives = 145/256 (56.64%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIF---LLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC +D      ++K+P    +GF+ QF  MPL +  L     I    A+ +L++GC PGG +SNI      GD++LS++MT  S+  ALGMMPL LF   + ++D  ++VIPYDSI I+L+ +V+PVGIGIFV  KW +++K ++K   + G I I+ +   G      +YK  G +     L  +G   P  G+ FG+ LA  +++  ++   +ALETG QN  +   I++ S    D  +    PLI ++F
Sbjct:   57 FSMGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGG----VLYK--GSWTIAPSLWIVGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 306          
BLAST of slc10a-2 vs. Ensembl Xenopus
Match: ENSXETT00000008944.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 145.976 bits (367), Expect = 1.154e-38
Identity = 94/256 (36.72%), Postives = 145/256 (56.64%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIF---LLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC +D      ++K+P    +GF+ QF  MPL +  L     I    A+ +L++GC PGG +SNI      GD++LS++MT  S+  ALGMMPL LF   + ++D  ++VIPYDSI I+L+ +V+PVGIGIFV  KW +++K ++K   + G I I+ +   G      +YK  G +     L  +G   P  G+ FG+ LA  +++  ++   +ALETG QN  +   I++ S    D  +    PLI ++F
Sbjct:   47 FSMGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGG----VLYK--GSWTIAPSLWIVGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 296          
BLAST of slc10a-2 vs. Ensembl Xenopus
Match: ENSXETT00000008699.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 145.591 bits (366), Expect = 1.204e-38
Identity = 94/256 (36.72%), Postives = 145/256 (56.64%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIF---LLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC +D      ++K+P    +GF+ QF  MPL +  L     I    A+ +L++GC PGG +SNI      GD++LS++MT  S+  ALGMMPL LF   + ++D  ++VIPYDSI I+L+ +V+PVGIGIFV  KW +++K ++K   + G I I+ +   G      +YK  G +     L  +G   P  G+ FG+ LA  +++  ++   +ALETG QN  +   I++ S    D  +    PLI ++F
Sbjct:   42 FSMGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGG----VLYK--GSWTIAPSLWIVGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 291          
BLAST of slc10a-2 vs. Ensembl Xenopus
Match: ENSXETT00000008959.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 145.591 bits (366), Expect = 1.337e-38
Identity = 94/256 (36.72%), Postives = 145/256 (56.64%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIF---LLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC +D      ++K+P    +GF+ QF  MPL +  L     I    A+ +L++GC PGG +SNI      GD++LS++MT  S+  ALGMMPL LF   + ++D  ++VIPYDSI I+L+ +V+PVGIGIFV  KW +++K ++K   + G I I+ +   G      +YK  G +     L  +G   P  G+ FG+ LA  +++  ++   +ALETG QN  +   I++ S    D  +    PLI ++F
Sbjct:   44 FSMGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGG----VLYK--GSWTIAPSLWIVGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 293          
BLAST of slc10a-2 vs. Ensembl Xenopus
Match: SLC10A6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:NCBI gene;Acc:100488946])

HSP 1 Score: 129.028 bits (323), Expect = 8.631e-33
Identity = 91/256 (35.55%), Postives = 146/256 (57.03%), Query Frame = 2
Query:  569 LTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDY-IFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            + F MGC ++   +  +L++P    IG V QF  MPLI+  L     ++ + A+ +L++GC PGG  SNI+T+   GD++LS++MT  S+  ALGMMP  LF   R +   K++ IPY +I + L  VV+PVG G+FV +KW  ++K++ K   I+G + ++ +      A+  +YK   D  + +L I    P LG+I G+ LA+  ++  K+   IALETG QN+ ++  +L+ S            P+I A F
Sbjct:   40 VVFSMGCTVEALKVWGHLRRPWGIIIGLVCQFGLMPLIAYLLAITFSVKPTQAVAILIMGCCPGGVISNIFTLWVDGDMDLSISMTSCSTILALGMMPFCLFIYSRSWELAKSIKIPYYNIGMALFSVVIPVGFGVFVNYKWPNQAKIISKAGSIIGGLLMLVI----GVASAVLYKGSWDTDLSILLIAIIYPLLGYISGFGLAVIVQQPWKRCRTIALETGAQNVHLSSTVLQLSFTPKQLVQMFTFPMIYASF 291          
BLAST of slc10a-2 vs. Ensembl Mouse
Match: Slc10a2 (solute carrier family 10, member 2 [Source:MGI Symbol;Acc:MGI:1201406])

HSP 1 Score: 141.354 bits (355), Expect = 4.013e-37
Identity = 104/305 (34.10%), Postives = 161/305 (52.79%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG--TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSE-DTEMKSNTDEQKNVL--LDESPK 1474
            F MGC ++    L ++K+P   F+GF+ QF  MPL    L   SGI    A+ +L++GC PGG  SNI      GD++LS++MT  S+  ALGMMPL LF   ++++D   +VIPYDSI I+L+ +V+PV  G+FV  KW +K+K+++K   I G+I I+ +   G   Y + +I +       L  IG   P  G+  G+ LA    +   +   +ALETG QN  +   I++ S    D ++    PLI  +F  +     +AA+++           + D E    TD + +     DE+ K
Sbjct:   47 FSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPK-----LWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLV-----FAAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNK 341          
BLAST of slc10a-2 vs. Ensembl Mouse
Match: Slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Source:MGI Symbol;Acc:MGI:1923000])

HSP 1 Score: 128.642 bits (322), Expect = 2.155e-32
Identity = 82/234 (35.04%), Postives = 138/234 (58.97%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFS 1276
            F  GC ++   +  +L++P    +G +SQF  MPL +  L    G++   A+ +L++G  PGG  SN+ T    GD++LS++MT  S+ AALGMMPL L+   R +   +N+VIPY SI I L+ +V+PV  G++V ++W +++ V++K   I+G + ++ V   G    + + K     + LL I    P +G + G+LLA  T ++ ++   I++ETG QNI + I +L+ S
Sbjct:   47 FSFGCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAIGFGLKPFQAIAVLMMGSCPGGTISNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYIYTRSWTLTQNLVIPYQSIGITLVSLVVPVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAVTG----MVLAKGWNTDVTLLVISCIFPLVGHVTGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMLQLS 276          
BLAST of slc10a-2 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 117.472 bits (293), Expect = 7.252e-29
Identity = 81/237 (34.18%), Postives = 127/237 (53.59%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPK-NVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIM--GIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC ++   I  +  KP    I  V+Q+  MPL +  LGK+  + +  AL +L+ GCSPGG  SN++T+   GD+NLS+ MT  SS  ALGMMPL L+   +   D      +PY  I ++L+ V++P  IGIF++ K       ++K   I+   +   + VLS     N  ++ +      LL   + +P+ GF+ GY+L+   R N      I++ETGFQN+ +   IL  + P
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPH---LLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP 275          
BLAST of slc10a-2 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 118.242 bits (295), Expect = 7.309e-29
Identity = 81/237 (34.18%), Postives = 127/237 (53.59%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPK-NVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIM--GIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC ++   I  +  KP    I  V+Q+  MPL +  LGK+  + +  AL +L+ GCSPGG  SN++T+   GD+NLS+ MT  SS  ALGMMPL L+   +   D      +PY  I ++L+ V++P  IGIF++ K       ++K   I+   +   + VLS     N  ++ +      LL   + +P+ GF+ GY+L+   R N      I++ETGFQN+ +   IL  + P
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPH---LLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP 275          
BLAST of slc10a-2 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 118.242 bits (295), Expect = 7.309e-29
Identity = 81/237 (34.18%), Postives = 127/237 (53.59%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPK-NVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIM--GIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC ++   I  +  KP    I  V+Q+  MPL +  LGK+  + +  AL +L+ GCSPGG  SN++T+   GD+NLS+ MT  SS  ALGMMPL L+   +   D      +PY  I ++L+ V++P  IGIF++ K       ++K   I+   +   + VLS     N  ++ +      LL   + +P+ GF+ GY+L+   R N      I++ETGFQN+ +   IL  + P
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPH---LLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP 275          
BLAST of slc10a-2 vs. UniProt/SwissProt
Match: sp|P70172|NTCP2_MOUSE (Ileal sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a2 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 2.807e-36
Identity = 104/305 (34.10%), Postives = 161/305 (52.79%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG--TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSE-DTEMKSNTDEQKNVL--LDESPK 1474
            F MGC ++    L ++K+P   F+GF+ QF  MPL    L   SGI    A+ +L++GC PGG  SNI      GD++LS++MT  S+  ALGMMPL LF   ++++D   +VIPYDSI I+L+ +V+PV  G+FV  KW +K+K+++K   I G+I I+ +   G   Y + +I +       L  IG   P  G+  G+ LA    +   +   +ALETG QN  +   I++ S    D ++    PLI  +F  +     +AA+++           + D E    TD + +     DE+ K
Sbjct:   47 FSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPK-----LWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLV-----FAAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNK 341          
BLAST of slc10a-2 vs. UniProt/SwissProt
Match: sp|Q62633|NTCP2_RAT (Ileal sodium/bile acid cotransporter OS=Rattus norvegicus OX=10116 GN=Slc10a2 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.233e-36
Identity = 102/295 (34.58%), Postives = 157/295 (53.22%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG--TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSE-DTEMKSNTDEQKN 1450
            F MGC ++ +  L ++K+P   F+GF+ QF  MPL    L   SGI    A+ +L++GC PGG  SNI      GD++LS++MT  S+  ALGMMPL LF   ++++D   +VIPYDSI I+L+ +V+PV IG+FV  KW +K+K+++K   I G I I+ +   G   Y + +I +       L  IG   P  G+  G+ LA    +   +   +ALETG QN  +   I++ S    D ++    PLI  +F  +     +AA+++           + D E    TD   +
Sbjct:   47 FSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPK-----LWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLV-----FAAIILGMYVTYKKCHGKNDAEFLEKTDNDMD 331          
BLAST of slc10a-2 vs. UniProt/SwissProt
Match: sp|Q60414|NTCP2_CRIGR (Ileal sodium/bile acid cotransporter OS=Cricetulus griseus OX=10029 GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.936e-35
Identity = 97/291 (33.33%), Postives = 154/291 (52.92%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSE-DTEMKSNTDEQ 1444
            F MGC ++    L +L++P    +GF+ QF  MPL    L    GI    A+ +L+ GC PGG ASNI      GD++LS++MT  S+  ALGMMPL LF   ++++D   +VIPYDSI  +L+ +V+PV IG++V  KW +K+K+++K   I G I I+ +   G       + +      L  IG   P  G+  G+ LA    +   +   +ALETG QN  +   I++ S    D ++    PLI ++F      + +AA+++           + +TE++  TD +
Sbjct:   47 FSMGCNVELHKFLGHLRRPWGIVVGFLCQFGIMPLTGFVLSVAFGILPVQAVVVLIQGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGTSLVALVIPVSIGMYVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWTIEPK---LWIIGTIYPIAGYGLGFFLARIAGQPWYRCRTVALETGLQNTQLCSTIVQLSFSPEDLNLVFTFPLIYSIFQ-----IAFAAILLGAYVAYKKCHGKNNTELQEKTDNE 329          
BLAST of slc10a-2 vs. UniProt/SwissProt
Match: sp|Q28727|NTCP2_RABIT (Ileal sodium/bile acid cotransporter OS=Oryctolagus cuniculus OX=9986 GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.232e-33
Identity = 92/255 (36.08%), Postives = 141/255 (55.29%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYG--TYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC ++    L ++++P   FIGF+ QF  MPL    L    GI    A+ +L++GC PGG ASNI      GD++LS++MT  S+  ALGMMPL L+   ++++D   +VIPYD+I  +L+ +V+PV IG+FV  KW +K+K+++K   I G + I+ +   G   Y + +I +       L  IG   P  G+  G+ LA    +   +   +ALETG QN  +   I++ S    D       PLI ++F
Sbjct:   48 FSMGCNVEIKKFLGHIRRPWGIFIGFLCQFGIMPLTGFVLAVAFGIMPIQAVVVLIMGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLYVYTKMWVDSGTIVIPYDNIGTSLVALVVPVSIGMFVNHKWPQKAKIILKVGSIAGAVLIVLIAVVGGILYQSAWIIEPK-----LWIIGTIFPMAGYSLGFFLARIAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLTYVFTFPLIYSIF 297          
BLAST of slc10a-2 vs. UniProt/SwissProt
Match: sp|Q9CXB2|SOAT_MOUSE (Solute carrier family 10 member 6 OS=Mus musculus OX=10090 GN=Slc10a6 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.508e-31
Identity = 82/234 (35.04%), Postives = 138/234 (58.97%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFS 1276
            F  GC ++   +  +L++P    +G +SQF  MPL +  L    G++   A+ +L++G  PGG  SN+ T    GD++LS++MT  S+ AALGMMPL L+   R +   +N+VIPY SI I L+ +V+PV  G++V ++W +++ V++K   I+G + ++ V   G    + + K     + LL I    P +G + G+LLA  T ++ ++   I++ETG QNI + I +L+ S
Sbjct:   47 FSFGCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAIGFGLKPFQAIAVLMMGSCPGGTISNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYIYTRSWTLTQNLVIPYQSIGITLVSLVVPVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAVTG----MVLAKGWNTDVTLLVISCIFPLVGHVTGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMLQLS 276          
BLAST of slc10a-2 vs. TrEMBL
Match: A0A0H3YJ17 (Slc10a-2 OS=Schmidtea mediterranea OX=79327 GN=slc10a-2 PE=2 SV=1)

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 462/462 (100.00%), Postives = 462/462 (100.00%), Query Frame = 2
Query:   92 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKNVLLDESPKD 1477
            MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIKKKCCKSSKQSEDTEMKSNTDEQKNVLLDESPKD
Sbjct:    1 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIKKKCCKSSKQSEDTEMKSNTDEQKNVLLDESPKD 462          
BLAST of slc10a-2 vs. TrEMBL
Match: A0A0H3YF76 (Slc10a-5 OS=Schmidtea mediterranea OX=79327 GN=slc10a-5 PE=2 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 2.522e-156
Identity = 262/457 (57.33%), Postives = 339/457 (74.18%), Query Frame = 2
Query:   92 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNS---SSFFKLKTFEMDSVILNETFTYY-LNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKN 1450
            M++L+I        +  +     R  NG   S   S+   +K FE + V  +  F     N TF+  + FK  C  DY KVG L+NW + Q+   +  N  +  +  V +KRLG SN+IC++ L +++  K+ E+K+ ++IV R  T+AEL+FRI+VSIFVIFLTFVMGCGLD++IIL YLKKPISP IGF SQF+FMPL+SAALGK +GI  +F LGLL IGCSPGGGASNIWT+L+GGD++LS+TMTFISSCAAL MMP W+F L R FIDP +V IPY SI +NLLQ+VLPVGIGI  +WKW++ ++ LVKKVKIMG++F+IF+L+YG+YAN YIYKL+GDY +LLPIGA LPWLGF FG++L++ TRR K QAIAI+LETGFQNIGIAILILKFSMPQPDGD+G+VMP+IVA+FTP+PLYVG   + IKK   K  + + + +M    ++ K 
Sbjct:    1 MKILIIALFSVITVDSKE----QRIINGINQSIPMSNISPIKLFEGEKVFFSNNFNLSPSNETFLGNATFK--CWMDYEKVGVLINWKNKQIQIGSTSNVSVNFSVLVLAKRLGGSNLICSLNLSNNSRVKM-EKKLIEIIVSRKQTVAELIFRIVVSIFVIFLTFVMGCGLDKEIILGYLKKPISPLIGFCSQFVFMPLVSAALGKFTGIHPAFGLGLLTIGCSPGGGASNIWTILFGGDMDLSITMTFISSCAALAMMPFWMFILSRFFIDPNSVQIPYGSIGLNLLQIVLPVGIGIAFQWKWDKAAETLVKKVKIMGLVFVIFILTYGSYANFYIYKLMGDYTYLLPIGALLPWLGFFFGFILSVVTRRKKSQAIAISLETGFQNIGIAILILKFSMPQPDGDLGSVMPIIVALFTPMPLYVGMLFIYIKKCLSKPEQLATEVKMDPVVEQTKE 450          
BLAST of slc10a-2 vs. TrEMBL
Match: A0A0H3YEZ4 (Slc10a-3 OS=Schmidtea mediterranea OX=79327 GN=slc10a-3 PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 7.056e-140
Identity = 227/407 (55.77%), Postives = 307/407 (75.43%), Query Frame = 2
Query:  182 NSSSFFKLKTF-------EMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTV--FSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVI 1375
            N SS F  + F       E +S  L  +  Y L +   +   F +NC  DY KVG L NWTD++    ++  ++ + NFT+  ++KRLGS+ + C +   D N   V++QKI +LIV+R  T+ ELVFRI+++IFV+ +TFVMGCG+DR  +  Y+KKPISP IGF SQF+FMPL+SA L KL GI+ +F LGLL IGCSPGGG+SN+WTV++GGDLNLSMTMTFISSCAAL MMPLWLF L R+F+DP  + IP+D+IA NLL VV+PV +GI  RWK+E K+  ++K  K++G+ F++F+L++G YAN YI++L+ DY++LLP+GA LPW+GF  GYLL+L TRR KKQ+IAI+LETGFQN+GIAI+ILK+S+PQP+GD+GAVM +IV++FTP+PLYV Y  + I
Sbjct:   21 NISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSI--NLTQFNFTINLYAKRLGSAYLECQLKSND-NLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFI 424          
BLAST of slc10a-2 vs. TrEMBL
Match: A0A1S3ISZ8 (ileal sodium/bile acid cotransporter OS=Lingula unguis OX=7574 GN=LOC106166944 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 3.081e-87
Identity = 144/325 (44.31%), Postives = 220/325 (67.69%), Query Frame = 2
Query:  494 QLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKNVLLDES 1468
             L+V+R P + + +FR + +  V  +TF MGC L+ + +   LKKP++P +GF SQ++ MPL++ A+ +++ +E +F LGLL IGCSPGGGASNIWTVL GG+L LS+TMTF+S+C ALGMMPLWLF LGR F+D   + IPYD++A  +  +V PV +G+ +     + +    + ++ + +IF+I++ ++G Y N +I+ L+ D+ +LL +G   PW G+IFG+ LA   R+ K++AI IALETG QNIGI ++IL+FS+PQPDGD+G++MP +  +   LPLY+   AL IK++CC      E      +  E  N + + +
Sbjct:  150 DLVVIRAPRLIDQIFRYVTTTLVAIITFFMGCTLNIETVKGILKKPVAPLLGFCSQYVMMPLLAFAVSQITQVEPAFGLGLLTIGCSPGGGASNIWTVLLGGELELSITMTFLSTCLALGMMPLWLFLLGRFFVDESKIKIPYDNVATTIATLVGPVALGLLLHLWKPKLAMKCKRLIRPLALIFLIYIYTFGMYVNWFIWGLLADHSYLLAVGIITPWCGYIFGFFLAKIFRQPKRRAITIALETGIQNIGIPMIILRFSLPQPDGDLGSLMPSLQGLSQMLPLYLILIALTIKRRCCDKGDDEESERELKDISEVDNSVCNSA 474          
BLAST of slc10a-2 vs. TrEMBL
Match: A0A1S3ISY8 (sodium/bile acid cotransporter OS=Lingula unguis OX=7574 GN=LOC106166935 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.740e-85
Identity = 170/411 (41.36%), Postives = 254/411 (61.80%), Query Frame = 2
Query:  227 VILNETFTYYLNSTFVNVSNFK--LNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNST---KVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQ 1444
            V+ N  F +     F N S F+  ++C    L  G  +  TDI L            NF   +++  + N+       D N+T   KV+E     ++V+R     +  FR++ S FV FLT +MGC LD  I+ + LKKP++P IGF SQ++ MPL++ A+G+++ IE++F LGLL IGCSPGGG+SN+WT+L GG+L LS+TMTF+S+C +LG+MPLWLF LGR +ID   + IPY SIA+ +  +V P+ IGI  R      +    + ++ + +IFI++V S+G Y NLY++ L+G    L+ +GA  PW GF+FG+++A   R+ +K+AI I+LETG QNIGI ILIL+FS+ QP+GD+ A+ P+I ++    P      AL IK KC    K+ +D   K + +E+
Sbjct:   95 VLQNNNFIFSTEG-FKNGSKFERSMSCSGQLLIKGLRLGRTDITL------------NFYKIAEK--NDNVYTDGAHLDDNTTSILKVYED----VVVIRKRRPIDTAFRVVTSAFVAFLTMLMGCTLDMGIVRDILKKPLAPAIGFASQYVLMPLLAFAVGQITQIEDAFGLGLLTIGCSPGGGSSNVWTILLGGELELSITMTFLSTCVSLGVMPLWLFLLGRFYIDESKIKIPYASIAVTIASLVGPILIGILFRLWKPHMADKTKRLIRPLALIFIVYVYSFGVYVNLYMWILMGKRPRLIGVGALTPWCGFLFGFVIAKIFRQPRKRAITISLETGIQNIGIPILILQFSLAQPEGDLAAIFPIIQSICQMFPPISALIALTIKHKCFDKGKKFKDAVEKKDGNEK 486          
BLAST of slc10a-2 vs. Ensembl Cavefish
Match: slc10a2 (solute carrier family 10 member 2 [Source:NCBI gene;Acc:103029770])

HSP 1 Score: 126.716 bits (317), Expect = 8.153e-32
Identity = 88/262 (33.59%), Postives = 143/262 (54.58%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIF---------IIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            F MGC +D   + +++++P   FIGF+ QF  MP ++ AL     +    A+ ++++GC PGG +SNI      GD++LS++MT  SS  ALGMMPL L     ++     + IPYDSI I L+ +++PV +G+FV+ KW + +K ++K   I+GI+          +++  S+     L+I            IG   P++GF  G+LLA    +   +   IALETGFQN  +   I++ S    + ++    PLI ++F
Sbjct:   48 FSMGCTVDAPKLWSHIRRPWGIFIGFLCQFGIMPFVAFALSLAFQVLPVQAVVIMIMGCCPGGSSSNIIAYWLEGDMDLSISMTTCSSILALGMMPLCLLIYTSVWTSADTIQIPYDSIGITLVSLLIPVSVGMFVKHKWPKVAKKILKVGSIVGILLIIIIAVVGGVLYQSSWTIAPALWI------------IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGFQNSQLCSTIVQLSFAPEELEVMFAFPLIYSIF 297          
BLAST of slc10a-2 vs. Ensembl Cavefish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 114.775 bits (286), Expect = 1.473e-27
Identity = 83/237 (35.02%), Postives = 131/237 (55.27%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXX-XXIMGIIFIIFVLSYGTYANLYIYKLIGDYI--FLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            +GC +D   I +++ KP    I  V+Q+  MPL + +L KL  +     + +LV GCSPGG  SNI  +   GD+NLS+ MT  S+  ALGMMPL L+   + F   +N V PY +I I+L+  ++P  +GIF+ +K  + +K++ K  + IMG+ F     +    A++ + K I       L+   A +P +G++ GYLL+   R N      +A+ETG QN  +   IL+ + P
Sbjct:  108 LGCTMDVWKIKDHIWKPKGVAIAVVAQYGIMPLSAFSLAKLLQLGPMETVAVLVCGCSPGGNLSNILALAIKGDMNLSIVMTTCSTVLALGMMPLLLYLYCQSFPGLENAV-PYGNITISLVMTLVPCAVGIFINYKVPKYAKIVTKVGMSIMGLAFT----ALAILASITLGKTILTVTSPALMTTAALMPLIGYVLGYLLSALFRLNPACRRTVAVETGCQNNQLCASILRVAFP 339          
BLAST of slc10a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000012978.2 (sodium/bile acid cotransporter-like [Source:NCBI gene;Acc:103037734])

HSP 1 Score: 105.531 bits (262), Expect = 1.357e-24
Identity = 86/258 (33.33%), Postives = 139/258 (53.88%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGI-IFIIFVLSYGTYANLYIYKLIGDYIFLLP----IGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGA--VMPLIVAMF 1333
            +GC ++   I  ++ +P    I  VSQF  MPL + +L K+  +    A+ +L+ GC PGG  SNI+ +   GD+NLS+ MT  S+  ALG MP  LF   + F   +N V PY  I I L+  ++P  IGI +       S +++K    +GI I +I   + G  A + I   +  ++ L P    + + +P +G++ GY+L+   ++N +    IA+ETG QNI +   ILK +  +P+ D+G   + PLI  +F
Sbjct:   55 LGCTMEIAKIKAHVLRPKGVGIALVSQFGIMPLTAFSLAKVFQLGAIEAVTVLICGCCPGGNLSNIFALALQGDMNLSIVMTTCSTVTALGAMPFLLFLYCQGFSGLENAV-PYAGIIIALIMTLVPCAIGIAINHWAPRYSPLIIK----VGISILLIASAAIGVMAGITIGGTV--WVVLSPKLMAVASLMPLIGYLLGYILSTVFKQNGQCKRTIAVETGCQNIQLCSTILKVAF-RPE-DIGPLYLFPLIYIIF 303          
BLAST of slc10a-2 vs. Ensembl Cavefish
Match: slc10a3 (solute carrier family 10 member 3 [Source:NCBI gene;Acc:103043696])

HSP 1 Score: 73.559 bits (179), Expect = 1.449e-13
Identity = 68/255 (26.67%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  584 GCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXX------IMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAM 1330
            GC ++ +++   LK+P+   +G + QFL MPL      +L+ +  + +LGL++   +PGGG   ++++L GGD+ L++ MT +S+  A   MPL     G L      + +P+  I   LL + +P+ +G+ V+ +    ++VL+  ++      I+G IF+ + +     A++    ++        +GA  P LG + G  LA        Q   + +E G QN  +A+ +++ S  + + D  +  P IVA+
Sbjct:  188 GCKVEVEVLRGLLKRPVPLLLGVLGQFLVMPLYGYGAARLASLPKALSLGLVITCSAPGGGGGYLYSLLLGGDVTLAICMTLVSTVVATAAMPLSSALYGHLLGVHATLRVPFVKILGTLLFIAIPISLGVLVKLRLPGLARVLLALIRPFSFVLIVGGIFMAYQMGASILADVRPRVVL--------VGAAAPVLGLLLGLGLAWLAGLPAPQRKTVGIEVGVQNSLLALAVMQLSFRRAEADFASQAPFIVAL 434          
BLAST of slc10a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000002522.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:63123281:63123706:1 gene:ENSAMXG00000002468.2 transcript:ENSAMXT00000002522.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 6.812e-9
Identity = 24/77 (31.17%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNL 811
            +GC  +   +  + ++P+   +  + QF+ MPL++  L     +++  A+ +L+ GC PGG  SNI T+L  G++NL
Sbjct:   50 LGCTAEVRELREHARRPVGVLLAALCQFVLMPLLAFVLALAFSLDDGAAVAVLLCGCCPGGNLSNIMTLLVNGEMNL 126          
BLAST of slc10a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007971.1 (pep scaffold:Pmarinus_7.0:GL476805:176592:179698:-1 gene:ENSPMAG00000007193.1 transcript:ENSPMAT00000007971.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 6.676e-34
Identity = 85/247 (34.41%), Postives = 143/247 (57.89%), Query Frame = 2
Query:  569 LTFVM---GCGLDRDIILNYLKKPISPF-IGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIF-----VLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            + FVM   GC +  D IL +LK+P +   +GFV QF  MPL + AL +   + ++ A  +L++GC PGG ASN+ +    GD++LS++MT +S+   LGMMPL L+   R ++D    VIPY++I I L  +V+PV +G+ +R K    +  ++K   ++G + ++      ++SY +  N+ ++           I A LP +GF+ GY+LA+  R+   +   I++ETG Q+I +   +L+ S P
Sbjct:   42 MCFVMLALGCSVCLDRILQHLKRPWAGLTVGFVCQFGVMPLAAFALARGLRLGSAEASAVLILGCCPGGLASNLISYWLDGDMDLSISMTIVSTILGLGMMPLCLYIYSRSWLDDTTFVIPYNTIGITLALLVIPVILGMLLRHKCPVHACRMLKLGTVVGSLVLVVTAVLGIISYNSLQNMSMHIWF--------IAAALPLIGFLLGYVLAMLFRQPPFRCRTISVETGAQSIHLCSGVLQISFP 280          
BLAST of slc10a-2 vs. Ensembl Sea Lamprey
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 120.939 bits (302), Expect = 6.135e-31
Identity = 87/251 (34.66%), Postives = 134/251 (53.39%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXX----XXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIF------LLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSM-PQPDGDM 1300
            +GC ++ + I  +L+KP   FI  ++QF  MPL + AL K+  +    A+ +L+ GC PGG  SN++ +   GD+NLS+ MT  S+  ALGMMPL L+A      D +  VIPY  I+I L  ++LP   GIF+  K         +  +  + + GI+FI+ +  Y           +G  I+      L+ IG  +P LGF+ G+ LA     + K   AI++ETGFQN+ +   IL+ +  PQ  G +
Sbjct:   56 LGCTMELEHIGAHLRKPRGIFIAVLAQFGIMPLTAFALAKVFRLNPVEAVTVLICGCCPGGNLSNVFALALDGDMNLSILMTTCSNVLALGMMPLLLWAYSHGLSDTR-FVIPYGKISITLALILLPCAAGIFINAKFPKYSRMMLRAGMALLLVTGIVFIVLMALY-----------MGSIIWLVFSPTLISIGVLMPLLGFMLGFFLAGLFHLSYKCRRAISMETGFQNLQLCSAILRLTFDPQVIGPL 294          
BLAST of slc10a-2 vs. Ensembl Sea Lamprey
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 69.707 bits (169), Expect = 3.326e-14
Identity = 59/174 (33.91%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  815 MTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYI-FLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMF 1333
            ++MT  S+   +GMMPL LF   + + D  ++ IPYDSI I L+ +V+PV  G+FV++KW +K+K+LVK   ++G I II +    + A   +Y+   D    +  IG   P +G++ G+ LA    +  ++   IA+ETG QN  +   I++ S            PLI + F
Sbjct:    1 ISMTVCSTLLGMGMMPLCLFIYTQTWTDSASIAIPYDSIGITLVSLVVPVAFGMFVQYKWPKKAKILVKIGSVLGGILIIAI----SVAGALLYQGAWDTEPAMWIIGCIFPIIGYVLGFGLAKLVNQPWQRCRTIAMETGAQNSQLCTTIVQLSFTPEQLVRMFTFPLIYSAF 170          
BLAST of slc10a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011394.1 (pep scaffold:Pmarinus_7.0:GL476582:173651:174025:-1 gene:ENSPMAG00000010367.1 transcript:ENSPMAT00000011394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 8.828e-13
Identity = 34/79 (43.04%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  575 FVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNL 811
            F MGC +    ++ +L+ P    IGFV QF FMPL + AL     IE   A+ +L++GC PGG  SNI T    GD++L
Sbjct:   47 FAMGCTVQIHKVIAHLRNPWGIIIGFVCQFGFMPLTAFALAIAFKIEPIQAIAVLIMGCCPGGTTSNIITYWLDGDMDL 125          
BLAST of slc10a-2 vs. Ensembl Medaka
Match: slc10a4 (solute carrier family 10 member 4 [Source:NCBI gene;Acc:101175384])

HSP 1 Score: 102.449 bits (254), Expect = 1.306e-23
Identity = 72/253 (28.46%), Postives = 128/253 (50.59%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFID-PKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVM-PLIVAMF 1333
            +GC ++   +  ++++PI   +  + QF+ MPL++  L     +++  A+ +L+ GC PGG  SNI ++L  G++NLS+ MT  S+  AL +MPL L+   R +I+ P   ++P+ +I + L   ++P+G+G+ +R++                   +  VL     A++Y             +   +P  G+  GY LA+          A++LETG QN+ +   ILK + P P    G  M PL+ A+F
Sbjct:   52 LGCTVEVSQLREHIRRPIGVLLALLCQFVIMPLVAFLLALAFSLDDVAAMAVLLCGCCPGGNLSNIMSLLVHGEMNLSIIMTISSTLLALVLMPLCLWIYSRAWINTPVVELLPFGAITLTLCSTLIPIGLGVLLRYRHTR----------------VADVLLSTIPASVYA------------VAVLMPLCGYAAGYGLAVLFDLPPSSRRAVSLETGCQNVQLCTAILKMAFP-PQLMGGLYMFPLLYALF 275          
BLAST of slc10a-2 vs. Ensembl Medaka
Match: slc10a4 (solute carrier family 10 member 4 [Source:NCBI gene;Acc:101175384])

HSP 1 Score: 102.064 bits (253), Expect = 1.433e-23
Identity = 72/253 (28.46%), Postives = 131/253 (51.78%), Query Frame = 2
Query:  581 MGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFID-PKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVM-PLIVAMF 1333
            +GC ++   +  ++++PI   +  + QF+ MPL++  L     +++  A+ +L+ GC PGG  SNI ++L  G++NLS+ MT  S+  AL +MPL L+   R +I+ P   ++P+ +I + L   ++P+G+G+ +R++    +                 VL  G    + +   + + +F   +   +P  G+  GY LA+          A++LETG QN+ +   ILK + P P    G  M PL+ A+F
Sbjct:   58 LGCTVEVSQLREHIRRPIGVLLALLCQFVIMPLVAFLLALAFSLDDVAAMAVLLCGCCPGGNLSNIMSLLVHGEMNLSIIMTISSTLLALVLMPLCLWIYSRAWINTPVVELLPFGAITLTLCSTLIPIGLGVLLRYRHTRVAD---------------VVLKVG---EVTVCVCVWESLF-YAVAVLMPLCGYAAGYGLAVLFDLPPSSRRAVSLETGCQNVQLCTAILKMAFP-PQLMGGLYMFPLLYALF 290          
BLAST of slc10a-2 vs. Ensembl Medaka
Match: SLC10A1 (sodium/bile acid cotransporter [Source:NCBI gene;Acc:101171045])

HSP 1 Score: 91.6633 bits (226), Expect = 7.166e-20
Identity = 64/188 (34.04%), Postives = 105/188 (55.85%), Query Frame = 2
Query:  725 ALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGII--FIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMP 1282
            A+ +L+ GC PGG  SNI++++  GD+NLS+ MT  S+ AALG+MPL L  L + F   +  V PY  I   +L  +L   IGI +     + S ++ K    + +I    +F+LS     ++    ++ D   LL   A +P +GF  GY+L++  + + + +  +++ETGFQNI +   ILK + P
Sbjct:   79 AVTVLICGCCPGGTLSNIFSLIVKGDMNLSIVMTTCSTFAALGLMPLLLCILCQGFPGLQKAV-PYVGIVTTILCTLLASTIGILINHYKPKYSLIVKKTGLWILLISSITLFILSAYVVKDVLWMIVMAD---LLTAAALMPLIGFTLGYVLSVICKLSPQCSRTVSMETGFQNIQLCTAILKVAFP 262          
BLAST of slc10a-2 vs. Ensembl Medaka
Match: slc10a3 (solute carrier family 10 member 3 [Source:NCBI gene;Acc:101169937])

HSP 1 Score: 80.4925 bits (197), Expect = 8.652e-16
Identity = 65/255 (25.49%), Postives = 126/255 (49.41%), Query Frame = 2
Query:  584 GCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVR------XXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAM 1330
            GC ++ +++   L+ P+   +G V QFL MP  +  + +L  +  + +LGL++   +PGGG   ++++L GGD+ L+++MT +S+  A   MPL     GRL      + +P+  I   LL + +P+ +G+ ++       +           V ++G IF+ + +     AN+    ++        +G  +P LG   G +LA        Q   +++E G QN  +A+ +++ S  + + D  +  P IVA+
Sbjct:  196 GCKVEVEVLRGLLRSPVPLLLGVVGQFLVMPFYAYCVSRLISLPTALSLGLVITCSAPGGGGGYLYSLLLGGDVTLAISMTLVSTLVATAAMPLSSALYGRLLGVHAALHVPFVKILGTLLFIAIPISLGMLIKLRLPGLTRVLLVLIRPFSIVLMIGGIFMAYQMGASILANVSPEIVV--------VGVTVPLLGLAVGAVLAKLAGLPLPQKKTVSIEVGVQNSLLALAVMQLSFRRVEADFASQAPFIVAL 442          
BLAST of slc10a-2 vs. Planmine SMEST
Match: SMESG000064833.1 (SMESG000064833.1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 460/462 (99.57%), Postives = 460/462 (99.57%), Query Frame = 2
Query:   92 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKNVLLDESPKD 1477
            MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTF NVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAAL MMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIKKKCCKSSKQSEDTEMKSNTDEQKNVLLDESPKD
Sbjct:    1 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNETFTYYLNSTFANVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALAMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIKKKCCKSSKQSEDTEMKSNTDEQKNVLLDESPKD 462          
BLAST of slc10a-2 vs. Planmine SMEST
Match: SMESG000064830.1 (SMESG000064830.1)

HSP 1 Score: 462.611 bits (1189), Expect = 7.013e-160
Identity = 262/457 (57.33%), Postives = 339/457 (74.18%), Query Frame = 2
Query:   92 MRVLVIYFLFYCYANGHDLGFVGRFENGFQNS---SSFFKLKTFEMDSVILNETFTYY-LNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEMKSNTDEQKN 1450
            M++L+I        +  +     R  NG   S   S+   +K FE + V  +  F     N TF+  + FK  C  DY KVG L+NW + Q+   +  N  +  +  V +KRLG SN+IC++ L +++  K+ E+K+ ++IV R  T+AEL+FRI+VSIFVIFLTFVMGCGLD++IIL YLKKPISP IGF SQF+FMPL+SAALGK +GI  +F LGLL IGCSPGGGASNIWT+L+GGD++LS+TMTFISSCAAL MMP W+F L R FIDP +V IPY SI +NLLQ+VLPVGIGI  +WKW++ ++ LVKKVKIMG++F+IF+L+YG+YAN YIYKL+GDY +LLPIGA LPWLGF FG++L++ TRR K QAIAI+LETGFQNIGIAILILKFSMPQPDGD+G+VMP+IVA+FTP+PLYVG   + IKK   K  + + + +M    ++ K 
Sbjct:    1 MKILIIALFSVITVDSKE----QRIINGINQSIPMSNISPIKLFEGEKVFFSNNFNLSPSNETFLGNATFK--CWMDYEKVGVLINWKNKQIQIGSTSNVSVNFSVLVLAKRLGGSNLICSLNLSNNSRVKM-EKKLIEIIVSRKQTVAELIFRIVVSIFVIFLTFVMGCGLDKEIILGYLKKPISPLIGFCSQFVFMPLVSAALGKFTGIHPAFGLGLLTIGCSPGGGASNIWTILFGGDMDLSITMTFISSCAALAMMPFWMFILSRFFIDPNSVQIPYGSIGLNLLQIVLPVGIGIAFQWKWDKAAETLVKKVKIMGLVFVIFILTYGSYANFYIYKLMGDYTYLLPIGALLPWLGFFFGFILSVVTRRKKSQAIAISLETGFQNIGIAILILKFSMPQPDGDLGSVMPIIVALFTPMPLYVGMLFIYIKKCLSKPEQLATEVKMDPVVEQTKE 450          
BLAST of slc10a-2 vs. Planmine SMEST
Match: SMESG000064829.1 (SMESG000064829.1)

HSP 1 Score: 264.618 bits (675), Expect = 2.461e-84
Identity = 149/277 (53.79%), Postives = 196/277 (70.76%), Query Frame = 2
Query:  182 NSSSFFKLKTF-------EMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTV--FSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVR 985
            N SS F  + F       E +S  L  +  Y L +   +   F +NC  DY KVG L NWTD++    ++  ++ + NFT+  ++KRLGS+ + C +   D N   V++QKI +LIV+R  T+ ELVFRI+++IFV+ +TFVMGCG+DR  +  Y+KKPISP IGF SQF+FMPL+SA L KL GI+ +F LGLL IGCSPGGG+SN+WTV++GGDLNLSMTMTFISSCAAL MMPLWLF L R+F+DP  + IP+D+IA NLL VV+PV +GI  R
Sbjct:   21 NISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSI--NLTQFNFTINLYAKRLGSAYLECQLKSND-NLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFR 294          
BLAST of slc10a-2 vs. Planmine SMEST
Match: SMESG000060981.1 (SMESG000060981.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.962e-53
Identity = 120/304 (39.47%), Postives = 188/304 (61.84%), Query Frame = 2
Query:  569 LTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXXXXXIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVIXXXXXXXXXQSEDTEM----KSNTDEQKNVLLDES 1468
            L F++GC  + + I ++ KKP+   I   +Q++ MPL++  + KL  + N F  GLL + CSP    SN+WT+LY G+ +L +T+TF+S+  +L M+P W+F LGR + D K   IP  +I + +LQVV+PV +G+  R+KW+     L+K  KI+ IIFI F+L++G Y NLY++++I DY  L+PI A LPW GF+FG L+ + ++    Q+  I+++ G QNIG AILI+K+SM     D G ++P I+ + +   L VGY   +I  K  K   ++E+  M     S T  Q   LL+++
Sbjct:   16 LMFLVGCSTEIESIWSHSKKPMPLLIVLFAQYVIMPLLAFGISKLFFLNNEFGFGLLAVSCSPSCITSNMWTILYKGEKDLGLTLTFVSTLFSLFMIPFWVFCLGRFYFDFKIAQIPIRNIFLGVLQVVVPVVLGLIFRYKWKRWGLKLLKVFKILSIIFIWFLLTFGLYVNLYVFEVILDYPHLVPIVAVLPWCGFLFGLLIGIGSKHGFVQSKTISIKIGVQNIGFAILIVKYSMQGLYSDFGILIPFIILISSHALLLVGYICKLIFVKFHKKVVRNEENLMNFPVSSYTIYQPVFLLNDN 319          
BLAST of slc10a-2 vs. Planmine SMEST
Match: SMESG000046910.1 (SMESG000046910.1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.150e-18
Identity = 82/297 (27.61%), Postives = 143/297 (48.15%), Query Frame = 2
Query:  497 LIVLRHPTIAELXXXXXXXXXXXXLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRXXXXXXXXXXXX-----XXXIMGIIFIIFVLSYGTYANLYIYKLIGD----YIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGY 1360
            + VLR P  +  VF +  +     L   +GC LD  +   Y K+      G  SQ L +P I  ++ K+  ++N+   GL  + CSPGGG  +I   L  GD +LS  ++ I+     G   LW++AL  L+     +     ++A+ L  + +  GIG+ V +     ++ ++       + + GI+F+    + G Y N Y +  I       + LL +  FL  +G I GY    + +++K    ++++ET   N  I I  L++S+ QP+ D+ +   L    F+PLPL++ Y
Sbjct:  219 ITVLRKPNPSNTVFNLSSAFIAGLLALSVGCSLDLSVAKTYFKQSRCLIFGLTSQHLILPTIGISIYKMLQLKNAVGYGLFALSCSPGGGLGHIIVFLMKGDEDLSALLSTINCFMNAGFTLLWMYALNSLY----QIEFSTYTMALWLGIIPIIQGIGVLVNFWSYSTAQAIMTWFTRPLLLLAGILFV----TLGVYINHYAFNQINQSMLLGVLLLMLSGFL--VGSISGYF--SSGKQSKDVTCSLSVETALSNGLILIPALRYSLYQPEADLASSACLWSIFFSPLPLFLIY 503          
The following BLAST results are available for this feature:
BLAST of slc10a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC10A23.440e-3233.67solute carrier family 10 member 2 [Source:HGNC Sym... [more]
SLC10A61.651e-2731.38solute carrier family 10 member 6 [Source:HGNC Sym... [more]
SLC10A18.486e-2732.64solute carrier family 10 member 1 [Source:HGNC Sym... [more]
SLC10A36.970e-2428.92solute carrier family 10 member 3 [Source:HGNC Sym... [more]
SLC10A31.525e-2328.92solute carrier family 10 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71G10AR.42.099e-6345.72pep chromosome:WBcel235:IV:2199041:2209051:1 gene:... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG116551.087e-3937.89gene:FBgn0030638 transcript:FBtr0074031[more]
CG99032.005e-1221.61gene:FBgn0030756 transcript:FBtr0074297[more]
back to top
BLAST of slc10a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc10a26.606e-2830.19solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
slc10a27.866e-2829.97solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
slc10a49.875e-2631.37solute carrier family 10 member 4 [Source:ZFIN;Acc... [more]
slc10a12.584e-2030.13solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
slc10a12.584e-2030.13solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008686.19.728e-3936.72solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008944.11.154e-3836.72solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008699.11.204e-3836.72solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008959.11.337e-3836.72solute carrier family 10 (sodium/bile acid cotrans... [more]
SLC10A68.631e-3335.55solute carrier family 10 (sodium/bile acid cotrans... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc10a24.013e-3734.10solute carrier family 10, member 2 [Source:MGI Sym... [more]
Slc10a62.155e-3235.04solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a17.252e-2934.18solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a17.309e-2934.18solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a17.309e-2934.18solute carrier family 10 (sodium/bile acid cotrans... [more]
back to top
BLAST of slc10a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70172|NTCP2_MOUSE2.807e-3634.10Ileal sodium/bile acid cotransporter OS=Mus muscul... [more]
sp|Q62633|NTCP2_RAT3.233e-3634.58Ileal sodium/bile acid cotransporter OS=Rattus nor... [more]
sp|Q60414|NTCP2_CRIGR8.936e-3533.33Ileal sodium/bile acid cotransporter OS=Cricetulus... [more]
sp|Q28727|NTCP2_RABIT1.232e-3336.08Ileal sodium/bile acid cotransporter OS=Oryctolagu... [more]
sp|Q9CXB2|SOAT_MOUSE1.508e-3135.04Solute carrier family 10 member 6 OS=Mus musculus ... [more]
back to top
BLAST of slc10a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ170.000e+0100.00Slc10a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF762.522e-15657.33Slc10a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YEZ47.056e-14055.77Slc10a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3ISZ83.081e-8744.31ileal sodium/bile acid cotransporter OS=Lingula un... [more]
A0A1S3ISY81.740e-8541.36sodium/bile acid cotransporter OS=Lingula unguis O... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc10a28.153e-3233.59solute carrier family 10 member 2 [Source:NCBI gen... [more]
slc10a11.473e-2735.02solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
ENSAMXT00000012978.21.357e-2433.33sodium/bile acid cotransporter-like [Source:NCBI g... [more]
slc10a31.449e-1326.67solute carrier family 10 member 3 [Source:NCBI gen... [more]
ENSAMXT00000002522.26.812e-931.17pep primary_assembly:Astyanax_mexicanus-2.0:3:6312... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007971.16.676e-3434.41pep scaffold:Pmarinus_7.0:GL476805:176592:179698:-... [more]
slc10a16.135e-3134.66solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
slc10a23.326e-1433.91solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000011394.18.828e-1343.04pep scaffold:Pmarinus_7.0:GL476582:173651:174025:-... [more]
back to top
BLAST of slc10a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc10a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc10a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc10a41.306e-2328.46solute carrier family 10 member 4 [Source:NCBI gen... [more]
slc10a41.433e-2328.46solute carrier family 10 member 4 [Source:NCBI gen... [more]
SLC10A17.166e-2034.04sodium/bile acid cotransporter [Source:NCBI gene;A... [more]
slc10a38.652e-1625.49solute carrier family 10 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc10a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064833.10.000e+099.57SMESG000064833.1[more]
SMESG000064830.17.013e-16057.33SMESG000064830.1[more]
SMESG000064829.12.461e-8453.79SMESG000064829.1[more]
SMESG000060981.11.962e-5339.47SMESG000060981.1[more]
SMESG000046910.14.150e-1827.61SMESG000046910.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030586
GenBankAKN21469.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030586 ID=SMED30030586|Name=slc10a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1546bp
GTCATACGTATTGAAATTCAAAATTATATATAAATAAGTTTTTGTTATAA
AATTGTCTATATAGTTATTTTTATTAAGATATTCATTGGTTATGCGTGTT
TTGGTAATTTATTTTTTGTTTTATTGTTACGCGAATGGCCATGATTTGGG
ATTTGTCGGTAGATTTGAGAATGGATTTCAAAATAGTAGTTCATTTTTCA
AATTAAAAACCTTTGAAATGGATTCTGTTATTCTCAATGAAACTTTCACA
TATTACTTGAATTCAACCTTTGTCAATGTTAGCAATTTCAAATTGAATTG
CCGTTCGGACTATTTGAAGGTAGGCTATTTGGTCAACTGGACTGATATCC
AACTGCCTCCAGTGACGATGGAGAACTCAGTGATGAAATTAAATTTTACG
GTATTTTCAAAGCGGCTGGGAAGTTCGAATATTATCTGTACGATATATTT
GCCTGACTCAAATTCTACGAAGGTATTTGAACAGAAGATTGGCCAACTGA
TTGTTCTTAGGCACCCAACAATTGCTGAATTGGTTTTCAGAATTATTGTG
TCGATTTTCGTCATATTTCTGACATTTGTCATGGGTTGTGGACTAGATCG
AGATATTATTCTTAATTATTTAAAGAAACCAATATCGCCATTTATTGGAT
TCGTTTCGCAATTTCTTTTTATGCCGTTAATTTCAGCCGCTTTGGGAAAG
TTAAGTGGAATCGAAAATTCTTTTGCGCTGGGGTTATTAGTAATTGGCTG
TTCTCCTGGTGGAGGTGCCAGTAACATCTGGACAGTTTTATACGGAGGAG
ATCTCAATTTAAGTATGACAATGACATTTATTAGCTCTTGTGCTGCTTTA
GGAATGATGCCTTTATGGTTATTCGCGTTAGGCCGTTTGTTCATTGACCC
AAAGAATGTTGTTATTCCTTATGATAGCATAGCAATTAATTTGCTTCAAG
TCGTTTTACCAGTAGGCATTGGTATATTTGTTCGATGGAAATGGGAAGAA
AAATCTAAGGTTTTGGTGAAAAAAGTCAAAATAATGGGTATAATATTTAT
TATATTCGTTTTGTCTTATGGTACATATGCTAATTTATATATTTACAAAC
TAATTGGAGACTACATATTTTTACTACCAATTGGAGCTTTCTTACCATGG
CTTGGGTTTATATTCGGTTATTTACTGGCCCTTGCAACACGACGAAATAA
AAAACAAGCTATTGCGATAGCGTTAGAAACTGGTTTCCAGAATATTGGAA
TAGCAATACTAATTTTAAAATTTTCAATGCCGCAACCAGATGGTGACATG
GGAGCTGTAATGCCGCTCATCGTAGCTATGTTTACCCCATTACCTCTTTA
TGTCGGTTACGCAGCTTTAGTTATAAAAAAGAAATGTTGTAAATCATCAA
AACAATCTGAAGACACAGAAATGAAATCGAACACAGATGAGCAAAAAAAT
GTTTTATTAGATGAATCACCTAAAGACTGATTTATGAATATTATTTTACT
AAAAATATTTTATTTATATTTTTAAAAATAAATGACGAAGTTTGTA
back to top

protein sequence of SMED30030586-orf-1

>SMED30030586-orf-1 ID=SMED30030586-orf-1|Name=SMED30030586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=463bp
MRVLVIYFLFYCYANGHDLGFVGRFENGFQNSSSFFKLKTFEMDSVILNE
TFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKL
NFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFR
IIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAA
LGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSC
AALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWK
WEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAF
LPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPD
GDMGAVMPLIVAMFTPLPLYVGYAALVIKKKCCKSSKQSEDTEMKSNTDE
QKNVLLDESPKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038770Na+/solute_symporter_sf
IPR004710Bilac:Na_transpt
IPR002657BilAc:Na_symport/Acr3
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038770Sodium/solute symporter superfamilyGENE3DG3DSA:1.20.1530.20coord: 126..427
e-value: 7.5E-68
score: 230.8
IPR002657Bile acid:sodium symporter/arsenical resistance protein Acr3PFAMPF01758SBFcoord: 155..324
e-value: 8.5E-30
score: 103.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 436..462
NoneNo IPR availablePANTHERPTHR10361:SF28RH04535Pcoord: 140..450
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.528
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 342..364
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 373..395
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 273..295
NoneNo IPR availableTMHMMTMhelixcoord: 316..338
IPR004710Bile acid:sodium symporterPANTHERPTHR10361SODIUM-BILE ACID COTRANSPORTERcoord: 140..450