Calcium activated potassium channel subunit

Overview
NameCalcium activated potassium channel subunit
Smed IDSMED30030583
Length (bp)860
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium activated potassium channel subunit (SMED30030583) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium activated potassium channel subunit (SMED30030583) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium activated potassium channel subunit (SMED30030583) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium activated potassium channel subunit (SMED30030583) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030583

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030583h1SMcG0000727 dd_Smed_v4_15809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030583h1SMcG0000727 dd_Smed_v4_15809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030583h1SMcG0000727 dd_Smed_v6_15809_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Match: KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2 [Source:HGNC Symbol;Acc:HGNC:6286])

HSP 1 Score: 56.9954 bits (136), Expect = 4.518e-9
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   63 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 185          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Match: KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2 [Source:HGNC Symbol;Acc:HGNC:6286])

HSP 1 Score: 56.9954 bits (136), Expect = 6.156e-9
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   82 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Match: KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2 [Source:HGNC Symbol;Acc:HGNC:6286])

HSP 1 Score: 56.9954 bits (136), Expect = 6.156e-9
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   82 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Match: KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2 [Source:HGNC Symbol;Acc:HGNC:6286])

HSP 1 Score: 56.9954 bits (136), Expect = 6.156e-9
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   82 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Match: KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2 [Source:HGNC Symbol;Acc:HGNC:6286])

HSP 1 Score: 56.9954 bits (136), Expect = 6.156e-9
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   82 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Zebrafish
Match: kcnmb2 (potassium large conductance calcium-activated channel, subfamily M, beta member 2 [Source:ZFIN;Acc:ZDB-GENE-050320-97])

HSP 1 Score: 48.521 bits (114), Expect = 2.547e-6
Identity = 35/132 (26.52%), Postives = 58/132 (43.94%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDN---GIIVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            +TCT++N+++T  I C   C  D    S +PCLQ+   Y  L+          I  LSH  +     S CF      KD+    +++      ++      C+ + +EH+  +LL + Y      H + WPS
Sbjct:   79 TTCTVLNSSLTKEINCSYNCGSDCWRSSKYPCLQV---YVSLN------ATGRIGLLSHNEEMLDVSSECFYVPKCQKDHTAMRVLIQNISDHLKMQQQVRCFHDPSEHQASILLKRIYGSASLLHSLFWPS 201          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Zebrafish
Match: si:ch211-247n2.1 (si:ch211-247n2.1 [Source:ZFIN;Acc:ZDB-GENE-141216-101])

HSP 1 Score: 47.7506 bits (112), Expect = 4.918e-6
Identity = 43/184 (23.37%), Postives = 77/184 (41.85%), Query Frame = 3
Query:  198 KNMPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCS---KDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            K   + +    +D    L +S   + LC+ ++  +L   +V  ++       S CT++N+++   I C   C    +  S +PCLQ+   Y  LD          +  LS+  ++  A   CF      K+  +   IV     R++      CY + +E +D VLL + Y  G     + WP+
Sbjct:   32 KRRTVTALKAGEDRAILLGLS---MILCSAMMYFVLGITMVRSYSDSVWTEESNCTVLNSSVVAEINCSYSCGSECRKSSRYPCLQV---YVSLDS-------GKVQRLSYNEEAHEANPECFYIPKCRKEQTLMHTIVMNISERLKMHQQVLCYYDPSEQQDGVLLTRLYGRGAIISSLLWPT 202          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Zebrafish
Match: si:ch211-247n2.1 (si:ch211-247n2.1 [Source:ZFIN;Acc:ZDB-GENE-141216-101])

HSP 1 Score: 47.7506 bits (112), Expect = 5.269e-6
Identity = 43/184 (23.37%), Postives = 77/184 (41.85%), Query Frame = 3
Query:  198 KNMPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCS---KDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            K   + +    +D    L +S   + LC+ ++  +L   +V  ++       S CT++N+++   I C   C    +  S +PCLQ+   Y  LD          +  LS+  ++  A   CF      K+  +   IV     R++      CY + +E +D VLL + Y  G     + WP+
Sbjct:   33 KRRTVTALKAGEDRAILLGLS---MILCSAMMYFVLGITMVRSYSDSVWTEESNCTVLNSSVVAEINCSYSCGSECRKSSRYPCLQV---YVSLDS-------GKVQRLSYNEEAHEANPECFYIPKCRKEQTLMHTIVMNISERLKMHQQVLCYYDPSEQQDGVLLTRLYGRGAIISSLLWPT 203          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Xenopus
Match: ENSXETT00000046191.1 (potassium channel subfamily M regulatory beta subunit 2 [Source:NCBI gene;Acc:100493738])

HSP 1 Score: 55.0694 bits (131), Expect = 2.351e-8
Identity = 36/128 (28.12%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + CTL+N +IT +  C   C  D    S +PCLQ+        Q+ L Y  +    ++    S+C+  P C  + +++  +VS      RK   F C+ + E ++  V+L K YS  + +H + WP+
Sbjct:   72 ETQCTLMNASITETFNCSFSCGPDCWKISQYPCLQVYVNLNSSGQKVLLYHTEETMKVN----SECSYIPRCGKNYEESLSLVSIIMENFRKHQHFPCFYDPEGNQKNVILTKLYSSDVLFHSLFWPT 195          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Xenopus
Match: ENSXETT00000046181.1 (potassium channel subfamily M regulatory beta subunit 2 [Source:NCBI gene;Acc:100493738])

HSP 1 Score: 54.6842 bits (130), Expect = 2.765e-8
Identity = 36/128 (28.12%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + CTL+N +IT +  C   C  D    S +PCLQ+        Q+ L Y  +    ++    S+C+  P C  + +++  +VS      RK   F C+ + E ++  V+L K YS  + +H + WP+
Sbjct:   81 ETQCTLMNASITETFNCSFSCGPDCWKISQYPCLQVYVNLNSSGQKVLLYHTEETMKVN----SECSYIPRCGKNYEESLSLVSIIMENFRKHQHFPCFYDPEGNQKNVILTKLYSSDVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Match: Kcnmb2 (potassium large conductance calcium-activated channel, subfamily M, beta member 2 [Source:MGI Symbol;Acc:MGI:1919663])

HSP 1 Score: 54.299 bits (129), Expect = 3.263e-8
Identity = 34/128 (26.56%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + C L+N +IT +  C   C  D    S +PCLQ+    T   +  L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   81 EAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Match: Kcnmb2 (potassium large conductance calcium-activated channel, subfamily M, beta member 2 [Source:MGI Symbol;Acc:MGI:1919663])

HSP 1 Score: 54.299 bits (129), Expect = 3.263e-8
Identity = 34/128 (26.56%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + C L+N +IT +  C   C  D    S +PCLQ+    T   +  L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   81 EAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Match: Kcnmb2 (potassium large conductance calcium-activated channel, subfamily M, beta member 2 [Source:MGI Symbol;Acc:MGI:1919663])

HSP 1 Score: 54.299 bits (129), Expect = 3.263e-8
Identity = 34/128 (26.56%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + C L+N +IT +  C   C  D    S +PCLQ+    T   +  L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   81 EAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Match: Kcnmb2 (potassium large conductance calcium-activated channel, subfamily M, beta member 2 [Source:MGI Symbol;Acc:MGI:1919663])

HSP 1 Score: 54.299 bits (129), Expect = 3.263e-8
Identity = 34/128 (26.56%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + C L+N +IT +  C   C  D    S +PCLQ+    T   +  L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   81 EAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Match: sp|Q9Y691|KCMB2_HUMAN (Calcium-activated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNMB2 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.956e-8
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            S CTL+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C  + +++  +V+      RK   F+CY + E ++  V+L K YS  + +H + WP+
Sbjct:   82 SQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ----KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Match: sp|Q9CZM9|KCMB2_MOUSE (Calcium-activated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnmb2 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.282e-7
Identity = 34/128 (26.56%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  351 SSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
             + C L+N +IT +  C   C  D    S +PCLQ+    T   +  L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   81 EAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Match: sp|Q811Q0|KCMB2_RAT (Calcium-activated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnmb2 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.787e-6
Identity = 40/157 (25.48%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  282 ALIVGAILIHLVVIPFTHENSFYSSTCT------LINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMRKTPTFACYINAE-HRDEVLLYKFYSIGMFWHCVAWPS 719
            A++V +I+++ + +  T   S+  S  T      L+N +IT +  C   C  D    S +PCLQ+    T   ++ L Y  +    ++     +C+  P C ++ +++  +VS      R+   F CY + E ++  V+L K YS  + +H + WP+
Sbjct:   53 AMMVCSIMMYFL-LGITLLRSYMQSVWTEEAQRALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETMKINQ----KCSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPT 204          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A4Z2CW83 (Calcium-activated potassium channel subunit beta-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007000 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 3.558e-42
Identity = 80/183 (43.72%), Postives = 114/183 (62.30%), Query Frame = 3
Query:  240 VKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNIT-TSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVW 785
            +K +Y++C+T+     IV  ILIHLVV P+ HE++F  + C+ ++  I  T +KCENKCSKDRS FPCL++  +Y   ++     ++D+IAT +HY+   CA S C     DN   V +FQ R+R    F CY++A H DE LLYKFY+    +H V WP  L +IS + L ++Y  DKC VW
Sbjct:   22 IKIIYLTCATVITTTFIVECILIHLVVQPYFHESAFTHTNCSFLHAYIVRTDVKCENKCSKDRSKFPCLKVIVQYLSGNKNHTVILFDNIATYNHYKLLGCATSACHHRDMDNTEWVEKFQRRIRLQRHFRCYVHATHEDEALLYKFYTFTSVFHAVFWPISLFLISSICLLLIYIMDKCRVW 204          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A5J4NQS7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0001240 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.741e-41
Identity = 80/193 (41.45%), Postives = 120/193 (62.18%), Query Frame = 3
Query:  216 SKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITT-SIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVWND 791
            S++C +  +K +Y++C+T+   +LIV  IL+HLV++P+ HE+ F  + C  +   I   +I+CENKCSKDRS F C++IT  Y   D+ + A ++D+IAT  HY    CA S C      N   V  F + +R++PTF CYI+ +H +E LL+KFYS    ++ + WP  LL  S L+LA + S D+C VW D
Sbjct:   51 SQTCREHVLKVVYLTCATVITTSLIVECILLHLVIMPYRHESGFVPTECAYVRARIAGDAIRCENKCSKDRSSFQCIRITVAYRKQDRNYTAILFDNIATYQHYHLLGCATSSCHRQNAANRASVQHFHNMVRQSPTFTCYIHEDHVNEALLHKFYSPITLFNTLFWPLSLLTSSGLLLAAISSYDRCRVWAD 243          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A183SZJ1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9639 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.015e-41
Identity = 73/184 (39.67%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  240 VKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSI-KCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVWN 788
            +K +YI C+     ++IVGAIL+HL+V+PF HE+ F  STC ++ T +   + KCENKCSK+RS FPCL++T  Y  + +     ++D IAT  +YR++ C  S C    ++N  +V+ F++ ++K   F C+I+AEH DE L++KFY     ++ + WP+    +SL  + V+Y+ D+C VW 
Sbjct:   18 IKVIYILCAATLTTSIIVGAILVHLLVLPFLHESGFEPSTCYIVKTELHMPVLKCENKCSKERSAFPCLRVTILYEKMGRNKTGILFDTIATHQNYRRNGCVTSSCHQRWEENIFVVNMFKADLQKRGKFNCFISAEHDDEALMFKFYRPTTIFYALFWPAFTFSVSLFTIIVIYAVDRCKVWR 201          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A504YFA9 (Calcium activated potassium channel subunit OS=Fasciola gigantica OX=46835 GN=FGIG_02054 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.188e-41
Identity = 77/183 (42.08%), Postives = 112/183 (61.20%), Query Frame = 3
Query:  240 VKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNI-TTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVW 785
            +KF Y++C+T+   + I+  ILIHLVV P+ HE++F  ++CT ++++I   ++KCENKCSKDRS FPCL++   Y          +YD+IAT  HY+   CA S C     DN   V +F+ R++    F CYI+A H DE LL+KFYS    +H V WP  L   S++ ++  Y  D+C VW
Sbjct:   19 LKFTYLTCATVITTSFIIECILIHLVVQPYIHESAFSHTSCTYLHSDIIRQNVKCENKCSKDRSRFPCLKVLVSYYTGGDNHTVVLYDNIATYQHYKYLGCATSSCHHRDTDNTAWVDQFRLRVQHQKHFGCYIHATHEDEALLFKFYSTNTVFHAVFWPVSLFCTSVVCVSCAYVVDRCRVW 201          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A4E0RIE4 (Calcium activated potassium channel subunit OS=Fasciola hepatica OX=6192 GN=D915_001494 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.039e-41
Identity = 77/183 (42.08%), Postives = 112/183 (61.20%), Query Frame = 3
Query:  240 VKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNI-TTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVW 785
            +KF Y++C+T+   + I+  IL+HLVV P+ HE++F  ++CT ++++I   ++KCENKCSKDRS FPCL++   Y          +YD+IAT  HY+   CA S C     DN   V +F+ R++    F CYI+A H DE LL+KFYS    +H V WP  L   SL+ ++  Y  D+C VW
Sbjct:   19 LKFTYLTCATVITTSFIIECILVHLVVQPYIHESAFSHTSCTYLHSDIIRQNVKCENKCSKDRSRFPCLKVLVSYYTGGDNHTVVLYDNIATYQHYKYLGCATSSCHHRDTDNTAWVDQFRLRVQHQKHFGCYIHATHEDEALLFKFYSTNTVFHAVFWPVSLFCTSLVCVSCAYVVDRCRVW 201          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Match: si:ch211-247n2.1 (calcium-activated potassium channel subunit beta-2 [Source:NCBI gene;Acc:103042220])

HSP 1 Score: 52.373 bits (124), Expect = 1.385e-7
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            S+CT++N+++ + I C   C  +    S +PCLQ+   Y  L+          +  LSH  ++Q A   CF      KD+ +   +V     +++      CY + +E +D VLL + Y  G  +  + WP+
Sbjct:   81 SSCTVLNSSVISEINCSYSCGSECWKSSRYPCLQV---YVSLNSS------GRVLRLSHNEEAQEANPECFYVPKCRKDHAVMHTLVLNISEQLKTQHQVPCYYDPSEQQDNVLLTRLYGRGAIFSSLLWPT 203          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Match: si:ch211-247n2.1 (calcium-activated potassium channel subunit beta-2 [Source:NCBI gene;Acc:103042220])

HSP 1 Score: 52.373 bits (124), Expect = 1.617e-7
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            S+CT++N+++ + I C   C  +    S +PCLQ+   Y  L+          +  LSH  ++Q A   CF      KD+ +   +V     +++      CY + +E +D VLL + Y  G  +  + WP+
Sbjct:  112 SSCTVLNSSVISEINCSYSCGSECWKSSRYPCLQV---YVSLNSS------GRVLRLSHNEEAQEANPECFYVPKCRKDHAVMHTLVLNISEQLKTQHQVPCYYDPSEQQDNVLLTRLYGRGAIFSSLLWPT 234          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Match: si:ch211-247n2.1 (calcium-activated potassium channel subunit beta-2 [Source:NCBI gene;Acc:103042220])

HSP 1 Score: 51.9878 bits (123), Expect = 1.905e-7
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            S+CT++N+++ + I C   C  +    S +PCLQ+   Y  L+          +  LSH  ++Q A   CF      KD+ +   +V     +++      CY + +E +D VLL + Y  G  +  + WP+
Sbjct:  120 SSCTVLNSSVISEINCSYSCGSECWKSSRYPCLQV---YVSLNSS------GRVLRLSHNEEAQEANPECFYVPKCRKDHAVMHTLVLNISEQLKTQHQVPCYYDPSEQQDNVLLTRLYGRGAIFSSLLWPT 242          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Match: kcnmb2 (calcium-activated potassium channel subunit beta-2-like [Source:NCBI gene;Acc:103021848])

HSP 1 Score: 51.6026 bits (122), Expect = 2.033e-7
Identity = 39/161 (24.22%), Postives = 73/161 (45.34%), Query Frame = 3
Query:  267 TLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDN---GIIVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            ++ LC++++  +L   +V  +T       S CT++N+++T  I C   C  D    S +PCLQ+   Y  ++          +  LSH  ++Q   S CF      KD+     ++     +++      C+ + AE +  +LL + Y     +H + WPS
Sbjct:   51 SMVLCSIMMYFVLCITMVRSYTDSVWTEESICTILNSSLTMEINCSYSCGPDCWRSSKYPCLQV---YVSIN------ATGRVGLLSHNEETQDISSECFYVPKCQKDHVAVQAMMVNISEKLKAQQQVRCFYDPAEQQSSILLSRLYGTSAIFHSLFWPS 202          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Match: si:ch211-247n2.1 (calcium-activated potassium channel subunit beta-2 [Source:NCBI gene;Acc:103042220])

HSP 1 Score: 51.6026 bits (122), Expect = 2.298e-7
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  354 STCTLINTNITTSIKCENKCSKD---RSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCF---SSTKDNGI---IVSEFQSRMRKTPTFACYIN-AEHRDEVLLYKFYSIGMFWHCVAWPS 719
            S+CT++N+++ + I C   C  +    S +PCLQ+   Y  L+          +  LSH  ++Q A   CF      KD+ +   +V     +++      CY + +E +D VLL + Y  G  +  + WP+
Sbjct:  124 SSCTVLNSSVISEINCSYSCGSECWKSSRYPCLQV---YVSLNSS------GRVLRLSHNEEAQEANPECFYVPKCRKDHAVMHTLVLNISEQLKTQHQVPCYYDPSEQQDNVLLTRLYGRGAIFSSLLWPT 246          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004674.1 (pep scaffold:Pmarinus_7.0:GL478954:145064:148714:1 gene:ENSPMAG00000004254.1 transcript:ENSPMAT00000004674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 9.007e-6
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 3
Query:  222 SCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCS---KDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISP-CFSSTKDNGIIVSEFQSRMR---KTPTFACYINAE-HRDEVLLYK 674
            S A+  V  L +S   L +    + +I    VV P  +      + CT+I+  I   I C  +C    K  S +PCLQ+    T   ++ L +  +   + S    SQC   P C+    D   ++   +S  R   +TP F C+ NA  H D+ L  +
Sbjct:   40 SAAEARVVLLALSMVGLGIAVFFILSIT---VVQPLLNGRGSKEANCTVISAEIPKWIDCAFECGPYCKGVSSYPCLQVYVNVTPWGRKVLLHRDEQSISSS----SQCYQLPKCYRDHADATAVIEPLKSSFRALNRTP-FRCFYNARVHHDDALFSR 190          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000047387.1 (SMESG000047387.1)

HSP 1 Score: 383.645 bits (984), Expect = 2.468e-136
Identity = 197/197 (100.00%), Postives = 197/197 (100.00%), Query Frame = 3
Query:  204 MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVWNDT 794
            MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGLLVISLLILAVLYSKDKCNVWNDT
Sbjct:    1 MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGLLVISLLILAVLYSKDKCNVWNDT 197          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000017226.1 (SMESG000017226.1)

HSP 1 Score: 176.022 bits (445), Expect = 3.565e-54
Identity = 86/195 (44.10%), Postives = 120/195 (61.54%), Query Frame = 3
Query:  207 PIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVWND 791
            P  S++  ++W K +Y++  ++ +   IV  IL+HLV+IP+ HE SF S+ C L  T +   ++CENKCSKDRS F CLQI   Y   ++ F AY+Y+H+ATL H+ K+ CA SPC     DN +IVS F   +++   F C+ + +H  E LLYKFY    F HC  WP  L+V S   L V+Y  DKC VW+D
Sbjct:   28 PSTSRATKENWFKIIYLASISIFVSTFIVVCILMHLVIIPYLHETSFISAQCNLNETRMGDEVRCENKCSKDRSKFKCLQIIVNYRRNNKMFSAYLYEHVATLRHFSKNHCATSPCHKEEIDNYLIVSRFNRDIKRQRNFNCFTSIKHPSEALLYKFYDASTFLHCTLWPLLLIVSSATSLTVIYQIDKCRVWHD 222          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000055809.1 (SMESG000055809.1)

HSP 1 Score: 126.331 bits (316), Expect = 4.026e-35
Identity = 76/209 (36.36%), Postives = 112/209 (53.59%), Query Frame = 3
Query:  204 MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTD------LDQE--FLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQ----SRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVW-ND 791
            M  I  +     +KFLYIS  ++++   I+  IL+HL++ P+ HE  F    CT++N +    IKC NKCSK+RS F C  +  KY        L  +  +  Y++D I TL +++  +C ISPC+    DN I    F       +     F CY+N    +EVLLYKFYS   +  C+ WP  L+V+S+ I+ + Y  D+C VW ND
Sbjct:    1 MRKIQNNIRHSVLKFLYISSLSVAVSGFIIECILLHLIISPYGHETQFVDGKCTVLNISTRYGIKCVNKCSKERSKFFCSTVKVKYQSKISLGRLSNQTWYHGYLFDQITTLHNFKDEKCIISPCYKLKLDNYIETRNFLHVHFDHLESNSAFPCYVNRYLTNEVLLYKFYSYETYISCILWPITLIVLSVFIILLCYWIDRCKVWAND 209          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000055809.1 (SMESG000055809.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.787e-32
Identity = 65/183 (35.52%), Postives = 95/183 (51.91%), Query Frame = 3
Query:  204 MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTD------LDQE--FLAYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQ----SRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWP 716
            M  I  +     +KFLYIS  ++++   I+  IL+HL++ P+ HE  F    CT++N +    IKC NKCSK+RS F C  +  KY        L  +  +  Y++D I TL +++  +C ISPC+    DN I    F       +     F CY+N    +EVLLYKFYS   +  C+ WP
Sbjct:    1 MRKIQNNIRHSVLKFLYISSLSVAVSGFIIECILLHLIISPYGHETQFVDGKCTVLNISTRYGIKCVNKCSKERSKFFCSTVKVKYQSKISLGRLSNQTWYHGYLFDQITTLHNFKDEKCIISPCYKLKLDNYIETRNFLHVHFDHLESNSAFPCYVNRYLTNEVLLYKFYSYETYISCILWP 183          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000053268.1 (SMESG000053268.1)

HSP 1 Score: 105.145 bits (261), Expect = 5.346e-27
Identity = 62/205 (30.24%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  210 IISKSCAQDWV-KFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNIT------TSIKCENKCSKDRSMFPCLQITAKYT--DLDQEFL--AYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGXXXXXXXXXXXXYSKDKCNVWND 791
            ++   C +  + K +Y+S  T      I+  IL+HL++ P+  E  F  +TC   N++          ++CENKC+KD   FPC+ +   Y   +  Q  L   Y+YD+  T + Y+K +C+ SPC     DN   V  F   +     F+CY N +    VLLYK Y   +  HC+ WP G+ ++ L+ +        C+VW +
Sbjct:    8 VLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGYLYDYYRTYNRYKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKN 212          
The following BLAST results are available for this feature:
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMB24.518e-928.35potassium calcium-activated channel subfamily M re... [more]
KCNMB26.156e-928.35potassium calcium-activated channel subfamily M re... [more]
KCNMB26.156e-928.35potassium calcium-activated channel subfamily M re... [more]
KCNMB26.156e-928.35potassium calcium-activated channel subfamily M re... [more]
KCNMB26.156e-928.35potassium calcium-activated channel subfamily M re... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kcnmb22.547e-626.52potassium large conductance calcium-activated chan... [more]
si:ch211-247n2.14.918e-623.37si:ch211-247n2.1 [Source:ZFIN;Acc:ZDB-GENE-141216-... [more]
si:ch211-247n2.15.269e-623.37si:ch211-247n2.1 [Source:ZFIN;Acc:ZDB-GENE-141216-... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000046191.12.351e-828.13potassium channel subfamily M regulatory beta subu... [more]
ENSXETT00000046181.12.765e-828.13potassium channel subfamily M regulatory beta subu... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Kcnmb23.263e-826.56potassium large conductance calcium-activated chan... [more]
Kcnmb23.263e-826.56potassium large conductance calcium-activated chan... [more]
Kcnmb23.263e-826.56potassium large conductance calcium-activated chan... [more]
Kcnmb23.263e-826.56potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9Y691|KCMB2_HUMAN2.956e-828.35Calcium-activated potassium channel subunit beta-2... [more]
sp|Q9CZM9|KCMB2_MOUSE2.282e-726.56Calcium-activated potassium channel subunit beta-2... [more]
sp|Q811Q0|KCMB2_RAT1.787e-625.48Calcium-activated potassium channel subunit beta-2... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CW833.558e-4243.72Calcium-activated potassium channel subunit beta-2... [more]
A0A5J4NQS71.741e-4141.45Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A183SZJ12.015e-4139.67Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A504YFA92.188e-4142.08Calcium activated potassium channel subunit OS=Fas... [more]
A0A4E0RIE44.039e-4142.08Calcium activated potassium channel subunit OS=Fas... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-247n2.11.385e-726.52calcium-activated potassium channel subunit beta-2... [more]
si:ch211-247n2.11.617e-726.52calcium-activated potassium channel subunit beta-2... [more]
si:ch211-247n2.11.905e-726.52calcium-activated potassium channel subunit beta-2... [more]
kcnmb22.033e-724.22calcium-activated potassium channel subunit beta-2... [more]
si:ch211-247n2.12.298e-726.52calcium-activated potassium channel subunit beta-2... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004674.19.007e-627.04pep scaffold:Pmarinus_7.0:GL478954:145064:148714:1... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047387.12.468e-136100.00SMESG000047387.1[more]
SMESG000017226.13.565e-5444.10SMESG000017226.1[more]
SMESG000055809.14.026e-3536.36SMESG000055809.1[more]
SMESG000055809.11.787e-3235.52SMESG000055809.1[more]
SMESG000053268.15.346e-2730.24SMESG000053268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030583 ID=SMED30030583|Name=Calcium activated potassium channel subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=860bp
TGAAATTTCACTGATGAAAATTGCAGCATCAAAATTGCTATCAAATATTA
GATCACCAACCAGAAGAGACAAACATTGTTTTGGAAAATTCTATTCTGCT
ATATATTTTAGACGAAACTTTTAAAATTGATTTTAATCGTCGGAAATGAA
ATTATCAACATCAACTTTTGGAGAATAACATAGCAAAATTGACAATCAAA
AATATGCCAATAATATCGAAATCTTGCGCTCAAGACTGGGTGAAATTTCT
TTATATTTCATGTAGCACATTGTCATTATGTGCGCTTATTGTTGGCGCAA
TTCTCATCCATCTCGTAGTCATACCCTTTACACATGAAAATAGTTTTTAT
TCATCCACATGTACATTAATTAATACCAATATCACGACTTCCATTAAATG
CGAGAACAAATGCTCAAAAGACAGATCAATGTTTCCTTGTTTACAAATAA
CTGCTAAATATACGGATCTCGACCAGGAATTTCTGGCTTATGTCTACGAT
CATATAGCTACATTGTCACATTACCGAAAATCTCAGTGTGCAATCAGTCC
TTGTTTTAGCTCGACAAAAGATAATGGAATTATTGTGTCTGAGTTTCAGT
CGAGAATGAGAAAAACTCCAACATTCGCATGTTACATAAATGCTGAACAC
CGAGACGAAGTTTTGCTTTACAAATTTTATTCAATAGGAATGTTTTGGCA
CTGTGTCGCATGGCCTAGCGGTCTTCTAGTAATATCCTTACTTATACTTG
CAGTTCTCTATTCCAAGGATAAATGCAATGTCTGGAATGATACTTGATTA
AATTATTAAATGAATTATTATTTATTTGATTTTGTTTTCTTTTCTTTAAA
AAAGGCTGAT
back to top

protein sequence of SMED30030583-orf-1

>SMED30030583-orf-1 ID=SMED30030583-orf-1|Name=SMED30030583-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MPIISKSCAQDWVKFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYS
STCTLINTNITTSIKCENKCSKDRSMFPCLQITAKYTDLDQEFLAYVYDH
IATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHR
DEVLLYKFYSIGMFWHCVAWPSGLLVISLLILAVLYSKDKCNVWNDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003930K_chnl_Ca-activ_BK_bsu
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003930Potassium channel, calcium-activated, BK, beta subunitPFAMPF03185CaKBcoord: 26..184
e-value: 2.9E-17
score: 63.0
IPR003930Potassium channel, calcium-activated, BK, beta subunitPANTHERPTHR10258CALCIUM-ACTIVATED POTASSIUM CHANNEL SUBUNIT BETAcoord: 17..190
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 164..186