Transmembrane channel-like protein

Overview
NameTransmembrane channel-like protein
Smed IDSMED30030557
Length (bp)2207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane channel-like protein (SMED30030557) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane channel-like protein (SMED30030557) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane channel-like protein (SMED30030557) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane channel-like protein (SMED30030557) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030557

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30030557SMESG000002416.1 dd_Smed_v4_11686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane channel-like protein vs. Ensembl Human
Match: TMC5 (transmembrane channel like 5 [Source:HGNC Symbol;Acc:HGNC:22999])

HSP 1 Score: 51.2174 bits (121), Expect = 7.174e-6
Identity = 90/413 (21.79%), Postives = 178/413 (43.10%), Query Frame = 3
Query:  123 RDNLQNMPNNSETIEEESTDIYEESYPNLK--LTKEEALTRSRKFKI---IQ-----KHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMGTPIFYGFY-NQSVQNT-TKFYYSVGRAYFCVNVICRV---FYILCLIRKFIFNV---GSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLS---KDNEQKIFKILRI-----LIVNIFCYGISILILERISWQITNDEIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRI 1283
            RD ++ + N   T+EE+          NL+  + KE++    R  ++   IQ       + ++ K+++SE  N  ++W+   K+I   +G  + SYF    W+    IF  I++ SFIIIP   +  +N   +Q+          +   T ++YGFY N ++Q+  +   Y++  AY      C     F +L  + K+  N      IY+ GI         L+F  W+F +   +  +  +  +   I++NLS   ++N +  F  L       ++  +   G++I     + +    +  ++++HSN   +L+L  P  +S   +    ++   + +E ++   H +Y   I+   L  +++ +L Y+W   +  +                      + CWET +GQ I
Sbjct:    4 RDRIKAIRNQPRTMEEKR---------NLRKIVDKEKSKQTHRILQLNCCIQCLNSISRAYRRSKNSLSEILNSISLWQKTLKIIGGKFGTSVLSYFNFLRWLLKFNIFSFILNFSFIIIPQFTVAKKN--TLQFTGLEFFTGVGYFRDTVMYYGFYTNSTIQHGNSGASYNMQLAYIFTIGACLTTCFFSLLFSMAKYFRNNFINPHIYSGGIT-------KLIF-CWDFTVTHEKAVKLKQKNLSTEIRENLSELRQENSKLTFNQLLTRFSAYMVAWVVSTGVAIACCAAVYYLAEYNLEFLKTHSNPGAVLLL--PFVVSCINLAVPCIYSMFRLVERYEMPRHEVYVLLIRNIFLKISIIGILCYYWLNTVALSG---------------------EECWETLIGQDI 374          
BLAST of Transmembrane channel-like protein vs. Ensembl Human
Match: TMC5 (transmembrane channel like 5 [Source:HGNC Symbol;Acc:HGNC:22999])

HSP 1 Score: 51.2174 bits (121), Expect = 7.440e-6
Identity = 93/431 (21.58%), Postives = 186/431 (43.16%), Query Frame = 3
Query:   87 YESIQLKEL------TIKRDNLQNMPNNSETIEEESTDIYEESYPNLK--LTKEEALTRSRKFKI---IQ-----KHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMGTPIFYGFY-NQSVQN-TTKFYYSVGRAYFCVNVICRV---FYILCLIRKFIFNV---GSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLS---KDNEQKIFKILRI-----LIVNIFCYGISILILERISWQITNDEIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRI 1283
            +E++Q ++L         RD ++ + N   T+EE+          NL+  + KE++    R  ++   IQ       + ++ K+++SE  N  ++W+   K+I   +G  + SYF    W+    IF  I++ SFIIIP   +  +N   +Q+          +   T ++YGFY N ++Q+  +   Y++  AY      C     F +L  + K+  N      IY+ GI         L+F  W+F +   +  +  +  +   I++NLS   ++N +  F  L       ++  +   G++I     + +    +  ++++HSN   +L+L  P  +S   +    ++   + +E ++   H +Y   I+   L  +++ +L Y+W   +  +                      + CWET +GQ I
Sbjct:   99 HETVQGQKLIASLIPMTSRDRIKAIRNQPRTMEEKR---------NLRKIVDKEKSKQTHRILQLNCCIQCLNSISRAYRRSKNSLSEILNSISLWQKTLKIIGGKFGTSVLSYFNFLRWLLKFNIFSFILNFSFIIIPQFTVAKKN--TLQFTGLEFFTGVGYFRDTVMYYGFYTNSTIQHGNSGASYNMQLAYIFTIGACLTTCFFSLLFSMAKYFRNNFINPHIYSGGIT-------KLIF-CWDFTVTHEKAVKLKQKNLSTEIRENLSELRQENSKLTFNQLLTRFSAYMVAWVVSTGVAIACCAAVYYLAEYNLEFLKTHSNPGAVLLL--PFVVSCINLAVPCIYSMFRLVERYEMPRHEVYVLLIRNIFLKISIIGILCYYWLNTVALSG---------------------EECWETLIGQDI 487          
BLAST of Transmembrane channel-like protein vs. TrEMBL
Match: A0A226NMA6 (Transmembrane channel-like protein (Fragment) OS=Callipepla squamata OX=9009 GN=ASZ78_002290 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.904e-11
Identity = 112/522 (21.46%), Postives = 223/522 (42.72%), Query Frame = 3
Query:  264 KHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMG------------TPIFYGFYNQSVQNTTKF--YYSVGRAY-FCVNVICRVFYILCLIRKFIFNVGSIYATGIELK-YTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKIF-----KILRILI-----------VNIFCYGISILILERISWQITNDEIYIQSHSNI--PLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQ-----LSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNYAS 1712
            K+S ++ ++ ++E+ +  N W    KVI  ++G  + SYF    W+                I   +IN+  +++ Q++     P+     G            T ++YGFY  +  + TK    Y++  AY F V     +++++CL+  F     SI    I L+ Y+ + S L   W+FN+ + +  +  +  +   IK++L+++N++ +      +I+RILI               C G+  L        + N E++++ H N       +L +PI  S+      + + ++  +E FQ+    +Y +  +   L  +++ +L Y+W  ++  A+ +Q                    CWET +GQ I      F+ V  +F +L      F + +      +SL  P+F       ++ +   L W+G  + P+LP I ++   + ++     ++ +C P   +   A+       L+   SL    + +    + + PS  CGPF+ L   YA+
Sbjct:   24 KNSLRRFRTGLAEFFHRLNFWHKTLKVIGGEFGTSVLSYFIFLKWL------------LNFNIFSFLINFGFITVPQFVAA--EPNNLSFTGLELLTGAGYFQQTVLYYGFYTNATISKTKIGASYNMQLAYIFTVG----MYFVICLLILFFSIAKSICRNFINLQVYSGNASKLLCTWDFNITNEKAVKLKQRNLSTQIKEDLAEENKEALHFSVTERIVRILIHLGSWAASLGTAVAACAGVYFL-------SVNNLELFMKGHKNDLESQAAMLVLPIITSLLNAFIPFFYSWLGNMEKFQNPKSKIYVNIARTLILKISIIGILCYYWLTVV-AASESQ--------------------CWETLIGQDI----YRFVLVDFIFCLLGSFFGEFLRRIIGTTVCVSLGVPEFDIGRSVLDLIYAQTLTWIGILFSPLLPGIQMVSFAIVFYVKKVSLTQNCQPPRKAWRAAQMTTFFMFLLFFPSLAGVLSVIAVTVWRLKPSNECGPFRGLPSIYAA 495          
BLAST of Transmembrane channel-like protein vs. TrEMBL
Match: A0A226PQV7 (Transmembrane channel-like protein (Fragment) OS=Colinus virginianus OX=9014 GN=H355_014996 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.716e-10
Identity = 111/509 (21.81%), Postives = 218/509 (42.83%), Query Frame = 3
Query:  270 SEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVW-ITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMGTPIFYGFYNQSVQNTTKF--YYSVGRAY-FCVNVICRVFYILCLIRKFIFNVGSIYATGIELK-YTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKIF-----KILRILI-----------VNIFCYGISILILERISWQITNDEIYIQSHSNI--PLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQ-----LSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNYAS 1712
            S ++ ++ ++EY +  N W    KVI  ++G  + SYF    W +   I    I      +   V     NLS      ++++    +   T ++YGFY  +  + TK    Y++  AY F V     +++++CL+  F     SI    I L+ Y+ + S L   W+FN+ + +  +  +  +   IK++L+++N++ +      +I+RILI               C G+  L        + N E++++ H N       +L +P+  S+      + + ++  +E FQ+    +Y +  +   L  +++ +L Y+W  ++  A+ +Q                    CWET +GQ I      F+ V  +F +L      F + +      +SL  P+F       ++ +   L W+G  + P+LP I ++   + ++     +  +C P   +   A+       L+   SL    + +    + + PS  CGPF+ L   YA+
Sbjct:   31 SLRRFRTGLAEYFHRLNFWHKTLKVIGGEFGTSVLSYFIFLKWLLNFNIFSFLINFGFITVPQFVAAEPNNLSFTG--LELLT-GAGYFQQTVLYYGFYTNATISKTKIGASYNMQLAYIFTVG----MYFVICLLILFFSIAKSICRNFINLQVYSGNASKLLCTWDFNITNEKAVKLKQRNLSTQIKEDLAEENKEALHFSVTERIVRILIHLGSWAASLGTAVAACAGVYFL-------SVNNLELFMKGHKNDLESQAAMLVLPVITSLLNAFIPFFYSWLGNMEKFQNPKSKIYVNIARTLILKISIIGILCYYWLTVV-AASESQ--------------------CWETLIGQDI----YRFVLVDFIFCLLGSFFGEFLRRIIGTTVCVSLGVPEFDIGRSVLDLIYAQTLTWIGILFSPLLPGIQMVSFAIVFYVKKVSLMQNCQPPRKAWRAAQMTTFFMFLLFFPSLAGVLSVIAVTVWRLKPSNECGPFRGLPSIYAA 500          
BLAST of Transmembrane channel-like protein vs. TrEMBL
Match: A0A093Q9F8 (Transmembrane channel-like protein (Fragment) OS=Phalacrocorax carbo OX=9209 GN=N336_12636 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.889e-10
Identity = 108/501 (21.56%), Postives = 220/501 (43.91%), Query Frame = 3
Query:  285 KSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVW-ITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMGTPIFYGFYNQS----VQNTTKFYYSVGRAY-FCVNVICRVFYILCLIRKFIFNVGSIYATG-IELK-YTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKI-----FKILRILIVNIFCY----GISILILERISW-QITNDEIYIQSHSN--IPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQ-----LSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNYAS 1712
            ++ +SEY +   +W    K+I  ++G  + SYF    W +T  +    I      I  +V     NLS   +    +     +   T ++YGFY  +    ++N     Y++  AY F +     +++++CL    +F++G ++    I L+ Y+ + S L   W+FNL + +  +  +  +   IK++L++ N + +      +++RI +V++ C+    G ++ +   + +  I N +++++ H N       +L +PI  S+      + + ++  +E FQ   H +Y +  +   L  +V+ +L Y+W  ++  + +                    Q CWET +GQ I    L    V  MF +L      F + +      ++L  P+F       N+ +   L W+G  + P+LP I ++ L + ++     +  +C P       A+   +   L+   S +   +      + + PS  CGPF+ L   YA+
Sbjct:   77 RNRLSEYFHRLQLWHKTLKIIGTEFGTSVLSYFIFLKWLLTFNVFSFLINFSFITIPQLVTAEPNNLS---FTGLELFTGAGYFQETVLYYGFYTNATISKIENGPS--YNMQLAYIFTIG----IYFVICLF-ILLFSMGRLFCKNFINLQVYSGNASKLLCTWDFNLTNEKAVKLKQKSLSTQIKEDLTEINREGLNFSVTERVVRI-VVHLVCWVASLGTAVAVCAGVYFLSINNLKLFVKGHKNDLKSQAAMLVLPIVASLLNTFIPFFYSWLGHLERFQTPGHQIYVTITRNVLLKMSVVGILCYYWLHVVAASES--------------------QECWETLVGQDIYRLVL----VDFMFCLLGSFFGEFLRRIIGTTVCVNLGLPEFDIGRNVLNLIYAQTLTWIGILFSPLLPGIQIISLSIVFYVKKVSLMRNCQPPRKVWRTAQMTTSFMFLLFFPSFLGVVSVTGVIVWRLKPSEECGPFRGLPSMYAA 542          
BLAST of Transmembrane channel-like protein vs. TrEMBL
Match: A0A091WFH2 (Transmembrane channel-like protein (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_07256 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.516e-10
Identity = 129/650 (19.85%), Postives = 271/650 (41.69%), Query Frame = 3
Query:  132 LQNMPNNSETIEEESTDIYEESYPNLKLTKEEALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMG------------TPIFYGFYNQSVQNTTK--FYYSVGRAY-FCVN---VICRVFYILCLIRKFIFNVGSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNE--------QKIFKILRILIVNIFCYGISILILERISW-QITNDEIYIQSHSN--IPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYL-----QLSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNYA--SNGFSFSDYFSNQNFVLKVI--TIGSDIIFNNNGIWYSIIIIVLSLFFQYIFRAMAVSEIRNYVNYKLADMREKKMSLLEDLKLKMRT 1967
            +Q MP   +   E    + +E     K +   ++T           S ++  +++SEY +   +W    K+I  ++G  + SYF    W+                I   +IN+  ++I Q++     P+    MG            T ++YGFY  +  +  +    Y++  AY F V    VIC +  +  + + F  N  +         Y+ + S L   W+FN+ + +  +  +  +   IK++L++ N+        +++ +I+  L+  +   G ++     + +  I N +++++ H N       +L +P+  S+      + + ++  +E FQ   H +Y +  +   L  +++ +L Y+W  I+  A+ +Q                    CWET +GQ I    L    V  +F +L      F + +      +S   P+F       ++ +   L W+G  + P+LP I L+   L ++     + ++C P       A+   +   L+   S +   + +    + + PS  CGPF+ L+  YA  S      + ++   +V+ +    I S++ F N  +   +++I+  L++Q I     ++++   +  ++ +  + KM LLE L+   R 
Sbjct:   30 IQKMPETMKKKREIRNKVLKEITKTSKHSSTPSVTMDSSLSSFALQSFRRFGNSLSEYFHLLQLWHKTLKIIGAEFGTSVLSYFIFLKWL------------LTFNIFSFLINFSFITIPQFVAA--EPNNLSFMGLELFTGAGYFQQTVLYYGFYTNATISKIENGLSYNMQLAYIFTVGIYFVICFLILLFSMAKSFCRNFIN------PQTYSGNASKLLCTWDFNITNEKAVKLKQKNLSTQIKEDLTEVNQEVLKFSVTERVVRIVIHLVAWVASLGTALAACAGVYFLSINNLKLFVKGHKNDLKSQAAMLVLPVVTSLLNAFIPFFYSWLGRLERFQTPGHQIYVTITRNIILKISIVGILCYYWLNIV-AASESQ--------------------CWETMVGQDIYRLVL----VDFIFCLLGSFFGEFLRRIIGTTVYVSWGLPEFDIGRNVLDLIYAQTLTWIGILFSPLLPCIQLISFSLVFYVKKVSLMMNCQPPCKVWRTAQMMTSFMFLLFFPSFLGVLSVVGVTVWRLKPSEECGPFRGLSSMYAAVSEWIKILENYTASKWVVWIYYNLITSELFFFNLSV---LVLIITYLYWQIIEGRKTMAKV---LRKQIINEGKDKMFLLEKLRALQRA 628          
BLAST of Transmembrane channel-like protein vs. TrEMBL
Match: A0A3S0ZMC0 (TMC domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_011158 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.128e-9
Identity = 126/573 (21.99%), Postives = 247/573 (43.11%), Query Frame = 3
Query:   84 RYESIQLKELTIKRDNLQNMPNN-SETIEEESTDIYEESYPNLKLT--KEEALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMIS-------PDQKWLMGTPIFYGFY-NQSVQNTTKFYYSVGRAYFCVNVICRVFYILCLI----------RKFIFNVGSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDN-------EQKIFKILRILIVNIFCYGISILILER-ISWQITND---EIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQLSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNY 1706
            R E   ++ L  + D + + P +  E +    T +  +     KL+  ++  LTR++  K       ++ K  + ++   F++W S   VI   +G  + SYF    W+ L  I + +++  F++IP ++  +  L    Y     S           +   T ++YGFY +++V+  T   Y +  AY    + C  +Y+ CLI          RK+  + G      I L Y    +L++  W++ ++S+  +   +  I   IK+ L+  N         + F      I+  +   +S+L     I++ ++N    +  + + ++IP++  L +P+ LS   +    +F F++  E +    + LY    +   L A +L +L Y W K         I+ S L              CWET++G+ I    +  +     ++   +  +  F     S+ + +F        + +   L WLG +Y P+LP++ +L L++ ++     +  +C P S     A R  TIF+  L I  I++   + +  F++ PS  CGP++N   +Y
Sbjct:  115 RQEDEIVESLEREIDLVDSSPQDIDEAVRTMPTTLSRKRSIKRKLSSRRKRKLTRTKLVKYWFAMLWQQTKYQLRKWRRIFDLWSSHLTVIEGCFGTSVASYFIFLKWVLLMNIPIFLLTFGFLVIPQILYRFHQLEPSGYAGNSESFTGIELLTGSGFFTNTEMYYGFYTDKAVEAVTNLEYKMKYAYL---LTCGGYYLFCLILLGYSYLKSYRKYYIDAGGT----ISLYY---FNLVYCGWDYGIKSHEASVLKQSSIYQEIKEYLAGKNVNQRRNKSHQAFCNKWAFIILAWAVVVSLLAASGYITYTVSNKLSIKTALDNSTSIPVVSPLAMPVVLSSIQLFVPMIFTFLETSENYSQPKYELYVHMFRDMALKATMLAVLVYFWFK---------IAASKLE-------------CWETFVGEEIYRLVIVDLIFTLGYSFFMEFCRKLFSLKWRSIERAEFATGRHTLELVYSQSLCWLGLFYSPLLPVVVILKLIIIFYIKRFSVVQNCRP-SLKPWRASRTHTIFVGYLFIFFILSCVAVGFGIFLVKPSTACGPYKNYDTSY 654          
BLAST of Transmembrane channel-like protein vs. Planmine SMEST
Match: SMESG000002416.1 (SMESG000002416.1)

HSP 1 Score: 1206.43 bits (3120), Expect = 0.000e+0
Identity = 653/657 (99.39%), Postives = 655/657 (99.70%), Query Frame = 3
Query:   78 MIRYESIQLKELTIKRDNLQNMPNNSETIEEESTDIYEESYPNLKLTKEEALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQXXXXXXXXXXXXXXXXXXXNYENLSIVQYIYQMISPDQKWLMGTPIFYGFYNQSVQNTTKFYYSVGRAYFCVNVICRVFYILCLIRKFIFNVGSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKIFKILRILIVNIFCYGISILILERISWQITNDEIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQLSLIKPKFFQLSQFSNICFLDCLFWLGFXXXXXXXXXXXXXXXXTYFYNMGMISVSCFPRSSSVDNAKRFKTXXXXXXXXXXXXXXXXXXYQSFVITPSVNCGPFQNLTHNYASNGFSFSDYFSNQNFVLKVITIGSDIIFNNNGIWYSIIIIVLSLFFQYIFRAMAVSEIRNYVNYKLADMREKKMSLLEDLKLKMRTLNLDAATYHTEATNENNLDIFFDQFSV 2048
            MIRYESIQLKELTIKRDNLQNMPNNSETIEEESTDIY+ESYPNLKLTKEEALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQIIFLSIISISFIIIPIVIINYENLSIVQYIYQMISPDQKWLMGTPIFYGFYNQS+ NTTKFYYSVGRAYFCVNVICRVFYILCLIRKFIFNVGSIYAT IELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKIFKILRILIVNIFCYGISILILERISWQITNDEIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQLSLIKPKFFQLSQFSNICFLDCLFWLGFYYIPVLPLIYLLILLLTYFYNMGMISVSCFPRSSSVDNAKRFKTIFLLMLLISLIIAFAFLIYQSFVITPSVNCGPFQNLTHNYASNGFSFSDYFSNQNFVLKVITIGSDIIFNNNGIWYSIIIIVLSLFFQYIFRAMAVSEIRNYVNYKLADMREKKMSLLEDLKLKMRTLNLDAATYHTEATNENNLDIFFDQFSV
Sbjct:    1 MIRYESIQLKELTIKRDNLQNMPNNSETIEEESTDIYQESYPNLKLTKEEALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCSYFKINVWITLQIIFLSIISISFIIIPIVIINYENLSIVQYIYQMISPDQKWLMGTPIFYGFYNQSISNTTKFYYSVGRAYFCVNVICRVFYILCLIRKFIFNVGSIYATSIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKNLSKDNEQKIFKILRILIVNIFCYGISILILERISWQITNDEIYIQSHSNIPLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLNAAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQRILMYFLSFISVAAMFTILTDIIKSFFKYLQLSLIKPKFFQLSQFSNICFLDCLFWLGFYYIPVLPLIYLLILLLTYFYNMGMISVSCFPRSSSVDNAKRFKTIFLLMLLISLIIAFAFLIYQSFVITPSVNCGPFQNLTHNYASNGFSFSDYFSNQNFVLKVITIGSDIIFNNNGIWYSIIIIVLSLFFQYIFRAMAVSEIRNYVNYKLADMREKKMSLLEDLKLKMRTLNLDAATYHTEATNENNLDIFFDQFSV 657          
The following BLAST results are available for this feature:
BLAST of Transmembrane channel-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TMC57.174e-621.79transmembrane channel like 5 [Source:HGNC Symbol;A... [more]
TMC57.440e-621.58transmembrane channel like 5 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A226NMA64.904e-1121.46Transmembrane channel-like protein (Fragment) OS=C... [more]
A0A226PQV71.716e-1021.81Transmembrane channel-like protein (Fragment) OS=C... [more]
A0A093Q9F85.889e-1021.56Transmembrane channel-like protein (Fragment) OS=P... [more]
A0A091WFH29.516e-1019.85Transmembrane channel-like protein (Fragment) OS=O... [more]
A0A3S0ZMC01.128e-921.99TMC domain-containing protein OS=Elysia chlorotica... [more]
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002416.10.000e+099.39SMESG000002416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030557 ID=SMED30030557|Name=Transmembrane channel-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2207bp
CAAGTTGAATTGAAGTTTATGTTTATTGGCATTTAAATTTTTTGTAAAAT
ATCTGACAAATCACTATTTACTAATCTATGATACGATATGAGTCCATTCA
GCTCAAAGAATTGACGATAAAGAGAGACAATTTGCAAAACATGCCAAATA
ATTCTGAAACCATTGAGGAAGAATCGACAGATATCTATGAGGAAAGTTAT
CCCAATTTAAAATTGACAAAAGAAGAGGCTCTTACTAGATCTAGAAAATT
TAAAATAATTCAAAAGCATAGCGAAAAGAAGCCCAAATCAACAATCAGCG
AATACAGTAACCATTTCAATGTCTGGAAGTCCGTCAATAAAGTCATTTCA
TGCGATTATGGAGAGGACATGTGTTCTTACTTCAAAATCAATGTATGGAT
AACCTTACAAATAATATTCCTATCAATAATTTCAATCTCTTTTATTATTA
TTCCCATTGTGATTATAAATTATGAAAATTTATCAATTGTTCAATACATT
TATCAAATGATTTCACCAGATCAGAAATGGCTTATGGGCACTCCTATATT
TTATGGGTTTTACAATCAGTCAGTCCAAAATACCACCAAATTTTATTATT
CTGTTGGTCGAGCATATTTTTGTGTCAATGTTATATGTAGAGTATTTTAT
ATACTTTGTCTGATTCGCAAATTTATTTTTAACGTCGGATCAATCTATGC
AACGGGAATTGAGTTAAAATATACTTTGTCACTCAGTTTGTTATTTGGAA
TGTGGAATTTTAATTTGCGGAGCAATCGGGATGCTGAATACAATAAGATG
TATATCCAACATTTTATTAAGAAAAATTTATCGAAAGACAACGAACAGAA
AATTTTTAAAATTTTGAGAATTTTAATTGTTAATATTTTTTGTTATGGAA
TTTCTATTCTCATATTGGAAAGGATAAGCTGGCAAATTACAAATGATGAG
ATATATATCCAATCTCATTCAAATATTCCATTATTGCTAATTCTTCGGGT
TCCGATAACCTTATCCATATGTGTTATTTGTGCAAGTTGGTTGTTCGATT
TCATTCAATGCATTGAAACATTTCAGCATGAACACCATACATTGTATTCG
TCGGCCATTAAAATTTTCACTCTAAATGCAGCTGTACTCGTTATGCTCAA
CTACCATTGGACTAAAATAATTTGGTGCGCAAATAACAATCAAATATCCT
GTTCCTTATTGAGAGACAAAATTCTTATAAATCCAACGTCGCTGTTACAA
ACCTGCTGGGAGACCTGGCTTGGTCAACGGATTTTGATGTATTTTCTATC
ATTCATATCAGTAGCAGCAATGTTTACCATACTAACTGATATTATTAAAT
CATTTTTCAAATATCTCCAATTATCTCTAATTAAACCAAAATTCTTTCAG
CTATCACAATTTAGCAATATTTGTTTTCTTGATTGCTTATTTTGGCTTGG
ATTTTATTATATTCCTGTGTTACCACTGATTTATTTACTTATTTTACTGC
TCACATATTTTTATAACATGGGTATGATATCAGTATCGTGTTTTCCCCGC
AGCTCATCTGTTGATAATGCCAAACGTTTCAAAACTATATTCCTATTAAT
GCTATTGATATCTCTAATAATTGCGTTTGCCTTCCTCATTTATCAAAGTT
TCGTAATTACTCCTTCCGTCAATTGCGGCCCGTTCCAGAATTTAACTCAC
AATTACGCATCCAATGGATTCAGTTTCAGTGATTATTTCAGCAATCAAAA
CTTTGTTTTGAAAGTAATTACCATCGGCTCAGACATCATTTTCAATAATA
ATGGAATTTGGTATTCCATTATTATCATTGTTTTAAGTCTTTTCTTTCAA
TATATCTTCAGAGCTATGGCTGTTAGCGAAATTAGAAACTATGTTAACTA
TAAACTTGCTGACATGAGAGAGAAAAAAATGTCTTTATTGGAAGATTTAA
AATTAAAAATGAGAACACTAAATTTGGATGCAGCTACTTATCACACAGAA
GCTACGAATGAAAATAATTTAGACATATTTTTCGATCAATTTTCGGTTTG
AAAACTTCAAATTACAATTAAAATTATTTGTTAAAGATTAAAACAATTTT
ATTTGATATTTTCTTTTAAAAGACATTTTAAATTTTAATATGTTTATTTG
TTGGTTTTGTTATGGATAAAGAAATTTCCAATTTCATAAAAATATGTTTA
AAAGACG
back to top

protein sequence of SMED30030557-orf-1

>SMED30030557-orf-1 ID=SMED30030557-orf-1|Name=SMED30030557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=658bp
MIRYESIQLKELTIKRDNLQNMPNNSETIEEESTDIYEESYPNLKLTKEE
ALTRSRKFKIIQKHSEKKPKSTISEYSNHFNVWKSVNKVISCDYGEDMCS
YFKINVWITLQIIFLSIISISFIIIPIVIINYENLSIVQYIYQMISPDQK
WLMGTPIFYGFYNQSVQNTTKFYYSVGRAYFCVNVICRVFYILCLIRKFI
FNVGSIYATGIELKYTLSLSLLFGMWNFNLRSNRDAEYNKMYIQHFIKKN
LSKDNEQKIFKILRILIVNIFCYGISILILERISWQITNDEIYIQSHSNI
PLLLILRVPITLSICVICASWLFDFIQCIETFQHEHHTLYSSAIKIFTLN
AAVLVMLNYHWTKIIWCANNNQISCSLLRDKILINPTSLLQTCWETWLGQ
RILMYFLSFISVAAMFTILTDIIKSFFKYLQLSLIKPKFFQLSQFSNICF
LDCLFWLGFYYIPVLPLIYLLILLLTYFYNMGMISVSCFPRSSSVDNAKR
FKTIFLLMLLISLIIAFAFLIYQSFVITPSVNCGPFQNLTHNYASNGFSF
SDYFSNQNFVLKVITIGSDIIFNNNGIWYSIIIIVLSLFFQYIFRAMAVS
EIRNYVNYKLADMREKKMSLLEDLKLKMRTLNLDAATYHTEATNENNLDI
FFDQFSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR038900TMC
IPR012496TMC_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012496TMC domainPFAMPF07810TMCcoord: 393..491
e-value: 8.1E-8
score: 32.8
IPR038900Transmembrane channel-like proteinPANTHERPTHR23302TRANSMEMBRANE CHANNEL-RELATEDcoord: 40..630
NoneNo IPR availableTMHMMTMhelixcoord: 401..423
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 504..526
NoneNo IPR availableTMHMMTMhelixcoord: 301..323
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 577..599
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 262..280
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 457..479