histone h2a.z-1

Overview
Namehistone h2a.z-1 (AFJ24840.1)
Smed IDSMED30030543
Length (bp)528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone h2a.z-1 (SMED30030543) t-SNE clustered cells

Violin plots show distribution of expression levels for histone h2a.z-1 (SMED30030543) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone h2a.z-1 (SMED30030543) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone h2a.z-1 (SMED30030543) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030543

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030543SMESG000020395.1 SmedASXL_006243SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30030543SMESG000020395.1 dd_Smed_v4_2614_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030543SMESG000020395.1 dd_Smed_v4_2614_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030543SMESG000020395.1 dd_Smed_v6_2614_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30030543SMESG000020395.1 isotig05441be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30030543SMESG000020395.1 dd_Smed_v4_2614_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030543SMESG000020395.1 SMED_03674_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030543SMESG000020395.1 SMED_03674_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone h2a.z-1 vs. Ensembl Human
Match: H2AZ1 (H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HGNC:4741])

HSP 1 Score: 210.305 bits (534), Expect = 2.554e-70
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 208.379 bits (529), Expect = 1.540e-69
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Human
Match: H2AZ1 (H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HGNC:4741])

HSP 1 Score: 203.371 bits (516), Expect = 1.115e-67
Identity = 104/122 (85.25%), Postives = 114/122 (93.44%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIA GGVIPHIHKSL+GKK
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIA-GGVIPHIHKSLIGKK 121          
BLAST of histone h2a.z-1 vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 184.882 bits (468), Expect = 2.484e-60
Identity = 91/114 (79.82%), Postives = 104/114 (91.23%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHI 399
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGG+  ++
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGMYYYL 114          
BLAST of histone h2a.z-1 vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 181.03 bits (458), Expect = 5.789e-59
Identity = 90/108 (83.33%), Postives = 100/108 (92.59%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGG 381
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGG
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGG 108          
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 193.741 bits (491), Expect = 5.318e-64
Identity = 98/124 (79.03%), Postives = 110/124 (88.71%), Query Frame = 1
Query:   64 MAGGK--AGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGK  AGKD+   K+K +SRS R+GLQFPVGRIHRFLK  +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELD LIKATIAGGGVIPHIH+ L+ KK
Sbjct:    1 MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKK 124          
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 193.741 bits (491), Expect = 5.318e-64
Identity = 98/124 (79.03%), Postives = 110/124 (88.71%), Query Frame = 1
Query:   64 MAGGK--AGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGK  AGKD+   K+K +SRS R+GLQFPVGRIHRFLK  +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELD LIKATIAGGGVIPHIH+ L+ KK
Sbjct:    1 MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKK 124          
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 193.741 bits (491), Expect = 5.318e-64
Identity = 98/124 (79.03%), Postives = 110/124 (88.71%), Query Frame = 1
Query:   64 MAGGK--AGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGK  AGKD+   K+K +SRS R+GLQFPVGRIHRFLK  +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELD LIKATIAGGGVIPHIH+ L+ KK
Sbjct:    1 MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKK 124          
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 126.331 bits (316), Expect = 1.216e-37
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK-ATIAGGGVIPHIHKSLVGKKPEG 432
            SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYL AEVLELAGNA++D K  RI+PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK  G
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQ-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTAG 124          
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 126.331 bits (316), Expect = 1.216e-37
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK-ATIAGGGVIPHIHKSLVGKKPEG 432
            SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYL AEVLELAGNA++D K  RI+PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK  G
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQ-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTAG 124          
BLAST of histone h2a.z-1 vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0085062)

HSP 1 Score: 209.92 bits (533), Expect = 2.809e-70
Identity = 105/128 (82.03%), Postives = 116/128 (90.62%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 441
            MAGGKAGKD+   KAK +SRS R+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK E + D
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQD 128          
BLAST of histone h2a.z-1 vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0334311)

HSP 1 Score: 209.92 bits (533), Expect = 2.809e-70
Identity = 105/128 (82.03%), Postives = 116/128 (90.62%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 441
            MAGGKAGKD+   KAK +SRS R+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK E + D
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQD 128          
BLAST of histone h2a.z-1 vs. Ensembl Fly
Match: His2A:CG33850 (gene:FBgn0053850 transcript:FBtr0091854)

HSP 1 Score: 127.102 bits (318), Expect = 6.585e-38
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK-ATIAGGGVIPHIHKSLVGKKPE 429
            SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of histone h2a.z-1 vs. Ensembl Fly
Match: His2A:CG33847 (gene:FBgn0053847 transcript:FBtr0091851)

HSP 1 Score: 127.102 bits (318), Expect = 6.585e-38
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK-ATIAGGGVIPHIHKSLVGKKPE 429
            SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of histone h2a.z-1 vs. Ensembl Fly
Match: His2A:CG33844 (gene:FBgn0053844 transcript:FBtr0091848)

HSP 1 Score: 127.102 bits (318), Expect = 6.585e-38
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK-ATIAGGGVIPHIHKSLVGKKPE 429
            SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 209.149 bits (531), Expect = 4.402e-70
Identity = 104/124 (83.87%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Match: h2az2a (H2A.Z variant histone 2a [Source:NCBI gene;Acc:252913])

HSP 1 Score: 208.379 bits (529), Expect = 9.794e-70
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 206.453 bits (524), Expect = 5.776e-69
Identity = 103/122 (84.43%), Postives = 114/122 (93.44%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
             AGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK
Sbjct:    1 QAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Match: hist1h2a1 (histone cluster 1 H2A family member1 [Source:ZFIN;Acc:ZDB-GENE-121214-150])

HSP 1 Score: 131.339 bits (329), Expect = 1.998e-39
Identity = 73/121 (60.33%), Postives = 89/121 (73.55%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKKPE 429
            GGKA     +AK  SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:    8 GGKA-----RAKAKSRSSRAGLQFPVGRIHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Match: hist1h2a5 (histone cluster 1 H2A family member 5 [Source:ZFIN;Acc:ZDB-GENE-131121-77])

HSP 1 Score: 130.954 bits (328), Expect = 2.595e-39
Identity = 73/124 (58.87%), Postives = 89/124 (71.77%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPEGLT 438
            G   GK   KAKT  RS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E  T
Sbjct:    5 GKTGGKTRAKAKT--RSSRAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAT 125          
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Match: arrdc2 (arrestin domain containing 2 [Source:Xenbase;Acc:XB-GENE-946088])

HSP 1 Score: 208.379 bits (529), Expect = 1.396e-69
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Match: h2a.zl (H2A.Z variant histone 1 [Source:NCBI gene;Acc:448675])

HSP 1 Score: 207.994 bits (528), Expect = 2.139e-69
Identity = 104/124 (83.87%), Postives = 114/124 (91.94%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAK--TISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKDT KAK  +I+RS R+GLQFPVGRIHR LK+ +++ GR+G TAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDTGKAKATSITRSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Match: h2a.zl (H2A.Z variant histone 1 [Source:NCBI gene;Acc:448675])

HSP 1 Score: 204.527 bits (519), Expect = 4.905e-68
Identity = 103/123 (83.74%), Postives = 113/123 (91.87%), Query Frame = 1
Query:   67 AGGKAGKDTCKAK--TISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            AGGKAGKDT KAK  +I+RS R+GLQFPVGRIHR LK+ +++ GR+G TAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    3 AGGKAGKDTGKAKATSITRSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKKGQ 125          
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Match: cited4 (Cbp/p300-interacting transactivator, with Glu/Asp rich carboxy-terminal domain, 4 [Source:Xenbase;Acc:XB-GENE-946639])

HSP 1 Score: 133.65 bits (335), Expect = 4.434e-40
Identity = 74/129 (57.36%), Postives = 91/129 (70.54%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPEGLTD*FKC 453
            G + GK   KAKT  RS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E     FK 
Sbjct:    5 GKQGGKTRAKAKT--RSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAYFKA 130          
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Match: ENSXETT00000002762.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:125293331:125293968:-1 gene:ENSXETG00000000652.1 transcript:ENSXETT00000002762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 4.434e-40
Identity = 74/129 (57.36%), Postives = 91/129 (70.54%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPEGLTD*FKC 453
            G + GK   KAKT  RS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E     FK 
Sbjct:    5 GKQGGKTRAKAKT--RSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAYFKA 130          
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Match: H2az1 (H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI:1888388])

HSP 1 Score: 210.305 bits (534), Expect = 1.753e-70
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Match: H2az2 (H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI:1924855])

HSP 1 Score: 208.379 bits (529), Expect = 1.057e-69
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Match: H2az1 (H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI:1888388])

HSP 1 Score: 152.91 bits (385), Expect = 3.286e-48
Identity = 83/124 (66.94%), Postives = 93/124 (75.00%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAE                       LAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE-----------------------LAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 101          
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Match: H2ac1 (H2A clustered histone 1 [Source:MGI Symbol;Acc:MGI:2448285])

HSP 1 Score: 136.346 bits (342), Expect = 2.907e-41
Identity = 75/121 (61.98%), Postives = 91/121 (75.21%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPE 429
            GGKA     +AK  SRS R+GLQFPVGR+HR L+  +  + RIGA A VY AA+LEYLTAEVLELAGNA++D K  RI+PRHLQLAIR DEEL+ L+ + TIA GGV+P+I   L+ KK E
Sbjct:    8 GGKA-----RAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQ-RIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Match: H2ac20 (H2A clustered histone 20 [Source:MGI Symbol;Acc:MGI:2448316])

HSP 1 Score: 134.42 bits (337), Expect = 1.412e-40
Identity = 74/121 (61.16%), Postives = 90/121 (74.38%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPE 429
            G + GK   KAK  SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLAIR DEEL+ L+ K TIA GGV+P+I   L+ KK E
Sbjct:    5 GKQGGKARAKAK--SRSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Match: sp|Q6YNC8|H2AZ_SHEEP (Histone H2A.Z OS=Ovis aries OX=9940 GN=H2AZ1 PE=2 SV=3)

HSP 1 Score: 210.305 bits (534), Expect = 1.226e-69
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Match: sp|P0C0S7|H2AZ_RAT (Histone H2A.Z OS=Rattus norvegicus OX=10116 GN=H2az1 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 1.226e-69
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Match: sp|Q5RC42|H2AZ_PONAB (Histone H2A.Z OS=Pongo abelii OX=9601 GN=H2AZ1 PE=2 SV=3)

HSP 1 Score: 210.305 bits (534), Expect = 1.226e-69
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Match: sp|P22647|H2AZ_ONCMY (Histone H2A.Z OS=Oncorhynchus mykiss OX=8022 GN=h2az1 PE=1 SV=4)

HSP 1 Score: 210.305 bits (534), Expect = 1.226e-69
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Match: sp|P0C0S6|H2AZ_MOUSE (Histone H2A.Z OS=Mus musculus OX=10090 GN=H2az1 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 1.226e-69
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. TrEMBL
Match: I1ZII6 (Histone H2A OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 2.013e-84
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 441
            MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD
Sbjct:    1 MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 126          
BLAST of histone h2a.z-1 vs. TrEMBL
Match: K9IQB8 (Histone H2A (Fragment) OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.861e-68
Identity = 107/128 (83.59%), Postives = 118/128 (92.19%), Query Frame = 1
Query:   46 SSTLF*MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            +S  F MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK
Sbjct:    1 ASAEFEMAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 128          
BLAST of histone h2a.z-1 vs. TrEMBL
Match: A0A1B3IQX3 (Histone H2A OS=Hydractinia echinata OX=35630 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 3.266e-68
Identity = 106/121 (87.60%), Postives = 115/121 (95.04%), Query Frame = 1
Query:   64 MAGGKAGKDT-CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGKAGKD+  K K+ SRS R+GLQFPVGRIHR+LKS S+NKGR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSL+GKK
Sbjct:    1 MAGGKAGKDSKPKTKSTSRSARAGLQFPVGRIHRYLKSRSTNKGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDLLIKATIAGGGVIPHIHKSLIGKK 121          
BLAST of histone h2a.z-1 vs. TrEMBL
Match: T2MHP0 (Histone H2A OS=Hydra vulgaris OX=6087 GN=H2AFZ PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.013e-67
Identity = 105/121 (86.78%), Postives = 114/121 (94.21%), Query Frame = 1
Query:   64 MAGGKAGKDT-CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGKAGKD+  K K+ SRS R+GLQFPVGRIHR+LKS S+NKGR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSL+ KK
Sbjct:    1 MAGGKAGKDSKPKTKSTSRSARAGLQFPVGRIHRYLKSRSTNKGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDLLIKATIAGGGVIPHIHKSLMNKK 121          
BLAST of histone h2a.z-1 vs. TrEMBL
Match: H0W952 (Histone H2A OS=Cavia porcellus OX=10141 GN=H2AFZ PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.172e-67
Identity = 105/124 (84.68%), Postives = 116/124 (93.55%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ KAKT  +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKTKGVSRSQRAGLQFPVGRIHRLLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Match: H2AZ1 (histone H2A.Z [Source:NCBI gene;Acc:103038819])

HSP 1 Score: 209.149 bits (531), Expect = 3.571e-70
Identity = 104/124 (83.87%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:103037668])

HSP 1 Score: 208.379 bits (529), Expect = 8.301e-70
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Match: h2az2b (histone H2A.V [Source:NCBI gene;Acc:103039302])

HSP 1 Score: 207.994 bits (528), Expect = 9.061e-70
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:103037668])

HSP 1 Score: 204.912 bits (520), Expect = 2.216e-68
Identity = 102/122 (83.61%), Postives = 113/122 (92.62%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
             AGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK
Sbjct:    7 QAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 128          
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Match: h2az2b (histone H2A.V [Source:NCBI gene;Acc:103039302])

HSP 1 Score: 194.512 bits (493), Expect = 1.830e-64
Identity = 94/112 (83.93%), Postives = 105/112 (93.75%), Query Frame = 1
Query:   94 CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
             KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    4 AKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 115          
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 4.091e-39
Identity = 70/119 (58.82%), Postives = 87/119 (73.11%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKK 423
            G   GK   KAK  SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:    5 GKTGGKSRAKAK--SRSSRAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 5.263e-39
Identity = 71/119 (59.66%), Postives = 88/119 (73.95%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKK 423
            GGKA     +AK  SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:    8 GGKA-----RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 8.578e-39
Identity = 70/119 (58.82%), Postives = 87/119 (73.11%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKK 423
            G   GK   KAK  SRS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:    5 GKTGGKSRAKAK--SRSSRAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011166.1 (pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088:1 gene:ENSPMAG00000010139.1 transcript:ENSPMAT00000011166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 1.400e-38
Identity = 72/120 (60.00%), Postives = 87/120 (72.50%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFL-KSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKK 423
            G   GK   KAK  SRS R+GLQFPVGR+HR L K N +   R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:    5 GKTGGKSRAKAK--SRSSRAGLQFPVGRVHRLLCKGNYAQ--RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011070.1 (pep scaffold:Pmarinus_7.0:GL476925:253954:254352:-1 gene:ENSPMAG00000010041.1 transcript:ENSPMAT00000011070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 2.765e-37
Identity = 69/123 (56.10%), Postives = 88/123 (71.54%), Query Frame = 1
Query:   64 MAG-GKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKKP 426
            M+G GK G  + +AK  SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P        ++P
Sbjct:    1 MSGRGKTGGKS-RAKAKSRSSRAGLQFPVGRIHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPTSRPCCCPRRP 121          
BLAST of histone h2a.z-1 vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 154.451 bits (389), Expect = 2.642e-49
Identity = 77/115 (66.96%), Postives = 99/115 (86.09%), Query Frame = 1
Query:   73 GKAG-KDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLV 414
            GK+G KD+   ++ S S R+GLQFPVGRI R+LK +++ + R+G+ AA+Y  A+LEYLTAEVLELAGNA+KDLKVKRI+PRHLQLAIRGD+ELD LI+ATIA GGV+PHI+K+L+
Sbjct:   10 GKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALL 124          
BLAST of histone h2a.z-1 vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 122.479 bits (306), Expect = 7.451e-37
Identity = 62/105 (59.05%), Postives = 81/105 (77.14%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKK 423
            SRS ++GL FPVGR+HR L+  +  + RIG+ A VY  A+LEYL AE+LELAGNA++D K  RI PRHLQLAIR D+EL+ L+   TIA GGV+P+IH++L+ KK
Sbjct:   18 SRSAKAGLTFPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKK 121          
BLAST of histone h2a.z-1 vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 122.479 bits (306), Expect = 7.451e-37
Identity = 62/105 (59.05%), Postives = 81/105 (77.14%), Query Frame = 1
Query:  112 SRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKK 423
            SRS ++GL FPVGR+HR L+  +  + RIG+ A VY  A+LEYL AE+LELAGNA++D K  RI PRHLQLAIR D+EL+ L+   TIA GGV+P+IH++L+ KK
Sbjct:   18 SRSAKAGLTFPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKK 121          
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Match: EDO46289 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8])

HSP 1 Score: 205.297 bits (521), Expect = 4.636e-69
Identity = 102/121 (84.30%), Postives = 113/121 (93.39%), Query Frame = 1
Query:   64 MAGGKAGKDT-CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            MAGGKAGKD+  KAK +SRS R+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK
Sbjct:    1 MAGGKAGKDSKAKAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 121          
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Match: EDO34611 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SNV0])

HSP 1 Score: 133.65 bits (335), Expect = 7.283e-41
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query:   64 MAG-GKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKKPE 429
            M+G GK GK   K K  SRS R+GLQFPVGR+HRFL+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:    1 MSGRGKGGKSRAKGK--SRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKSE 121          
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Match: EDO31130 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SYT5])

HSP 1 Score: 133.265 bits (334), Expect = 1.256e-40
Identity = 73/124 (58.87%), Postives = 92/124 (74.19%), Query Frame = 1
Query:   64 MAG-GKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKKPE 429
            M+G GK GK   K K  SRS R+GLQFPVGR+HRFL+  +  + R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ K+ E
Sbjct:    1 MSGRGKGGKSRAKGK--SRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKRSE 121          
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Match: EDO49641 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0])

HSP 1 Score: 133.65 bits (335), Expect = 1.262e-40
Identity = 72/121 (59.50%), Postives = 91/121 (75.21%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKK 423
            M+G   GK   K+K  +RS R+GLQFPVGRIHRFL+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L++  TIA GGV+P+I   L+ KK
Sbjct:    1 MSGRGKGK-INKSKVKTRSSRAGLQFPVGRIHRFLRKGNYAE-RVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKK 119          
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Match: EDO46356 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5])

HSP 1 Score: 132.494 bits (332), Expect = 2.388e-40
Identity = 73/124 (58.87%), Postives = 92/124 (74.19%), Query Frame = 1
Query:   64 MAG-GKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKA-TIAGGGVIPHIHKSLVGKKPE 429
            M+G GK GK   K K  SRS ++GLQFPVGR+HRFL+  +  K R+GA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TI+ GGV+P+I   L+ KK E
Sbjct:    1 MSGRGKGGKSRAKGK--SRSAKAGLQFPVGRVHRFLRKGNYAK-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKKSE 121          
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Match: H2AFZ (histone H2A.Z [Source:NCBI gene;Acc:101172846])

HSP 1 Score: 208.764 bits (530), Expect = 4.984e-70
Identity = 105/124 (84.68%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKT--ISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+ K KT  ISRSQR+GLQFPVGRIHR LKS +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKTKTKAISRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 208.379 bits (529), Expect = 8.249e-70
Identity = 103/124 (83.06%), Postives = 115/124 (92.74%), Query Frame = 1
Query:   64 MAGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
            MAGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    1 MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124          
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 204.527 bits (519), Expect = 8.340e-66
Identity = 102/121 (84.30%), Postives = 113/121 (93.39%), Query Frame = 1
Query:   67 AGGKAGKDT--CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKK 423
            AGGKAGKD+   KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK
Sbjct:  190 AGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 310          
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 194.897 bits (494), Expect = 1.590e-64
Identity = 94/112 (83.93%), Postives = 105/112 (93.75%), Query Frame = 1
Query:   94 CKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPE 429
             KAK +SRSQR+GLQFPVGRIHR LK+ +++ GR+GATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKK +
Sbjct:    8 AKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 119          
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Match: ENSORLT00000043619.1 (pep primary_assembly:ASM223467v1:1:2176285:2181192:1 gene:ENSORLG00000022228.1 transcript:ENSORLT00000043619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 3.990e-39
Identity = 72/121 (59.50%), Postives = 88/121 (72.73%), Query Frame = 1
Query:   70 GGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPE 429
            G   GK   KAKT  RS R+GLQFPVGR+HR L+  +  + R+GA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct:    5 GKTGGKARAKAKT--RSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of histone h2a.z-1 vs. Planmine SMEST
Match: SMESG000020395.1 (SMESG000020395.1)

HSP 1 Score: 253.832 bits (647), Expect = 5.598e-88
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 441
            MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD
Sbjct:    1 MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKPEGLTD 126          
BLAST of histone h2a.z-1 vs. Planmine SMEST
Match: SMESG000074553.1 (SMESG000074553.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.312e-54
Identity = 102/123 (82.93%), Postives = 111/123 (90.24%), Query Frame = 1
Query:   64 MAGGKAGKDTCKAKTISRS--QRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKP 426
            MA GKAGKD+ K+K+ S S   R+GLQFPVGRIHR LKS +++ GR+GATAAVY AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKKP
Sbjct:    1 MAKGKAGKDSGKSKSKSISRSHRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYAAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKP 123          
BLAST of histone h2a.z-1 vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 137.502 bits (345), Expect = 5.596e-42
Identity = 77/122 (63.11%), Postives = 94/122 (77.05%), Query Frame = 1
Query:   67 AGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPE 429
            A GKAGK T K+++ +RS R+GLQFPVGRIHR L+  +  + R+GA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+ K TIA GGV+P+I  SL+ KK E
Sbjct:    3 AKGKAGK-TTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAE 122          
BLAST of histone h2a.z-1 vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 137.117 bits (344), Expect = 5.750e-42
Identity = 77/122 (63.11%), Postives = 94/122 (77.05%), Query Frame = 1
Query:   67 AGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKKPE 429
            A GKAGK T K+++ +RS R+GLQFPVGRIHR L+  +  + R+GA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+ K TIA GGV+P+I  SL+ KK E
Sbjct:    3 AKGKAGK-TTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAE 122          
BLAST of histone h2a.z-1 vs. Planmine SMEST
Match: SMESG000018807.1 (SMESG000018807.1)

HSP 1 Score: 132.109 bits (331), Expect = 7.634e-40
Identity = 76/122 (62.30%), Postives = 90/122 (73.77%), Query Frame = 1
Query:   64 MAG-GKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLI-KATIAGGGVIPHIHKSLVGKK 423
            M+G GK GK   KAK  SRS R+GLQFPVGRIHR L+  +  + R+GA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:    1 MSGRGKGGKSRNKAK--SRSVRAGLQFPVGRIHRMLRKGNYAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGSVTIAQGGVLPNIQSVLLPKK 119          
The following BLAST results are available for this feature:
BLAST of histone h2a.z-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AZ12.554e-7084.68H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ21.540e-6983.06H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ11.115e-6785.25H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ22.484e-6079.82H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ25.789e-5983.33H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htz-15.318e-6479.03Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-15.318e-6479.03Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-15.318e-6479.03Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
his-351.216e-3761.11Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-351.216e-3761.11Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2Av2.809e-7082.03gene:FBgn0001197 transcript:FBtr0085062[more]
His2Av2.809e-7082.03gene:FBgn0001197 transcript:FBtr0334311[more]
His2A:CG338506.585e-3862.62gene:FBgn0053850 transcript:FBtr0091854[more]
His2A:CG338476.585e-3862.62gene:FBgn0053847 transcript:FBtr0091851[more]
His2A:CG338446.585e-3862.62gene:FBgn0053844 transcript:FBtr0091848[more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h2az2b4.402e-7083.87H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
h2az2a9.794e-7083.06H2A.Z variant histone 2a [Source:NCBI gene;Acc:252... [more]
h2az2b5.776e-6984.43H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
hist1h2a11.998e-3960.33histone cluster 1 H2A family member1 [Source:ZFIN;... [more]
hist1h2a52.595e-3958.87histone cluster 1 H2A family member 5 [Source:ZFIN... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrdc21.396e-6983.06arrestin domain containing 2 [Source:Xenbase;Acc:X... [more]
h2a.zl2.139e-6983.87H2A.Z variant histone 1 [Source:NCBI gene;Acc:4486... [more]
h2a.zl4.905e-6883.74H2A.Z variant histone 1 [Source:NCBI gene;Acc:4486... [more]
cited44.434e-4057.36Cbp/p300-interacting transactivator, with Glu/Asp ... [more]
ENSXETT00000002762.14.434e-4057.36pep primary_assembly:Xenopus_tropicalis_v9.1:3:125... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2az11.753e-7084.68H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2az21.057e-6983.06H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI... [more]
H2az13.286e-4866.94H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2ac12.907e-4161.98H2A clustered histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2ac201.412e-4061.16H2A clustered histone 20 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of histone h2a.z-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6YNC8|H2AZ_SHEEP1.226e-6984.68Histone H2A.Z OS=Ovis aries OX=9940 GN=H2AZ1 PE=2 ... [more]
sp|P0C0S7|H2AZ_RAT1.226e-6984.68Histone H2A.Z OS=Rattus norvegicus OX=10116 GN=H2a... [more]
sp|Q5RC42|H2AZ_PONAB1.226e-6984.68Histone H2A.Z OS=Pongo abelii OX=9601 GN=H2AZ1 PE=... [more]
sp|P22647|H2AZ_ONCMY1.226e-6984.68Histone H2A.Z OS=Oncorhynchus mykiss OX=8022 GN=h2... [more]
sp|P0C0S6|H2AZ_MOUSE1.226e-6984.68Histone H2A.Z OS=Mus musculus OX=10090 GN=H2az1 PE... [more]
back to top
BLAST of histone h2a.z-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZII62.013e-84100.00Histone H2A OS=Schmidtea mediterranea OX=79327 PE=... [more]
K9IQB82.861e-6883.59Histone H2A (Fragment) OS=Desmodus rotundus OX=943... [more]
A0A1B3IQX33.266e-6887.60Histone H2A OS=Hydractinia echinata OX=35630 PE=2 ... [more]
T2MHP02.013e-6786.78Histone H2A OS=Hydra vulgaris OX=6087 GN=H2AFZ PE=... [more]
H0W9522.172e-6784.68Histone H2A OS=Cavia porcellus OX=10141 GN=H2AFZ P... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AZ13.571e-7083.87histone H2A.Z [Source:NCBI gene;Acc:103038819][more]
h2az2a8.301e-7083.06histone H2A.V [Source:NCBI gene;Acc:103037668][more]
h2az2b9.061e-7083.06histone H2A.V [Source:NCBI gene;Acc:103039302][more]
h2az2a2.216e-6883.61histone H2A.V [Source:NCBI gene;Acc:103037668][more]
h2az2b1.830e-6483.93histone H2A.V [Source:NCBI gene;Acc:103039302][more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005338.14.091e-3958.82pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000011253.15.263e-3959.66pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000002388.18.578e-3958.82pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
ENSPMAT00000011166.11.400e-3860.00pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088... [more]
ENSPMAT00000011070.12.765e-3756.10pep scaffold:Pmarinus_7.0:GL476925:253954:254352:-... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HTZ12.642e-4966.96Histone variant H2AZ; exchanged for histone H2A in... [more]
HTA27.451e-3759.05Histone H2A; core histone protein required for chr... [more]
HTA17.451e-3759.05Histone H2A; core histone protein required for chr... [more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO462894.636e-6984.30Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8][more]
EDO346117.283e-4159.68Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SNV0][more]
EDO311301.256e-4058.87Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SYT5][more]
EDO496411.262e-4059.50Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0][more]
EDO463562.388e-4058.87Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5][more]
back to top
BLAST of histone h2a.z-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AFZ4.984e-7084.68histone H2A.Z [Source:NCBI gene;Acc:101172846][more]
h2az2a8.249e-7083.06histone H2A.V [Source:NCBI gene;Acc:101170644][more]
h2az2a8.340e-6684.30histone H2A.V [Source:NCBI gene;Acc:101170644][more]
h2az2a1.590e-6483.93histone H2A.V [Source:NCBI gene;Acc:101170644][more]
ENSORLT00000043619.13.990e-3959.50pep primary_assembly:ASM223467v1:1:2176285:2181192... [more]
back to top
BLAST of histone h2a.z-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020395.15.598e-88100.00SMESG000020395.1[more]
SMESG000074553.11.312e-5482.93SMESG000074553.1[more]
SMESG000006040.15.596e-4263.11SMESG000006040.1[more]
SMESG000006040.15.750e-4263.11SMESG000006040.1[more]
SMESG000018807.17.634e-4062.30SMESG000018807.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030543
GenBankAFJ24840.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030543 ID=SMED30030543|Name=histone h2a.z-1|organism=Schmidtea mediterranea sexual|type=transcript|length=528bp
TAATTTTTTAACTATTATTATTGTTTATATAGGTTGATATTTTAAAGCTC
AACATTATTTTAAATGGCAGGTGGAAAAGCAGGAAAAGATACTTGTAAAG
CTAAAACTATTTCTAGATCACAAAGATCTGGATTACAATTTCCTGTTGGT
CGTATTCACAGGTTTTTGAAATCGAATTCATCCAACAAAGGACGTATTGG
AGCAACAGCTGCAGTTTACACTGCCGCTATACTTGAATATTTGACAGCTG
AAGTGTTGGAATTAGCTGGAAATGCCAGCAAAGATTTAAAAGTTAAACGT
ATTTCCCCTCGCCATTTGCAATTGGCAATCCGAGGAGATGAAGAACTTGA
CGTTTTAATTAAAGCCACTATTGCTGGCGGTGGAGTTATTCCTCATATTC
ATAAAAGTCTTGTTGGTAAAAAGCCAGAGGGTCTTACAGATTGATTTAAA
TGTATATAAAATAGAATTTAATGTTATTATATTGTTGTTAAATATGTATG
TGTATTTATAAATAAACAATGTTTTCCC
back to top

protein sequence of SMED30030543-orf-1

>SMED30030543-orf-1 ID=SMED30030543-orf-1|Name=SMED30030543-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MAGGKAGKDTCKAKTISRSQRSGLQFPVGRIHRFLKSNSSNKGRIGATAA
VYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIK
ATIAGGGVIPHIHKSLVGKKPEGLTD*
back to top
Aliases
The feature 'histone h2a.z-1' has the following synonyms
Synonym
h2a.z-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR007125Histone_H2A/H2B/H3
IPR032454Histone_H2A_C
IPR009072Histone-fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 14..36
score: 66.67
coord: 100..118
score: 52.33
coord: 44..59
score: 68.69
coord: 73..87
score: 64.51
coord: 59..72
score: 84.63
IPR002119Histone H2ASMARTSM00414h2a4coord: 3..123
e-value: 7.7E-67
score: 238.0
IPR002119Histone H2ACDDcd00074H2Acoord: 12..120
e-value: 2.07067E-57
score: 171.749
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..125
e-value: 8.5E-51
score: 173.2
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 3..100
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 13..92
e-value: 1.6E-17
score: 64.1
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 93..122
e-value: 1.1E-11
score: 44.3
NoneNo IPR availablePANTHERPTHR23430HISTONE H2Acoord: 4..121
NoneNo IPR availablePANTHERPTHR23430:SF47HISTONE H2A.Zcoord: 4..121