Neurogenic locus Notch protein

Overview
NameNeurogenic locus Notch protein
Smed IDSMED30030526
Length (bp)2148
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurogenic locus Notch protein (SMED30030526) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurogenic locus Notch protein (SMED30030526) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurogenic locus Notch protein (SMED30030526) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurogenic locus Notch protein (SMED30030526) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030526SMESG000035155.1 SmedASXL_014768SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030526SMESG000035155.1 dd_Smed_v4_11097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030526SMESG000035155.1 dd_Smed_v4_11097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030526SMESG000035155.1 dd_Smed_v4_11097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030526SMESG000035155.1 dd_Smed_v4_11097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030526SMESG000035155.1 dd_Smed_v6_11097_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030526SMESG000035155.1 dd_Smed_v4_11097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: ERICH6 (glutamate rich 6 [Source:HGNC Symbol;Acc:HGNC:28602])

HSP 1 Score: 110.923 bits (276), Expect = 6.595e-25
Identity = 107/399 (26.82%), Postives = 175/399 (43.86%), Query Frame = 1
Query:  793 SNVDQSK-----LFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVII-----NMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPF---QPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKC 1947
            SNVD S        CC  F++L+D+       E    TKP  K  LI I PH +H +             K +EK L+R+    +A   +                    +  E   FS   S      ++L+ I+YQLS                   +I  K+ + D++      N + + +  D     G   +  L+    ++Y +G  F+  FP G   I+YPSGNLAI  V    N    C++ +D+      NP IL +  ++G  S  H +G++ +  + L G    + G++ R W W     + + PF   +P+FL+LNR+IG+RI  Q+ I + F ++ +Q  I+VG K K+P   +  +L  V  +   ++  LI I+ R+   +E C
Sbjct:  137 SNVDVSSEPKGHASCCIAFQNLIDYIY-----EEQIKTKPP-KAELIAIDPHAAHGSEV--------DRLKAKEKALQRKQEQRMARHFA-------------------IISREQTHFSEDDS------KRLKTISYQLSV------------------DIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELL---EKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVN-GFTCIVQEDMPT----NPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNS--ITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIR-RLFHKLEGC 467          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: ERICH6 (glutamate rich 6 [Source:HGNC Symbol;Acc:HGNC:28602])

HSP 1 Score: 110.923 bits (276), Expect = 1.224e-24
Identity = 107/399 (26.82%), Postives = 175/399 (43.86%), Query Frame = 1
Query:  793 SNVDQSK-----LFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVII-----NMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPF---QPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKC 1947
            SNVD S        CC  F++L+D+       E    TKP  K  LI I PH +H +             K +EK L+R+    +A   +                    +  E   FS   S      ++L+ I+YQLS                   +I  K+ + D++      N + + +  D     G   +  L+    ++Y +G  F+  FP G   I+YPSGNLAI  V    N    C++ +D+      NP IL +  ++G  S  H +G++ +  + L G    + G++ R W W     + + PF   +P+FL+LNR+IG+RI  Q+ I + F ++ +Q  I+VG K K+P   +  +L  V  +   ++  LI I+ R+   +E C
Sbjct:  283 SNVDVSSEPKGHASCCIAFQNLIDYIY-----EEQIKTKPP-KAELIAIDPHAAHGSEV--------DRLKAKEKALQRKQEQRMARHFA-------------------IISREQTHFSEDDS------KRLKTISYQLSV------------------DIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELL---EKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVN-GFTCIVQEDMPT----NPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNS--ITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIR-RLFHKLEGC 613          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: ERICH6B (glutamate rich 6B [Source:HGNC Symbol;Acc:HGNC:26523])

HSP 1 Score: 89.3521 bits (220), Expect = 8.921e-18
Identity = 48/155 (30.97%), Postives = 82/155 (52.90%), Query Frame = 1
Query: 1384 YPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSK--IPE 1842
            YPN  ++ ++FP G   I+YPSGNLA+ I+          ++ D +     +  I  + + +G  +F   + DI +   +  G+   +D  +K   +W+   HVHAPP QP+ L +N +I ++I +Q+ I   F    +QI +N+G + K  IPE
Sbjct:  480 YPNKNVYQILFPDGTGQIHYPSGNLAMLILYAKMKKFTYIILEDSL-----EGRIRALINNSGNATFYDENSDIWLNLSSNLGYYFPKDKRQKAWNWWNLNIHVHAPPVQPISLKINEYIQVQIRSQDKIIFCFTYEQKQICLNLGTRYKFVIPE 629          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: ntn3 (netrin 3 [Source:Xenbase;Acc:XB-GENE-960264])

HSP 1 Score: 89.3521 bits (220), Expect = 3.997e-18
Identity = 60/219 (27.40%), Postives = 111/219 (50.68%), Query Frame = 1
Query: 1378 QYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDG----KPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKP-LIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAK 2019
            ++Y  G  F++ FP G A I+YPSGN+A+  +        + +I  D  +      IL +  ++G  +  H +G++ +  + + G      G K R+W W      +P+V   PF+P+F+SLN+ +GIRI +Q  I+++F S+ +Q  IN+  + +   + Q R+  +V L    I +  L A K ++  ++ K    +  P     +K    P+ +A+
Sbjct:  217 KFYRTGQRFLITFPDGTAQIFYPSGNVAVVAIATNRK-DSVYIIQGDKDV---NADILAVFGSSGKATCYHPNGNVCL--NPVGGQYFDHTGMKLRRWRWKSTDLSEPYV---PFKPVFISLNQQVGIRICSQEQIYISFLSMGKQAKINIWTRHQT--KTQVRINELVNLNKWFIEELILFATKIKILSLLNKLEGYVNFPTNEQWDKLKAPPFLVAQ 424          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: ntn3 (netrin 3 [Source:Xenbase;Acc:XB-GENE-960264])

HSP 1 Score: 85.5001 bits (210), Expect = 3.996e-17
Identity = 48/162 (29.63%), Postives = 88/162 (54.32%), Query Frame = 1
Query: 1378 QYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDG----KPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQ 1851
            ++Y  G  F++ FP G A I+YPSGN+A+  +        + +I  D  +      IL +  ++G  +  H +G++ +  + + G      G K R+W W      +P+V   PF+P+F+SLN+ +GIRI +Q  I+++F S+ +Q  IN+  + +   +V+
Sbjct:  151 KFYRTGQRFLITFPDGTAQIFYPSGNVAVVAIATNRK-DSVYIIQGDKDV---NADILAVFGSSGKATCYHPNGNVCL--NPVGGQYFDHTGMKLRRWRWKSTDLSEPYV---PFKPVFISLNQQVGIRICSQEQIYISFLSMGKQAKINIWTRHQTKTQVR 303          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Erich6b (glutamate rich 6B [Source:MGI Symbol;Acc:MGI:1922522])

HSP 1 Score: 101.293 bits (251), Expect = 8.200e-22
Identity = 63/172 (36.63%), Postives = 96/172 (55.81%), Query Frame = 1
Query: 1384 YPNGCLFMVIFPTGLASIYYPSGNLAISI-VREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQW-FWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFS-VSRQIHINVGVKSK-IPERVQRRMLAMVKLETD 1887
            Y +G  F V FP G   IYYPSGNLA+ I  + AE L  I V+ D V     +  I G+ + +G  +F    G I +    L G+   + G +++ W +W+   HVHAPPF  + L LN++I ++I +Q+ +   FF+   ++I +N+G K K I E V + ++  V LETD
Sbjct:  360 YHSGKSFHVFFPNGTGQIYYPSGNLALLISCKGAEKLTYI-VLEDSV-----RTKIRGLVTNSGHATFYKEDGGIWLSLSKLLGYYFPK-GKQQKAWNWWNLDLHVHAPPFMCITLKLNKYIHVQIRSQDKVIFCFFTPKQKRICLNMGTKFKHINETVHQALMERVVLETD 524          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Erich6 (glutamate rich 6 [Source:MGI Symbol;Acc:MGI:3588212])

HSP 1 Score: 82.0333 bits (201), Expect = 1.143e-15
Identity = 58/186 (31.18%), Postives = 94/186 (50.54%), Query Frame = 1
Query: 1423 GLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGK-PHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI--PERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHP 1968
            G   + YPSGNLAI I    +    IC+I +D       NP IL +  ++G  S  H +G++ +  + L G    + G++ R W W    P      F+P+FL+LNR+IGIRI  Q+ + +NF ++ +Q  I++G K  +  PE V     A+  L  D ++  L+A   ++  +  K    +  P
Sbjct:  493 GTILLTYPSGNLAI-IRLPNKTDGFICIIQEDTPT----NPTILALFDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRTWNWSSTMPSSSFVSFKPVFLALNRYIGIRILEQDKVSINFLAMGQQATISLGTKVMLHDPEEVP----ALWFLSGDDLL--LLANLIKIRRLFNKLEGCMNFP 667          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|Q5XI56|ERIP6_RAT (Glutamate-rich protein 6 OS=Rattus norvegicus OX=10116 GN=Erich6 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.578e-24
Identity = 104/391 (26.60%), Postives = 172/391 (43.99%), Query Frame = 1
Query:  820 CCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDG-KPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI--PERVQR-RMLA----MVKLETDKIMKPLIAIKARVNGIIEKCHEALGHP 1968
            CC +F++L+D+    R      LT  S +  LI ISPH +H +             K +EK ++R+    +A            R ++ +P       EE+             T+ L+ I+YQLS     +         +  EE+ ++      I N+  T    D +   G      L+    + Y +G  F+  FP G   I+YPSGNLAI  V    +   IC+I +D +   +   IL +  ++G  S  H +G++ +  + L G    + G++ R W W   KP      F+P+ L+LNR+IGIRI  Q+ + ++F ++ +Q  I +G K  +  PE V   R L+    ++     KI +    ++  VN  + K  E L  P
Sbjct:  240 CCLQFQNLLDYITEER------LTTKSPEMELISISPHAAHGSDA--------DRLKAKEKAMQRKQERQMA------------RHFTIIPEQSPVGTEED-------------TKHLKTISYQLSGDYLQN---------VRTEEVDLQ------ITNISITCC--DSWKICGKVMGNELL---EKDYKHGSKFLTSFPDGTIQIFYPSGNLAIIRVPNKTD-GFICIIQEDTA---TSPAILALFDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRTWNWSSTKPTPAFVSFKPVLLALNRYIGIRILEQDKVSIHFLAMGQQATICLGTKVVLQDPEEVPTLRFLSGDDLLLLASLIKIRRLFSKMEGCVNFPVSKAWERLKQP 567          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|Q7L0X2|ERIP6_HUMAN (Glutamate-rich protein 6 OS=Homo sapiens OX=9606 GN=ERICH6 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.877e-24
Identity = 107/399 (26.82%), Postives = 175/399 (43.86%), Query Frame = 1
Query:  793 SNVDQSK-----LFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVII-----NMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPF---QPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKC 1947
            SNVD S        CC  F++L+D+       E    TKP  K  LI I PH +H +             K +EK L+R+    +A   +                    +  E   FS   S      ++L+ I+YQLS                   +I  K+ + D++      N + + +  D     G   +  L+    ++Y +G  F+  FP G   I+YPSGNLAI  V    N    C++ +D+      NP IL +  ++G  S  H +G++ +  + L G    + G++ R W W     + + PF   +P+FL+LNR+IG+RI  Q+ I + F ++ +Q  I+VG K K+P   +  +L  V  +   ++  LI I+ R+   +E C
Sbjct:  283 SNVDVSSEPKGHASCCIAFQNLIDYIY-----EEQIKTKPP-KAELIAIDPHAAHGSEV--------DRLKAKEKALQRKQEQRMARHFA-------------------IISREQTHFSEDDS------KRLKTISYQLSV------------------DIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELL---EKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVN-GFTCIVQEDMPT----NPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNS--ITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIR-RLFHKLEGC 613          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|Q5W0A0|ERI6B_HUMAN (Glutamate-rich protein 6B OS=Homo sapiens OX=9606 GN=ERICH6B PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.284e-17
Identity = 48/155 (30.97%), Postives = 82/155 (52.90%), Query Frame = 1
Query: 1384 YPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSK--IPE 1842
            YPN  ++ ++FP G   I+YPSGNLA+ I+          ++ D +     +  I  + + +G  +F   + DI +   +  G+   +D  +K   +W+   HVHAPP QP+ L +N +I ++I +Q+ I   F    +QI +N+G + K  IPE
Sbjct:  480 YPNKNVYQILFPDGTGQIHYPSGNLAMLILYAKMKKFTYIILEDSL-----EGRIRALINNSGNATFYDENSDIWLNLSSNLGYYFPKDKRQKAWNWWNLNIHVHAPPVQPISLKINEYIQVQIRSQDKIIFCFTYEQKQICLNLGTRYKFVIPE 629          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|D3Z6S9|ERIP6_MOUSE (Glutamate-rich protein 6 OS=Mus musculus OX=10090 GN=Erich6 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.999e-15
Identity = 58/186 (31.18%), Postives = 94/186 (50.54%), Query Frame = 1
Query: 1423 GLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGK-PHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI--PERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHP 1968
            G   + YPSGNLAI I    +    IC+I +D       NP IL +  ++G  S  H +G++ +  + L G    + G++ R W W    P      F+P+FL+LNR+IGIRI  Q+ + +NF ++ +Q  I++G K  +  PE V     A+  L  D ++  L+A   ++  +  K    +  P
Sbjct:  493 GTILLTYPSGNLAI-IRLPNKTDGFICIIQEDTPT----NPTILALFDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRTWNWSSTMPSSSFVSFKPVFLALNRYIGIRILEQDKVSINFLAMGQQATISLGTKVMLHDPEEVP----ALWFLSGDDLL--LLANLIKIRRLFNKLEGCMNFP 667          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A267ETE8 (FAM194 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030731g3 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.001e-52
Identity = 151/506 (29.84%), Postives = 249/506 (49.21%), Query Frame = 1
Query:  403 QSSASSESLPVYPSRKIDDEFGIXXXXXXXXXXXXXXXXXXXTLINEDSNKKMPISNDEEIEN--------AIQKNIIFDAGLPTFLKASKELGNP--DIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIA------HRQNESNSLTKPSSKQNLIDISPH---KSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLP--MICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDG-------KPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI 1836
            +S A   ++P YP  ++DDEFG+ L    D +    +++   +L+N  S+K   +   +  E         A    ++   G P  L+  +E   P  +  P +S D   A +M  G  D C+FC +P+  +PS  +Q   + +Q  L+CC EFR L++FA+       H+Q ++ S         LID++PH    S         E+ + E + R KLL+++     A           R   S                      E+ M RQ+R INY LSS + +++GWT+R P+   + +S   E +    +MD    I D+   +G++ + +   +  ++YPNG  F+ +F     +++YPSG LAI I R A+  P  ++ ++ DD     ++  +LG+    G G+     G IRI YD  NG ++ + GSKKR W W          PH+HAPPFQP+ L+LN+ +G+R++A++ I+++F + SR   INVG + KI
Sbjct:  111 RSRAGGLTIPAYPEPRVDDEFGVLLVQDDDSDLSDTNVKGD-SLVNSGSSKNAGLETVDTAEAVGVADEEPAADNGLLPSVGPPQILQYLRESQIPVEEAFPGLSLD-LGAVSMREG--DSCDFCGRPIQALPSREDQASRSPEQ--LYCCAEFRKLLEFALQYQTRLLHQQQQTES--------GLIDVAPHPHFGSRGKKSAQERERMREEAEKRRKLLQQERQRRAAEAAQATAQARKREQVS---------------------VEADMGRQMRTINYSLSSMRCLEEGWTLRAPSPLGDGVS---EWQIYDFDMDE---ITDLAAGLGITPRGTPTDLLEKFYPNGKKFVTMFADRTGNVFYPSGRLAILISRPADR-PNNLLHIVLDDKPPGRAR--LLGVFDNIGRGTAYFRDGGIRINYDRFNGLDLDQQGSKKRHWHWHSTGQPAAQAPHIHAPPFQPISLALNKTVGLRLAARDSIYLSFVTASRSCKINVGARIKI 572          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A267F7T6 (FAM194 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030731g1 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.039e-52
Identity = 151/506 (29.84%), Postives = 249/506 (49.21%), Query Frame = 1
Query:  403 QSSASSESLPVYPSRKIDDEFGIXXXXXXXXXXXXXXXXXXXTLINEDSNKKMPISNDEEIEN--------AIQKNIIFDAGLPTFLKASKELGNP--DIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIA------HRQNESNSLTKPSSKQNLIDISPH---KSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLP--MICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDG-------KPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI 1836
            +S A   ++P YP  ++DDEFG+ L    D +    +++   +L+N  S+K   +   +  E         A    ++   G P  L+  +E   P  +  P +S D   A +M  G  D C+FC +P+  +PS  +Q   + +Q  L+CC EFR L++FA+       H+Q ++ S         LID++PH    S         E+ + E + R KLL+++     A           R   S                      E+ M RQ+R INY LSS + +++GWT+R P+   + +S   E +    +MD    I D+   +G++ + +   +  ++YPNG  F+ +F     +++YPSG LAI I R A+  P  ++ ++ DD     ++  +LG+    G G+     G IRI YD  NG ++ + GSKKR W W          PH+HAPPFQP+ L+LN+ +G+R++A++ I+++F + SR   INVG + KI
Sbjct:  111 RSRAGGLTIPAYPEPRVDDEFGVLLVQDDDSDLSDTNVKGD-SLVNSGSSKNAGLETVDTAEAVGVADEEPAADNGLLPSVGPPQILQYLRESQIPVEEAFPGLSLD-LGAVSMREG--DSCDFCGRPIQALPSREDQASRSPEQ--LYCCAEFRKLLEFALQYQTRLLHQQQQTES--------GLIDVAPHPHFGSRGKKSAQERERMREEAEKRRKLLQQERQRRAAEAAQATAQARKREQVS---------------------VEADMGRQMRTINYSLSSMRCLEEGWTLRAPSPLGDGVS---EWQIYDFDMDE---ITDLAAGLGITPRGTPTDLLEKFYPNGKKFVTMFADRTGNVFYPSGRLAILISRPADR-PNNLLHIVLDDKPPDRAR--LLGVFDNIGRGTAYFRDGGIRINYDRFNGLDLDQQGSKKRHWHWHSTGQPAAQAPHIHAPPFQPISLALNKTVGLRLAARDSIYLSFVTASRSCKINVGARIKI 572          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: V4BBD1 (FAM194 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229951 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.683e-48
Identity = 118/382 (30.89%), Postives = 203/382 (53.14%), Query Frame = 1
Query:  736 CEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLER--QNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFS---IRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIIN--MDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFW-DGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI--PERVQ 1851
            CEFC   + P P++ +Q +   +Q  L+CC ++R+ V FA +        + K    + LIDI PH    + +     K ++ +++R++ +E+  Q A  + +  +     G   + +E+   ++       F        S + ++ RQ++ INYQLSS K +++GWT R P    ++  M     DV I   +D+T         +  S +     + ++ Y NG  F++IFP G  S++YPSG LA+SI +  +    I V+HD+     S + I+G+   NG G   H +G++R+ +D L+G E+ + G+KK++W W D + HVHAPPFQP+ + LNR IG+R+ +Q  I V F + +R    NVG + ++  PE ++
Sbjct:  231 CEFCELDIKPFPTIEQQQELPPEQ--LYCCDQYREFVQFATSTAFELEEEMQK---TKKLIDIKPHGHFGSKKARKAAKERAVQRMRDREMEKRKQEATGMNSYFAGASPSGEFGSATEVGGGRAGAGRNQGFKGNGPAPLSYKDMVARQMKTINYQLSSQKCLEEGWTKRAPTPQEDDGDMI----DVFIPEPLDFT---------LANSAKIRERELIQKNYENGKKFLMIFPDGTGSVFYPSGYLAVSICK-MDAGQFIYVVHDN----SSDSRIMGVFEPNGHGCCYHNNGNVRLYFDQLDGIELDKYGAKKKKWSWKDQETHVHAPPFQPICVGLNRSIGLRVMSQEHITVTFMAKNRSCRFNVGARLRLMKPENIK 589          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A267F005 (FAM194 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030731g2 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.749e-47
Identity = 122/387 (31.52%), Postives = 198/387 (51.16%), Query Frame = 1
Query:  730 DVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIA------HRQNESNSLTKPSSKQNLIDIS--PH-KSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLP--MICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGK-------PHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI 1836
            D C+FC +P+  +PS  +Q   + +Q  L+CC EFR L++FA+       H+Q ++ S         LID++  PH  S         E+ + E + R KLL+++     A           R   S                      E+ M RQ+R INY LSS + +++GWT+R P+   + +S   E +    +MD    I D+   +G++ + +   +  ++YPNG  F+ +F     +++YPSG LAI I R A+  P  ++ ++ DD     ++  +LG+    G G+     G IRI YD  NG ++ + GSKKR W W          PH+HAPPFQP+ L+LN+ +G+R++A++ I+++F + SR   INVG + KI
Sbjct:    5 DSCDFCGRPIQALPSREDQASRSPEQ--LYCCAEFRKLLEFALQYQTRLLHQQQQTES--------GLIDVAPHPHFGSRGKKSAQERERMREEAEKRRKLLQQERQRRAAEAAQATAQARKREQVS---------------------VEADMGRQMRTINYSLSSMRCLEEGWTLRAPSPLGDGVS---EWQIYDFDMDE---ITDLAAGLGITPRGTPTDLLEKFYPNGKKFVTMFADRTGNVFYPSGRLAILISRPADR-PNNLLHIVLDDKPPGRAR--LLGVFDNIGRGTAYFRDGGIRINYDRFNGLDLDQQGSKKRHWHWHSTGQPAAQAPHIHAPPFQPISLALNKTVGLRLAARDSIYLSFVTASRSCKINVGARIKI 351          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A1S3JRJ2 (glutamate-rich protein 6-like OS=Lingula unguis OX=7574 GN=LOC106175238 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.123e-44
Identity = 126/419 (30.07%), Postives = 201/419 (47.97%), Query Frame = 1
Query:  733 VCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKD----VIINMDYTSLIPDIYGQIGLSDQCSLIGVS-RQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFW-DGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHP 1968
            VCEFC+K + P PS+ EQ     DQ  L+CC+E+R  V FA+       N +         IDI PH    + +     K ++  ++RE+ L R      A Q +                  +     + FF+          R ++ INYQLSS + +D+GWT+RPP+       + EE KD     + ++D+T     +  + GL  +    GV+  +YY +G LF+V+FP G   +YYPSGNLAI I           ++ D      ++ P +LG+   NG       +G +R+  D + G E+  +G+KK++W W D   HVHAPPFQP+  +LNR + +R   Q+ I + F S  +    NVG K K+   V    + + ++E +++   L   K +V  +++K    +  P
Sbjct:  334 VCEFCQKTIKPFPSMEEQQTKPPDQ--LYCCEEYRQFVHFALF------NPMETEHKVDEKIDIKPHGPFGSKQARRAAKERAVLRMRERELARAQQVAAAQQAA------------------AGGGGVSNFFTF--------ARAMKTINYQLSSQRCLDEGWTVRPPS------PLWEEAKDPDVFSVEDVDFT-----MNAKEGLGWELRKRGVTLEKYYEDGSLFLVLFPDGTGHVYYPSGNLAIGISSTTPGKFTYVILED-----AAEEPQVLGVFEPNGHAGCYFHNGKLRLCLDQMGGIELDINGAKKKKWNWKDVTTHVHAPPFQPICFALNRCLSLRFLDQDNISLLFQSHKQSCKFNVGAKLKL---VNPEYIPVKEIEENEVF--LSECKTKVEFLLDKVANLMKFP 697          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: ENSAMXT00000019601.2 (glutamate-rich protein 6-like [Source:NCBI gene;Acc:107197653])

HSP 1 Score: 100.138 bits (248), Expect = 9.209e-22
Identity = 78/290 (26.90%), Postives = 140/290 (48.28%), Query Frame = 1
Query:  985 RKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVE--EENEFFSIRQSTESVMTR----QLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKI 1836
            R + E   ER    L A  +S    E  +    E  S +S ++  E   F+   Q+  S+ T       + I++QLS C  +D+   +     + ++ S +EE  +V    D +   P  +G   L +    I   +++Y NG  F+  F  G A ++YPSGNLAI ++   +    +CV+ D+++   S  P+  +  ++G  +  H +G + +  D   G  +   G++ R+W W  +      P +P+FLSLN+ +G+R+  +  IFV+F ++ +Q   +VG   KI
Sbjct:  111 RFVLELCEERPRGTLTAGDLSIGFEEQLKLGAGEWDSEESRLQQMEMERFYREAQTRPSMSTDTSLFHTKTISFQLSGCDPVDERLNL-----AVKKESSEEEKPEVWEWNDPSGSEPAGFGLNHLQEGARFI---QKFYSNGNKFLTGFSDGSAQVFYPSGNLAIIVLTNKKE--RVCVVRDNIT---SHCPVRALFQSSGRATCYHGNGRVWLNMDLWGGQSLDEAGARTRKWSWSDRAQT-PTPLRPIFLSLNKSVGVRVLGRQYIFVSFLALGQQAKFSVGSCVKI 386          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO33633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRP5])

HSP 1 Score: 153.295 bits (386), Expect = 9.266e-39
Identity = 125/486 (25.72%), Postives = 220/486 (45.27%), Query Frame = 1
Query:  598 QKNIIFDAGLPTFLKASKE-----LGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNP-ILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFW-DGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERK 2034
            ++ +I   G P  L+  KE     L N ++        FL  ++  G    C FC++ ++P P++ E+I+S +   +LFCC ++   + F + HR +ES+       +  LIDI PH  + T       K ++  + RE+ +ERQ AA             P   Y+                         +TRQ++ INY L+S K M++GWT++P + +       E+   + +N             + +  +  L     ++Y +G  F+++ P G    YYPSGN+A+ ++   E      ++++D   F+ ++   L      G G+    +G +R++ D   G  +   G++K++W W + K HVHAPPFQP+  SL + + IR  +QN I + +         NVG K K    ++        ++ D+    L  +K  +N ++++   AL  PN    +K PL P  L K   R+
Sbjct:  357 EETLIPSIGPPAILQYIKESQHPPLTNEELEERDIGGEFLKKSVFSG---PCMFCKEEVLPFPTI-EEIES-LSPEQLFCCPQYERFIKFELTHRGDESHI------RDELIDIKPHPPYGTKAARRAAKERAAERAREREMERQKAA-----------GNPTNFYA-------------------------LTRQMKTINYSLASTKCMEEGWTVKPRSPTPSIDGQGEDQFVIEVN------------PLQMQKRAFL----ERFYEDGQRFLLVLPDGTGCCYYPSGNIAV-LITSTERGKFNYLVYEDSDEFDIQHTGTLASFDPTGHGTCYFRNGAVRLVVDPFGGVLLDSSGTRKKKWLWHNHKTHVHAPPFQPITFSLTKQLAIRCLSQNKIVITYTHGKHTAKFNVGSKLKAVRNLK------PPIDRDEHELHLAEVKQFINILLDRTQNALRLPNYPRLDKIPL-PQRLQKTMRRE 771          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000035155.1 (SMESG000035155.1)

HSP 1 Score: 1288.48 bits (3333), Expect = 0.000e+0
Identity = 655/662 (98.94%), Postives = 659/662 (99.55%), Query Frame = 1
Query:   73 MNELILTSIKEESAASYNINEFSPDNLTSPILPLQQVIEKAVQTDSDWLDQIKREIFDAITHETSIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKDDQALAEDYERENCQSSASSESLPVYPSRKIDDEFGIXXXXXXXXXXXXXXXXXXXTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 2058
            MNELILTSIKEESAASYNINEFSPDNLTSPIL LQQVIEKAVQTDSDWLDQIKREIFDAITHET+IKEQIPQKPKSKAGTIRSQMTKTSVIKSKAK DQALAEDYER+NC+SSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDL KLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMIC+IHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV
Sbjct:    1 MNELILTSIKEESAASYNINEFSPDNLTSPILSLQQVIEKAVQTDSDWLDQIKREIFDAITHETNIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKADQALAEDYERDNCESSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDLAKLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICIIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 662          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000035155.1 (SMESG000035155.1)

HSP 1 Score: 1249.19 bits (3231), Expect = 0.000e+0
Identity = 641/662 (96.83%), Postives = 645/662 (97.43%), Query Frame = 1
Query:   73 MNELILTSIKEESAASYNINEFSPDNLTSPILPLQQVIEKAVQTDSDWLDQIKREIFDAITHETSIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKDDQALAEDYERENCQSSASSESLPVYPSRKIDDEFGIXXXXXXXXXXXXXXXXXXXTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 2058
            MNELILTSIKEESAASYNINEFSPDNLTSPIL LQQVIEKAVQTDSDWLDQIKREIFDAITHET+IKEQIPQKPKSKAGTIRSQMTKTSVIKSKAK DQALAEDYER+NC+SSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDL KLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMK              KSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMIC+IHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV
Sbjct:    1 MNELILTSIKEESAASYNINEFSPDNLTSPILSLQQVIEKAVQTDSDWLDQIKREIFDAITHETNIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKADQALAEDYERDNCESSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDLAKLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMK-------------TKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICIIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 649          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000035155.1 (SMESG000035155.1)

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 635/662 (95.92%), Postives = 639/662 (96.53%), Query Frame = 1
Query:   73 MNELILTSIKEESAASYNINEFSPDNLTSPILPLQQVIEKAVQTDSDWLDQIKREIFDAITHETSIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKDDQALAEDYERENCQSSASSESLPVYPSRKIDDEFGIXXXXXXXXXXXXXXXXXXXTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTXXXXXXXXXXSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEENEFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 2058
            MNELILTSIKEESAASYNINEFSPDNLTSPIL LQQVIEKAVQTDSDWLDQIKREIFDAITHET+IKEQIPQKPKSKAGTIRSQMTKTSVIKSKAK DQALAEDYER+NC+SSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDL KLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPS                    VMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMIC+IHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV
Sbjct:    1 MNELILTSIKEESAASYNINEFSPDNLTSPILSLQQVIEKAVQTDSDWLDQIKREIFDAITHETNIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKADQALAEDYERDNCESSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDLAKLSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDIAPPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFCCQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEKAKSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPS--------------------VMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKEELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPTGLASIYYPSGNLAISIVREAENLPMICIIHDDVSIFESKNPILGIASTNGFGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLFLSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMVKLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKITERKNTLSLSMV 642          
The following BLAST results are available for this feature:
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ERICH66.595e-2526.82glutamate rich 6 [Source:HGNC Symbol;Acc:HGNC:2860... [more]
ERICH61.224e-2426.82glutamate rich 6 [Source:HGNC Symbol;Acc:HGNC:2860... [more]
ERICH6B8.921e-1830.97glutamate rich 6B [Source:HGNC Symbol;Acc:HGNC:265... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ntn33.997e-1827.40netrin 3 [Source:Xenbase;Acc:XB-GENE-960264][more]
ntn33.996e-1729.63netrin 3 [Source:Xenbase;Acc:XB-GENE-960264][more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Erich6b8.200e-2236.63glutamate rich 6B [Source:MGI Symbol;Acc:MGI:19225... [more]
Erich61.143e-1531.18glutamate rich 6 [Source:MGI Symbol;Acc:MGI:358821... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5XI56|ERIP6_RAT1.578e-2426.60Glutamate-rich protein 6 OS=Rattus norvegicus OX=1... [more]
sp|Q7L0X2|ERIP6_HUMAN5.877e-2426.82Glutamate-rich protein 6 OS=Homo sapiens OX=9606 G... [more]
sp|Q5W0A0|ERI6B_HUMAN4.284e-1730.97Glutamate-rich protein 6B OS=Homo sapiens OX=9606 ... [more]
sp|D3Z6S9|ERIP6_MOUSE7.999e-1531.18Glutamate-rich protein 6 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ETE81.001e-5229.84FAM194 domain-containing protein OS=Macrostomum li... [more]
A0A267F7T62.039e-5229.84FAM194 domain-containing protein OS=Macrostomum li... [more]
V4BBD16.683e-4830.89FAM194 domain-containing protein OS=Lottia gigante... [more]
A0A267F0054.749e-4731.52FAM194 domain-containing protein OS=Macrostomum li... [more]
A0A1S3JRJ21.123e-4430.07glutamate-rich protein 6-like OS=Lingula unguis OX... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000019601.29.209e-2226.90glutamate-rich protein 6-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO336339.266e-3925.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000035155.10.000e+098.94SMESG000035155.1[more]
SMESG000035155.10.000e+096.83SMESG000035155.1[more]
SMESG000035155.10.000e+095.92SMESG000035155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030526 ID=SMED30030526|Name=Neurogenic locus Notch protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2148bp
CTATATAAATCTTATATGTAATTTAAAAGAAAAGAAAATTAAAATTTATG
AATTATTTATTTAATATAATAAATGAATGAACTAATATTAACTTCAATAA
AAGAAGAATCGGCTGCTTCATACAATATAAATGAATTTTCTCCAGATAAT
TTAACAAGTCCAATTTTACCATTGCAACAAGTCATTGAAAAGGCAGTTCA
GACTGATTCTGATTGGCTGGATCAGATTAAAAGAGAAATTTTTGATGCAA
TAACACATGAAACAAGTATCAAAGAACAGATTCCACAAAAACCAAAATCA
AAAGCGGGAACGATACGATCGCAAATGACTAAGACTAGTGTTATTAAATC
AAAAGCGAAAGATGATCAAGCTTTAGCTGAGGATTATGAGAGGGAGAATT
GTCAGTCCAGTGCCAGTAGTGAATCGTTGCCGGTTTATCCCTCCAGGAAA
ATCGACGATGAATTCGGCATAGAATTGTACGACAGCTCGGATGATGAGGA
TGATTCTATTGATTTGGAAAAGTTGTCAACCTTGATAAATGAAGATTCGA
ATAAGAAAATGCCAATATCAAATGATGAAGAAATTGAGAATGCCATTCAG
AAAAACATCATTTTTGATGCGGGCTTGCCAACTTTTCTTAAGGCATCTAA
AGAGTTGGGTAACCCTGACATTGCTCCCCCGATGTCAGCTGACGCATTCT
TAGCCAGCGCCATGTTACCGGGACGCGAAGATGTTTGTGAATTTTGCAGG
AAACCTCTGATACCAATCCCTTCGGTGCATGAACAAATCGATTCTAATGT
GGACCAATCGAAATTGTTTTGCTGTCAAGAATTTCGAGATCTTGTAGATT
TTGCGATTGCCCATAGACAAAATGAGTCAAATTCACTGACAAAACCAAGC
TCAAAACAAAATTTGATTGATATTTCTCCTCACAAAAGTCATAAAACTCT
CGAGGAGCTCGCTGAAGAAAAAGCCAAATCGGAAAGAAAAATTCGAGAGA
AATTGCTTGAACGCCAAAATGCCGCTCTGTTGGCTGCTCAGATGTCTAGA
ATGAAAATTGAAGGACCCCGAAGAGCTTATTCCGAAATGCCATCTGCTAA
ATCAACCGTTGAAGAGGAAAATGAATTTTTTTCCATTAGACAGTCCACAG
AATCAGTAATGACTAGACAACTGCGAGTTATAAATTATCAACTCTCCAGC
TGTAAATTTATGGACGACGGTTGGACAATTCGGCCCCCAGCAATTTCCAA
TGAGGAGATATCAATGAAGGAGGAATTGAAAGATGTTATCATCAACATGG
ATTATACTTCTTTAATTCCAGATATTTACGGACAGATTGGGTTGTCTGAT
CAGTGTTCACTAATTGGTGTCAGTCGTCAGTATTATCCAAATGGATGTCT
TTTCATGGTCATTTTCCCAACTGGTTTAGCTAGTATTTATTATCCATCGG
GGAATCTGGCAATTTCGATAGTGAGAGAAGCAGAAAATTTGCCCATGATT
TGCGTAATTCATGATGATGTCTCCATTTTTGAGAGTAAAAATCCGATTTT
GGGTATAGCAAGTACAAATGGGTTTGGTTCATTTTCTCATACTTCGGGAG
ATATTAGAATTTTATATGACACCTTAAATGGATTTGAAATTCATCGGGAT
GGATCGAAGAAACGTCAGTGGTTTTGGGATGGGAAACCGCATGTCCATGC
TCCTCCATTTCAACCATTGTTCCTTTCACTAAATAGGTTTATTGGCATTC
GTATTTCTGCTCAGAATGGAATTTTTGTCAATTTTTTCAGTGTCAGTCGA
CAAATTCACATCAATGTCGGAGTGAAATCTAAAATTCCAGAACGAGTGCA
GAGAAGAATGCTTGCAATGGTAAAGCTAGAAACTGATAAAATCATGAAAC
CTTTAATTGCAATCAAAGCCAGAGTGAACGGTATTATTGAAAAATGCCAC
GAAGCCTTGGGTCACCCAAATTTGTTATTGGAAAATAAATGGCCACTCAA
ACCTTACGCGTTGGCCAAAATTACCGAAAGGAAAAATACTTTAAGTCTTT
CTATGGTTTAGCACTGGATCGTTTTGATTCATTTTGACTTCTGATTTCAA
GGATTTTTCGTGTATTATTTTTGACCGGCCTGCTGAAAATATATGTTA
back to top

protein sequence of SMED30030526-orf-1

>SMED30030526-orf-1 ID=SMED30030526-orf-1|Name=SMED30030526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MNELILTSIKEESAASYNINEFSPDNLTSPILPLQQVIEKAVQTDSDWLD
QIKREIFDAITHETSIKEQIPQKPKSKAGTIRSQMTKTSVIKSKAKDDQA
LAEDYERENCQSSASSESLPVYPSRKIDDEFGIELYDSSDDEDDSIDLEK
LSTLINEDSNKKMPISNDEEIENAIQKNIIFDAGLPTFLKASKELGNPDI
APPMSADAFLASAMLPGREDVCEFCRKPLIPIPSVHEQIDSNVDQSKLFC
CQEFRDLVDFAIAHRQNESNSLTKPSSKQNLIDISPHKSHKTLEELAEEK
AKSERKIREKLLERQNAALLAAQMSRMKIEGPRRAYSEMPSAKSTVEEEN
EFFSIRQSTESVMTRQLRVINYQLSSCKFMDDGWTIRPPAISNEEISMKE
ELKDVIINMDYTSLIPDIYGQIGLSDQCSLIGVSRQYYPNGCLFMVIFPT
GLASIYYPSGNLAISIVREAENLPMICVIHDDVSIFESKNPILGIASTNG
FGSFSHTSGDIRILYDTLNGFEIHRDGSKKRQWFWDGKPHVHAPPFQPLF
LSLNRFIGIRISAQNGIFVNFFSVSRQIHINVGVKSKIPERVQRRMLAMV
KLETDKIMKPLIAIKARVNGIIEKCHEALGHPNLLLENKWPLKPYALAKI
TERKNTLSLSMV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029281FAM194_C
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 293..313
NoneNo IPR availablePANTHERPTHR23093:SF18coord: 362..655
coord: 23..318
NoneNo IPR availablePANTHERPTHR23093FAMILY NOT NAMEDcoord: 362..655
NoneNo IPR availablePANTHERPTHR23093FAMILY NOT NAMEDcoord: 23..318
IPR029281FAM194, C-terminalPFAMPF14977FAM194coord: 435..632
e-value: 1.7E-40
score: 138.5