Guanine nucleotide-binding protein 3 protein

Overview
NameGuanine nucleotide-binding protein 3 protein
Smed IDSMED30030518
Length (bp)1447
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein 3 protein (SMED30030518) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein 3 protein (SMED30030518) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein 3 protein (SMED30030518) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein 3 protein (SMED30030518) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030518

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030518h1SMcG0014296 Contig2477GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030518h1SMcG0014788 Contig2477GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030518h1SMcG0014788 dd_Smed_v4_676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Match: GNL3L (G protein nucleolar 3 like [Source:HGNC Symbol;Acc:HGNC:25553])

HSP 1 Score: 205.682 bits (522), Expect = 5.214e-59
Identity = 129/359 (35.93%), Postives = 199/359 (55.43%), Query Frame = 2
Query:  203 ECPFKDQVIKEV--TQSSLMEKDAEKKRLL---AMRILRKSKPVDKHEE------MKAKMIKDSSR-AFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTC----ASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            E   K + ++E+   Q +  E++ +K+R +      +LR+ +  +  EE      M  ++  +++R A+  + RK++E SDVI  VLDARDP+G R  + E+ +  A  NK ++ VLNKIDLVP++ ++ W+  L  E  T+AFKA+ Q Q   L     S P ++ + +     A +G +NL+  +   N    G   T     + VG+ G+PN GKSS+INS+KR R C  G + G+T+ +Q V LD  I L+D+PGI+    N      LRNC+ V+K+ DPV   E I  RC   ++   Y +  F T   F+ A A R+   KKGG+ + + AA  ++ DW SGKIS+   PPA
Sbjct:   56 EAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQHQVKNLNRC--SVPVDQASESLLKSKACFGAENLMRVLG--NYCRLGEVRTH----IRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIRLLDAPGIVPG-PNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGVSGFQTTEHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPA 405          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Match: GNL3L (G protein nucleolar 3 like [Source:HGNC Symbol;Acc:HGNC:25553])

HSP 1 Score: 205.682 bits (522), Expect = 5.214e-59
Identity = 129/359 (35.93%), Postives = 199/359 (55.43%), Query Frame = 2
Query:  203 ECPFKDQVIKEV--TQSSLMEKDAEKKRLL---AMRILRKSKPVDKHEE------MKAKMIKDSSR-AFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTC----ASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            E   K + ++E+   Q +  E++ +K+R +      +LR+ +  +  EE      M  ++  +++R A+  + RK++E SDVI  VLDARDP+G R  + E+ +  A  NK ++ VLNKIDLVP++ ++ W+  L  E  T+AFKA+ Q Q   L     S P ++ + +     A +G +NL+  +   N    G   T     + VG+ G+PN GKSS+INS+KR R C  G + G+T+ +Q V LD  I L+D+PGI+    N      LRNC+ V+K+ DPV   E I  RC   ++   Y +  F T   F+ A A R+   KKGG+ + + AA  ++ DW SGKIS+   PPA
Sbjct:   56 EAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQHQVKNLNRC--SVPVDQASESLLKSKACFGAENLMRVLG--NYCRLGEVRTH----IRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIRLLDAPGIVPG-PNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGVSGFQTTEHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPA 405          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Match: GNL3 (G protein nucleolar 3 [Source:HGNC Symbol;Acc:HGNC:29931])

HSP 1 Score: 202.601 bits (514), Expect = 3.547e-58
Identity = 144/462 (31.17%), Postives = 240/462 (51.95%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEV------------TQSSLMEKDAEKKRLLAMRILRKSKPVDKHE--------EMKAKMIKDSSRA-FIGDIRKLIEESDVICMVLDARDPMGTRSLE-SEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQ-----ALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIA-----GDSIDVELDESITLQPTDGVN--SISVLSGTNVMRTIV 1342
            L K +KR + H++YK+ KKV++HHR ++K  K +  KKP      +P   PFK+ +++E              Q    +K+ EKKR L      K   V+  E        E KAK  K +S+  +  +++K+IE SDV+  VLDARDP+G R  +  E ++++  K ++ +LNK DLVP++NL++W+  L KE  T+ F+A+ + +       R+ +   + P   ++  C  +G + L   +    +    A        + VG+ G PN GKSS+INS+K++++C  G   GLTR++Q V LD  I +IDSP  I++  N  +  ALR+   +E ++ P+  A AI ++    Q+ + Y +P +    EF    A R    +KGG+PN++ AA  L  +W    ++Y   PP          +SI V++     L+  +  N  SI  + G ++  +I+
Sbjct:    6 LKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDP-GVPNSAPFKEALLREAELRKQRLEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPF--RSEVC--FGKEGLWKLLGGFQETCSKA--------IRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVK-PMEAASAILSQADARQVVLKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGFNLEELEKNNAQSIRAIKGPHLANSIL 453          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Match: GNL3 (G protein nucleolar 3 [Source:HGNC Symbol;Acc:HGNC:29931])

HSP 1 Score: 196.823 bits (499), Expect = 4.114e-56
Identity = 140/454 (30.84%), Postives = 235/454 (51.76%), Query Frame = 2
Query:   83 SLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEV------------TQSSLMEKDAEKKRLLAMRILRKSKPVDKHE--------EMKAKMIKDSSRA-FIGDIRKLIEESDVICMVLDARDPMGTRSLE-SEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQ-----ALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIA-----GDSIDVELDESITLQPTDGVN--SISVLSGTNVMRTIV 1342
            + H++YK+ KKV++HHR ++K  K +  KKP      +P   PFK+ +++E              Q    +K+ EKKR L      K   V+  E        E KAK  K +S+  +  +++K+IE SDV+  VLDARDP+G R  +  E ++++  K ++ +LNK DLVP++NL++W+  L KE  T+ F+A+ + +       R+ +   + P   ++  C  +G + L   +    +    A        + VG+ G PN GKSS+INS+K++++C  G   GLTR++Q V LD  I +IDSP  I++  N  +  ALR+   +E ++ P+  A AI ++    Q+ + Y +P +    EF    A R    +KGG+PN++ AA  L  +W    ++Y   PP          +SI V++     L+  +  N  SI  + G ++  +I+
Sbjct:    2 TCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDP-GVPNSAPFKEALLREAELRKQRLEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPF--RSEVC--FGKEGLWKLLGGFQETCSKA--------IRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVK-PMEAASAILSQADARQVVLKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGFNLEELEKNNAQSIRAIKGPHLANSIL 441          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Match: GNL2 (G protein nucleolar 2 [Source:HGNC Symbol;Acc:HGNC:29925])

HSP 1 Score: 167.933 bits (424), Expect = 1.888e-44
Identity = 98/294 (33.33%), Postives = 146/294 (49.66%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            K  S+   G++ K+I+ SDV+  VLDARDPMGTRS   E  +K     K +IFVLNK DLVP    K W+A LS++  T+AF A                      S    +G    I  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    +AG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI+ P     A+  R +   +   YK+  ++   +F+   A R   L KGG P+L+     ++ DW  G+I +  +PP
Sbjct:  200 KGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIETYLKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHA----------------------SLTNPFGKGAFIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAEDFLEKLAFRTGKLLKGGEPDLQTVGKMVLNDWQRGRIPFFVKPP 463          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Match: nst-1 (Guanine nucleotide-binding protein-like 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21086])

HSP 1 Score: 258.84 bits (660), Expect = 7.512e-80
Identity = 152/428 (35.51%), Postives = 237/428 (55.37%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSS---LMEKDAEKKRLLAMRI-LRKSKPVDKHEEMKAKMIKDSS-----------------------RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN--DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP-AGIAGDSIDV 1252
            L K +KR S  ++YK+ KKV+ H+R VKK  K   +      ++ +P  CPFK++++ +  Q      + ++A K+     RI  RK+      E M AK  K  +                       +A+  ++RK +E +DVI  VLDARDP+G+RS   E  +    K ++ +LNKIDLVPR+N++ W+  L  +  TIAFKA+ Q+Q   +G  N +  +N + S C   G D ++  + +  +N       +      VG+ G PN GKSSVINS+KR++ C  GNL G+T+ +Q V LD +I LIDSPG+IL      DP E AL+N +RV+ + DP+A   AI  RC +  + + Y L +F+++ +F+   A R+  L++G  P++  AA +++ DWN+GK+ Y + PP  G A + I V
Sbjct:    6 LKKTSKRVSCAKRYKIEKKVRDHNRKVKKEAKKNGTTNKKEKTISVPNSCPFKEEILVQAEQEREKIKVRQEAAKEAAKIHRIEKRKNNLPANFESMVAKASKQGTEFDKKVASAAEHEKFNTLDDKTIKAYASEVRKTVEIADVIIQVLDARDPLGSRSKSVEDQVLKGGKRLVLLLNKIDLVPRENVQKWLEYLRGQFPTIAFKASTQEQKSNIGRFNSAILNNTETSKCV--GADIVMKILANYCRNKDIKTSIR------VGVVGFPNVGKSSVINSLKRRKACNVGNLPGITKEIQEVELDKNIRLIDSPGVILVSQKDLDPIEVALKNAIRVDNLLDPIAPVHAILRRCSKETIMLHYNLADFNSVDQFLAQLARRIGKLRRGARPDVNAAAKRVLNDWNTGKLRYYTHPPEQGTAKEDIVV 425          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Match: nst-1 (Guanine nucleotide-binding protein-like 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21086])

HSP 1 Score: 258.84 bits (660), Expect = 7.512e-80
Identity = 152/428 (35.51%), Postives = 237/428 (55.37%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSS---LMEKDAEKKRLLAMRI-LRKSKPVDKHEEMKAKMIKDSS-----------------------RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN--DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP-AGIAGDSIDV 1252
            L K +KR S  ++YK+ KKV+ H+R VKK  K   +      ++ +P  CPFK++++ +  Q      + ++A K+     RI  RK+      E M AK  K  +                       +A+  ++RK +E +DVI  VLDARDP+G+RS   E  +    K ++ +LNKIDLVPR+N++ W+  L  +  TIAFKA+ Q+Q   +G  N +  +N + S C   G D ++  + +  +N       +      VG+ G PN GKSSVINS+KR++ C  GNL G+T+ +Q V LD +I LIDSPG+IL      DP E AL+N +RV+ + DP+A   AI  RC +  + + Y L +F+++ +F+   A R+  L++G  P++  AA +++ DWN+GK+ Y + PP  G A + I V
Sbjct:    6 LKKTSKRVSCAKRYKIEKKVRDHNRKVKKEAKKNGTTNKKEKTISVPNSCPFKEEILVQAEQEREKIKVRQEAAKEAAKIHRIEKRKNNLPANFESMVAKASKQGTEFDKKVASAAEHEKFNTLDDKTIKAYASEVRKTVEIADVIIQVLDARDPLGSRSKSVEDQVLKGGKRLVLLLNKIDLVPRENVQKWLEYLRGQFPTIAFKASTQEQKSNIGRFNSAILNNTETSKCV--GADIVMKILANYCRNKDIKTSIR------VGVVGFPNVGKSSVINSLKRRKACNVGNLPGITKEIQEVELDKNIRLIDSPGVILVSQKDLDPIEVALKNAIRVDNLLDPIAPVHAILRRCSKETIMLHYNLADFNSVDQFLAQLARRIGKLRRGARPDVNAAAKRVLNDWNTGKLRYYTHPPEQGTAKEDIVV 425          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Match: ngp-1 (Nucleolar GTP-binding protein 2 [Source:UniProtKB/TrEMBL;Acc:Q9XXN4])

HSP 1 Score: 162.925 bits (411), Expect = 1.009e-43
Identity = 105/338 (31.07%), Postives = 178/338 (52.66%), Query Frame = 2
Query:  233 EVTQSSL--MEKDAEKKRLL---AMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            ++T++SL  M K AE + +     + + R+ +  D+ E M        S    G++ K+I+ SDV+  V+DARDPMGTR    E+ ++    +K ++ V+NK+DLVP    + WI  LSKE  TIAF A++ +                      S+G   +IN ++   K  P         ++ VG  G PN GKSS++N++++K++C+   +AG T+  Q+V L   I LIDSPG++  Q +   +  L+  +RVE ++DP    + + +RC+   L+  Y +PEF  + +F+   A +   L KGG P++   +  ++ ++  GK+ Y   PP 
Sbjct:  111 KLTEASLEEMSKSAEDRDVKYKPELDLSREKELGDRPENMNPLFRAGQSNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKEKPHKHLVTVINKVDLVPTWVTRKWIGELSKEMPTIAFHASINN----------------------SFGKGAVINLLRQFAKLHP------DRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDFLTKIAIKQGRLLKGGDPDIVAVSKVVLNEFQRGKLPYFVPPPG 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Match: ngp-1 (Nucleolar GTP-binding protein 2 [Source:UniProtKB/TrEMBL;Acc:Q9XXN4])

HSP 1 Score: 162.925 bits (411), Expect = 1.009e-43
Identity = 105/338 (31.07%), Postives = 178/338 (52.66%), Query Frame = 2
Query:  233 EVTQSSL--MEKDAEKKRLL---AMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            ++T++SL  M K AE + +     + + R+ +  D+ E M        S    G++ K+I+ SDV+  V+DARDPMGTR    E+ ++    +K ++ V+NK+DLVP    + WI  LSKE  TIAF A++ +                      S+G   +IN ++   K  P         ++ VG  G PN GKSS++N++++K++C+   +AG T+  Q+V L   I LIDSPG++  Q +   +  L+  +RVE ++DP    + + +RC+   L+  Y +PEF  + +F+   A +   L KGG P++   +  ++ ++  GK+ Y   PP 
Sbjct:  111 KLTEASLEEMSKSAEDRDVKYKPELDLSREKELGDRPENMNPLFRAGQSNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKEKPHKHLVTVINKVDLVPTWVTRKWIGELSKEMPTIAFHASINN----------------------SFGKGAVINLLRQFAKLHP------DRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDFLTKIAIKQGRLLKGGDPDIVAVSKVVLNEFQRGKLPYFVPPPG 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Match: ngp-1 (Nucleolar GTP-binding protein 2 [Source:UniProtKB/TrEMBL;Acc:Q9XXN4])

HSP 1 Score: 162.925 bits (411), Expect = 1.009e-43
Identity = 105/338 (31.07%), Postives = 178/338 (52.66%), Query Frame = 2
Query:  233 EVTQSSL--MEKDAEKKRLL---AMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            ++T++SL  M K AE + +     + + R+ +  D+ E M        S    G++ K+I+ SDV+  V+DARDPMGTR    E+ ++    +K ++ V+NK+DLVP    + WI  LSKE  TIAF A++ +                      S+G   +IN ++   K  P         ++ VG  G PN GKSS++N++++K++C+   +AG T+  Q+V L   I LIDSPG++  Q +   +  L+  +RVE ++DP    + + +RC+   L+  Y +PEF  + +F+   A +   L KGG P++   +  ++ ++  GK+ Y   PP 
Sbjct:  111 KLTEASLEEMSKSAEDRDVKYKPELDLSREKELGDRPENMNPLFRAGQSNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKEKPHKHLVTVINKVDLVPTWVTRKWIGELSKEMPTIAFHASINN----------------------SFGKGAVINLLRQFAKLHP------DRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDFLTKIAIKQGRLLKGGDPDIVAVSKVVLNEFQRGKLPYFVPPPG 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Match: Ns1 (gene:FBgn0038473 transcript:FBtr0083426)

HSP 1 Score: 245.358 bits (625), Expect = 2.631e-74
Identity = 152/431 (35.27%), Postives = 233/431 (54.06%), Query Frame = 2
Query:   62 SKRNKRTSLHQKYKVAKKVKQHHR-DVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVT---QSSLMEKDAEKKRLLAMRILRKSKPVDK---------------HE---------EMKAKMIKDSS-RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEK---NSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDV 1252
            +K++KR +   K+K+ KKV+ H++ + + + KN K        +QIP  CPFKD ++KEV    Q    E+ A ++   A R   K K ++                HE         + K  + K+ S + +  + RK+IE +DV+  V+DARDP+GTR  E E+ ++ A  NK ++ VLNK DLVPR+NL  WI    +     AFKA+ QDQA RLG         EK    S C   G + L++ + +  +N     G K++  + VG+ G+PN GKSS+INS+ R R C  G+  G+T+++Q V LD+ I LID PGI+     + +   L+N  RV  ++DP  +AE++  R  +     +Y +  +DT  EF    A+RM    K GVP++  AA  ++ DWN+GKI YC++PP    G S+ +
Sbjct:    8 TKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKQKLIQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESMVEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVC--IGAELLMSMLGNYCRNK----GIKTS--IRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAAARSVLNDWNTGKIKYCTQPPEVQEGQSVHI 430          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Match: Ns2 (gene:FBgn0034243 transcript:FBtr0086906)

HSP 1 Score: 169.088 bits (427), Expect = 2.087e-45
Identity = 98/295 (33.22%), Postives = 153/295 (51.86%), Query Frame = 2
Query:  362 SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIA 1234
            S+    ++ K+++ SDV+  VLDARDPMGTRS   E+ ++    +K + F+LNK+DLVP    + W+A LS E  TIAF A++Q                        +G   LIN  + L        G    DK  + VG  G PN GKSSVIN+++ K++C+   +AG T+  Q++ L   I LID PG++   +    E  L+  +RVE + +P    +++  R +   +   YK+  ++T T F+   A +   L KGG P++ + A  ++ DW  GK+ +   PP G A
Sbjct:  208 SKRIWNELHKVVDASDVLLQVLDARDPMGTRSKYIEEFLRKEKPHKHLFFILNKVDLVPVWVTQRWVAILSAEYPTIAFHASLQ----------------------HPFGKGALINLFRQL--------GKLHLDKKQISVGFIGYPNVGKSSVINALRSKKVCKVAPIAGETKVWQYITLMKRIFLIDCPGVVYPTAETDTEKVLKGVVRVELVTNPEDYVDSLLKRVRPEYISKNYKIEHWNTSTHFLEQLAQKTGKLLKGGEPDVTVTARMVLNDWQRGKLPFYV-PPEGFA 471          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Match: Ns3 (gene:FBgn0266284 transcript:FBtr0339578)

HSP 1 Score: 78.5666 bits (192), Expect = 4.197e-15
Identity = 81/349 (23.21%), Postives = 145/349 (41.55%), Query Frame = 2
Query:  371 FIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEA-RTIAFKANV-----------------QDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIK--------SLNKNTPGAAGTKSADKLI------------------------VGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN-DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQ-----VLYKLPEFDTI------TEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            F   + +++E SDV+  ++DAR+P+  RS + E+ +K    +K  + ++NK DL+  +  + W      E  RT  + A +                 + Q LR       R   E   +  S  V++ +N I+        + N   P   G K++ +L+                        VG+ G PN GKSS INS+   +        G T+  Q + LD  I+L D PG+++       A+  L   L ++++ D V     +  R  R  L+     V+ K  E + +       E ++A+      +   G P+   +A  ++KD+ +G++ Y   PP+
Sbjct:  164 FWRQLWRVVERSDVVVQIVDARNPLLFRSADLERYVKEVEPSKMNMILVNKSDLLTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEECLDSFPEVQQLR-------RAVEEIKQSLDS--VEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIYTGPRHTEQHVTVGMVGYPNVGKSSTINSLMTVKKVSVSATPGKTKRFQTLFLDKDILLCDCPGLVMPSFVLTKADMLLNGILPIDQMRDHVPAVNLLCERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARYVLKDYVNGRLLYAMSPPS 503          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Match: Ns3 (gene:FBgn0266284 transcript:FBtr0070297)

HSP 1 Score: 78.5666 bits (192), Expect = 4.197e-15
Identity = 81/349 (23.21%), Postives = 145/349 (41.55%), Query Frame = 2
Query:  371 FIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEA-RTIAFKANV-----------------QDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIK--------SLNKNTPGAAGTKSADKLI------------------------VGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN-DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQ-----VLYKLPEFDTI------TEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            F   + +++E SDV+  ++DAR+P+  RS + E+ +K    +K  + ++NK DL+  +  + W      E  RT  + A +                 + Q LR       R   E   +  S  V++ +N I+        + N   P   G K++ +L+                        VG+ G PN GKSS INS+   +        G T+  Q + LD  I+L D PG+++       A+  L   L ++++ D V     +  R  R  L+     V+ K  E + +       E ++A+      +   G P+   +A  ++KD+ +G++ Y   PP+
Sbjct:  164 FWRQLWRVVERSDVVVQIVDARNPLLFRSADLERYVKEVEPSKMNMILVNKSDLLTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEECLDSFPEVQQLR-------RAVEEIKQSLDS--VEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIYTGPRHTEQHVTVGMVGYPNVGKSSTINSLMTVKKVSVSATPGKTKRFQTLFLDKDILLCDCPGLVMPSFVLTKADMLLNGILPIDQMRDHVPAVNLLCERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARYVLKDYVNGRLLYAMSPPS 503          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Match: CG17141 (gene:FBgn0039020 transcript:FBtr0084322)

HSP 1 Score: 53.1434 bits (126), Expect = 2.625e-7
Identity = 81/311 (26.05%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  383 IRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN-KTIIFVLNKIDLVPRDNLKAWIACLSK---EARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVIN-----SIKRKRICEAGNLAGLTRNLQH---VALDNHIVLIDSPGIILAQSNDP---AEYALRNCLRVEKIEDPVAVAEAIY--NRCQRIQLQVLYKLPE--FDTITEFMVAFASRMCPLKK-----GGV---PNLKLAAIKLIKDWNSGKISYCS-EPPAGI 1231
            I++ +   D I  + DAR P+  R+ +    I  +  K  I VLNK+DL+     K+ +  L +   E + I F  N +DQ               +N+     GV +++     L   +     T++A+  ++ I GVPN GKSSVIN      +K+K     G  AG+TR++     +  +  + +ID+PGI+     D     + AL  CL    + + +     +Y  N  ++     + KL     D I+  +  +A R     K     G V    NL  AA K I  + SG++ + + + P+G 
Sbjct:   34 IQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLRRQQPELQHILF-TNCKDQ---------------RNN-----GVLDILPLATRLVSESSRFNRTQAAEHNLM-IIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGPSDDISAVLAEYAHREELFHKVKQYDGRVEVMTNLLAAARKFIHFFRSGQLGHMNLDEPSGF 322          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Match: gnl3l (guanine nucleotide binding protein-like 3 (nucleolar)-like [Source:ZFIN;Acc:ZDB-GENE-040723-1])

HSP 1 Score: 225.713 bits (574), Expect = 7.185e-67
Identity = 120/294 (40.82%), Postives = 176/294 (59.86%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            ++S +A+  + +K+IE +DVI  VLDARDP+G R  + E+ +     NK I+ VLNKIDLV +D ++ WI  L  E  T+AFK++ Q Q   L  S    ++ + E   + A  G D L+  + +  +N       K+A  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DP+   EAI  RC ++Q+   Y +P+F T  EF+   A R   L+KGG+P+   AA  ++ DW  G+ISY + PP
Sbjct:  112 ENSRKAYCREFKKVIEAADVILEVLDARDPLGCRCPQVEQAVVQSGTNKKIVLVLNKIDLVSKDIVEKWIKYLRNEFPTVAFKSSTQQQNKNLKRSRVPVTQATQELLESSACVGADCLMKLLGNYCRNQ----DIKTA--ITVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAMILRNCVKIEQLVDPLPAVEAILRRCNKMQIIDHYGIPDFQTAHEFLALLARRQGKLRKGGLPDSDKAAKSVLMDWTGGRISYFTHPP 399          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Match: gnl3l (guanine nucleotide binding protein-like 3 (nucleolar)-like [Source:ZFIN;Acc:ZDB-GENE-040723-1])

HSP 1 Score: 225.713 bits (574), Expect = 7.724e-67
Identity = 120/294 (40.82%), Postives = 176/294 (59.86%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            ++S +A+  + +K+IE +DVI  VLDARDP+G R  + E+ +     NK I+ VLNKIDLV +D ++ WI  L  E  T+AFK++ Q Q   L  S    ++ + E   + A  G D L+  + +  +N       K+A  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DP+   EAI  RC ++Q+   Y +P+F T  EF+   A R   L+KGG+P+   AA  ++ DW  G+ISY + PP
Sbjct:  109 ENSRKAYCREFKKVIEAADVILEVLDARDPLGCRCPQVEQAVVQSGTNKKIVLVLNKIDLVSKDIVEKWIKYLRNEFPTVAFKSSTQQQNKNLKRSRVPVTQATQELLESSACVGADCLMKLLGNYCRNQ----DIKTA--ITVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAMILRNCVKIEQLVDPLPAVEAILRRCNKMQIIDHYGIPDFQTAHEFLALLARRQGKLRKGGLPDSDKAAKSVLMDWTGGRISYFTHPP 396          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Match: gnl3 (guanine nucleotide binding protein-like 3 (nucleolar) [Source:NCBI gene;Acc:321897])

HSP 1 Score: 207.223 bits (526), Expect = 4.663e-60
Identity = 139/438 (31.74%), Postives = 224/438 (51.14%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQ-SSLMEKDAEKKRLLAMRILRKSKPVDKHEE-------------------MKAKMIK-DSSRAF-IGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSN---EKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA-----GIAGDSIDVELDESITL 1276
            L K +KR S  ++YK+ KKV++H+R +KK+ K +   +     + +P   PFK++V++E  Q    +E   E+ +++  +     +  +K                       +A ++K  S++ F   ++ K+IE SDVI  VLDARDP+G R  + E+++      K ++F+LNKIDLVP+DNL+ W+  L  E  T  FK+++Q +   +      R +N   + +   + +G D L+  +  L     G    K      VG+ G PN GKSS+INS+K  R C AG   GLTR +Q V +   + +IDSPGI+ A SN  +  ALR+    EK E P      +  +C +  + + Y +P++ +  EF+  FA +   L+KGGV + +LAA   + DW   K+SY S  P          D+I  EL   + +
Sbjct:    6 LKKASKRLSCAKRYKIQKKVREHNRKLKKAAKKQGISRKAKKDIGVPNSAPFKEEVLREAEQRKQELETLKEQNKIVKQQEKAAKRKKEKDAASSVKEPAAKKAKKAAKIKEARAAIVKVKSAKTFKCQELNKVIEASDVIVEVLDARDPLGCRCPQLEEMVLKHEGKKKLLFILNKIDLVPKDNLEKWLHFLEAECPTFLFKSSMQLKDRTVQQKRQQRGTNAVLDHSRAASCFGKDFLLQTLNDLANKKEGETMLK------VGVVGFPNVGKSSIINSLKEMRACNAGVQRGLTRCMQEVHITKKVKMIDSPGILAALSNPGSAMALRSLQVEEKEESPQEAVRNLLKQCNQQHIMLQYNVPDYRSSLEFLTTFAMKHGLLQKGGVADTELAATTFLNDWTGAKLSYYSRVPERQGLPSYLSDAIVTELQSDVDM 437          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Match: gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:ZFIN;Acc:ZDB-GENE-040426-2317])

HSP 1 Score: 179.104 bits (453), Expect = 1.074e-48
Identity = 104/300 (34.67%), Postives = 155/300 (51.67%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGD 1240
            K  S+   G++ K+I+ SDVI  VLDARDPMGTRS   E  +K     K +IFVLNK DL+P    K W+A LS+E  T+AF A                      S   S+G  +LI  ++          G   +DK  + VG  G PN GKSS+IN+++ K++C    LAG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI +P     A+  R +   +Q  Y++P + +  +F+   A R   L KGG P+L   +  ++ DW  G+I +  +PP G+  D
Sbjct:  200 KGQSKRIWGELYKVIDSSDVIIQVLDARDPMGTRSQSIETYLKKEKPWKHLIFVLNKCDLIPTWVTKHWVAVLSQEYPTLAFHA----------------------SLTNSFGKGSLIQLLRQF--------GKLHSDKKQISVGFIGYPNVGKSSIINTLRSKKVCNVAPLAGETKVWQYITLMRRIFLIDCPGVVYPSDDSETDIVLKGVVQVEKIRNPEDHIGAVLERAKAEYIQKTYRIPSWSSAEDFLEKLAFRTGKLLKGGEPDLPTVSKMVLNDWQRGRIPFFVKPP-GVETD 468          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Match: gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:ZFIN;Acc:ZDB-GENE-040426-2317])

HSP 1 Score: 83.1889 bits (204), Expect = 1.818e-17
Identity = 48/155 (30.97%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  545 KAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDP 1003
            K W+A LS+E  T+AF A++ +                      S+G  +LI  ++          G   +DK  + VG  G PN GKSS+IN+++ K++C    LAG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI +P
Sbjct:  129 KHWVAVLSQEYPTLAFHASLTN----------------------SFGKGSLIQLLRQF--------GKLHSDKKQISVGFIGYPNVGKSSIINTLRSKKVCNVAPLAGETKVWQYITLMRRIFLIDCPGVVYPSDDSETDIVLKGVVQVEKIRNP 253          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Match: rom1 (retinal outer segment membrane protein 1 [Source:Xenbase;Acc:XB-GENE-962406])

HSP 1 Score: 224.557 bits (571), Expect = 1.656e-66
Identity = 123/306 (40.20%), Postives = 182/306 (59.48%), Query Frame = 2
Query:  317 VDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            ++KHE+++ +   +S +A+  + +K++E +DVI  VLDARDP+G R  + E+ +      K ++ VLNKIDLVP+  ++ W+  L  E  T+AFKA+ Q Q   L  S     + S +  S+ A  G D+L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DPV   EAI  RC + Q+   YK+  F    EF+   A R   LKKGG P+ + AA  ++ DW SGKISY + PP
Sbjct:   86 LEKHEQLENE---NSRKAYYREFKKVVEAADVILEVLDARDPLGCRCPQVEQAVVQSGTEKKLVLVLNKIDLVPKPVVEKWLKYLRNEFPTVAFKASTQQQNKNLQQSRVPVKQASEDLLSSGACIGADSLMKLLGNYCRNK----DIKTS--ISVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAVILRNCVKIEQLVDPVGPVEAILRRCNKEQIIQHYKVSNFRDTLEFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 382          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Match: rom1 (retinal outer segment membrane protein 1 [Source:Xenbase;Acc:XB-GENE-962406])

HSP 1 Score: 224.557 bits (571), Expect = 1.827e-66
Identity = 123/308 (39.94%), Postives = 183/308 (59.42%), Query Frame = 2
Query:  311 KPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            + ++KHE+++ +   +S +A+  + +K++E +DVI  VLDARDP+G R  + E+ +      K ++ VLNKIDLVP+  ++ W+  L  E  T+AFKA+ Q Q   L  S     + S +  S+ A  G D+L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DPV   EAI  RC + Q+   YK+  F    EF+   A R   LKKGG P+ + AA  ++ DW SGKISY + PP
Sbjct:   90 RSLEKHEQLENE---NSRKAYYREFKKVVEAADVILEVLDARDPLGCRCPQVEQAVVQSGTEKKLVLVLNKIDLVPKPVVEKWLKYLRNEFPTVAFKASTQQQNKNLQQSRVPVKQASEDLLSSGACIGADSLMKLLGNYCRNK----DIKTS--ISVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAVILRNCVKIEQLVDPVGPVEAILRRCNKEQIIQHYKVSNFRDTLEFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 388          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Match: rom1 (retinal outer segment membrane protein 1 [Source:Xenbase;Acc:XB-GENE-962406])

HSP 1 Score: 224.557 bits (571), Expect = 1.969e-66
Identity = 123/308 (39.94%), Postives = 183/308 (59.42%), Query Frame = 2
Query:  311 KPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            + ++KHE+++ +   +S +A+  + +K++E +DVI  VLDARDP+G R  + E+ +      K ++ VLNKIDLVP+  ++ W+  L  E  T+AFKA+ Q Q   L  S     + S +  S+ A  G D+L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DPV   EAI  RC + Q+   YK+  F    EF+   A R   LKKGG P+ + AA  ++ DW SGKISY + PP
Sbjct:   98 RSLEKHEQLENE---NSRKAYYREFKKVVEAADVILEVLDARDPLGCRCPQVEQAVVQSGTEKKLVLVLNKIDLVPKPVVEKWLKYLRNEFPTVAFKASTQQQNKNLQQSRVPVKQASEDLLSSGACIGADSLMKLLGNYCRNK----DIKTS--ISVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAVILRNCVKIEQLVDPVGPVEAILRRCNKEQIIQHYKVSNFRDTLEFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 396          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Match: rom1 (retinal outer segment membrane protein 1 [Source:Xenbase;Acc:XB-GENE-962406])

HSP 1 Score: 224.557 bits (571), Expect = 2.121e-66
Identity = 123/308 (39.94%), Postives = 183/308 (59.42%), Query Frame = 2
Query:  311 KPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            + ++KHE+++ +   +S +A+  + +K++E +DVI  VLDARDP+G R  + E+ +      K ++ VLNKIDLVP+  ++ W+  L  E  T+AFKA+ Q Q   L  S     + S +  S+ A  G D+L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DPV   EAI  RC + Q+   YK+  F    EF+   A R   LKKGG P+ + AA  ++ DW SGKISY + PP
Sbjct:   96 RSLEKHEQLENE---NSRKAYYREFKKVVEAADVILEVLDARDPLGCRCPQVEQAVVQSGTEKKLVLVLNKIDLVPKPVVEKWLKYLRNEFPTVAFKASTQQQNKNLQQSRVPVKQASEDLLSSGACIGADSLMKLLGNYCRNK----DIKTS--ISVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAVILRNCVKIEQLVDPVGPVEAILRRCNKEQIIQHYKVSNFRDTLEFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 394          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Match: rom1 (retinal outer segment membrane protein 1 [Source:Xenbase;Acc:XB-GENE-962406])

HSP 1 Score: 224.557 bits (571), Expect = 2.511e-66
Identity = 123/308 (39.94%), Postives = 183/308 (59.42%), Query Frame = 2
Query:  311 KPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            + ++KHE+++ +   +S +A+  + +K++E +DVI  VLDARDP+G R  + E+ +      K ++ VLNKIDLVP+  ++ W+  L  E  T+AFKA+ Q Q   L  S     + S +  S+ A  G D+L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DPV   EAI  RC + Q+   YK+  F    EF+   A R   LKKGG P+ + AA  ++ DW SGKISY + PP
Sbjct:   98 RSLEKHEQLENE---NSRKAYYREFKKVVEAADVILEVLDARDPLGCRCPQVEQAVVQSGTEKKLVLVLNKIDLVPKPVVEKWLKYLRNEFPTVAFKASTQQQNKNLQQSRVPVKQASEDLLSSGACIGADSLMKLLGNYCRNK----DIKTS--ISVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAAVILRNCVKIEQLVDPVGPVEAILRRCNKEQIIQHYKVSNFRDTLEFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 396          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Match: Gnl3l (guanine nucleotide binding protein-like 3 (nucleolar)-like [Source:MGI Symbol;Acc:MGI:2448557])

HSP 1 Score: 202.601 bits (514), Expect = 4.682e-58
Identity = 123/361 (34.07%), Postives = 201/361 (55.68%), Query Frame = 2
Query:  203 ECPFKDQVIKEVTQSSLMEKDAEKKRLLAMR-----ILRKSKPVDKHEE------MKAKMIKDSSR-AFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSR---PSNEKNSTC----ASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            E   K + ++E+ +   + ++ E++R   M      +L++ +  ++ EE      M  ++  +++R A+  + RK++E SDVI  VLDARDP+G R  + E+ +  A  NK ++ VLNKIDLVP++ ++ W+  L  E  T+AFKA+ Q   ++    N +R   P ++ + +     A +G +NL+  + +  +        +    + VG+ G+PN GKSS+INS+KR R C  G + G+T+ +Q V LD  I L+D+PGI+    N      LRNC+ V+K+ DPV   E I  RC   ++   Y +  F T   F+ A A R+   KKGGV + + AA  ++ DW SGKIS+ + PP
Sbjct:   49 EAELKKKRVEEMREKQQVAREQERQRHRTMESYCQDVLKRQQEFEQKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEETVLRAEGNKKLVLVLNKIDLVPKEIVEKWLEYLLNELPTVAFKASTQHHQVK----NLTRCKVPVDQASESLLKSRACFGAENLMRVLGNYCRLG------EVRGHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGVTKFMQEVYLDKFIRLLDAPGIVPG-PNSEVGTILRNCIHVQKLADPVTPVETILQRCNLEEISSYYGVSGFQTTEHFLTAVAHRLGKKKKGGVYSQEQAAKAVLADWVSGKISFYTLPP 398          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Match: Gnl3l (guanine nucleotide binding protein-like 3 (nucleolar)-like [Source:MGI Symbol;Acc:MGI:2448557])

HSP 1 Score: 202.601 bits (514), Expect = 4.682e-58
Identity = 123/361 (34.07%), Postives = 201/361 (55.68%), Query Frame = 2
Query:  203 ECPFKDQVIKEVTQSSLMEKDAEKKRLLAMR-----ILRKSKPVDKHEE------MKAKMIKDSSR-AFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSR---PSNEKNSTC----ASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            E   K + ++E+ +   + ++ E++R   M      +L++ +  ++ EE      M  ++  +++R A+  + RK++E SDVI  VLDARDP+G R  + E+ +  A  NK ++ VLNKIDLVP++ ++ W+  L  E  T+AFKA+ Q   ++    N +R   P ++ + +     A +G +NL+  + +  +        +    + VG+ G+PN GKSS+INS+KR R C  G + G+T+ +Q V LD  I L+D+PGI+    N      LRNC+ V+K+ DPV   E I  RC   ++   Y +  F T   F+ A A R+   KKGGV + + AA  ++ DW SGKIS+ + PP
Sbjct:   49 EAELKKKRVEEMREKQQVAREQERQRHRTMESYCQDVLKRQQEFEQKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEETVLRAEGNKKLVLVLNKIDLVPKEIVEKWLEYLLNELPTVAFKASTQHHQVK----NLTRCKVPVDQASESLLKSRACFGAENLMRVLGNYCRLG------EVRGHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGVTKFMQEVYLDKFIRLLDAPGIVPG-PNSEVGTILRNCIHVQKLADPVTPVETILQRCNLEEISSYYGVSGFQTTEHFLTAVAHRLGKKKKGGVYSQEQAAKAVLADWVSGKISFYTLPP 398          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Match: Gnl3 (guanine nucleotide binding protein-like 3 (nucleolar) [Source:MGI Symbol;Acc:MGI:1353651])

HSP 1 Score: 199.134 bits (505), Expect = 4.431e-57
Identity = 149/461 (32.32%), Postives = 236/461 (51.19%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEV------------TQSSLMEKDAEKKRLLAMRILRKSKPVDKHEE------MKAKMIKDSSRAF-IGDIRKLIEESDVICMVLDARDPMGTRSLE-SEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKA--NVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLI-NYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVN----------SISVLSGTNVMRTIV 1342
            L K +KR + H++YK+ KKV++HHR ++K  K +  KKP      +P   PFK+ +++E              Q    +K+ E+KR L +    +   V+  EE       KAK  K + +     +++K+IE SD++  VLDARDP+G R  +  E +I++ +K +I VLNK DLVP++NL+ W+  L+KE  T+ FKA  N++++           P   K   C    +  L+ ++ +S  K+            + VG+ G PN GKSSVINS+K++ IC  G   GLTR++Q V LD  I +IDSP +I++  N P   ALR+   +E++  P+  A AI ++    Q+ + Y +PE+     F    A R    +KGG PN++ AA  +  +W    + Y   PPA     +  +  +E+I      G N          SI VL G ++   I+
Sbjct:    6 LKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPG-VPNSAPFKEALLREAELRKQQLEELKQQQKLDRQKEQERKRKLEVSPGDEQSNVETREESDEPKRKKAKAGKQNPKKLHCQELKKVIEASDIVLEVLDARDPLGCRCPQIEEAVIQSGSKKLILVLNKSDLVPKENLENWLNYLNKELPTVVFKASTNLKNRKTFKIKKKKVVPFQSK-ICCGKEALWKLLGDFQQSCGKD------------IQVGVIGFPNVGKSSVINSLKQEWICNVGISMGLTRSMQIVPLDKQITIIDSPCLIISPCNSPTALALRSPASIEELR-PLEAASAILSQADNEQVVLKYTVPEYKDSLHFFTKLAQRRGLHQKGGSPNVESAAKLVWSEWTGASLGYYCHPPASW---NHSLHFNENIAAVMKKGFNLEELEKNNAHSIQVLKGPHLTNRIL 448          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Match: Gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:MGI Symbol;Acc:MGI:2385207])

HSP 1 Score: 164.466 bits (415), Expect = 1.908e-43
Identity = 100/302 (33.11%), Postives = 150/302 (49.67%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP-AGIAGDS 1243
            K  S+   G++ K+I+ SDV+  VLDARDPMGTRS   E  +K     K +IFVLNK DLVP    K W+A LS++  T+AF A                      S    +G    I  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    +AG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI+ P     A+  R +   +   YK+  ++   +F+   A R   L KGG P++   +  ++ DW  G+I +  +PP A +  DS
Sbjct:  200 KGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIEAYLKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHA----------------------SLTNPFGKGAFIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSEDSETDIVLKGVVQVEKIKAPQDHIGAVLERAKPEYISKTYKIESWENAEDFLEKLALRTGKLLKGGEPDMLTVSKMVLNDWQRGRIPFFVKPPNAELPTDS 471          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Match: Gnl3l (guanine nucleotide binding protein-like 3 (nucleolar)-like [Source:MGI Symbol;Acc:MGI:2448557])

HSP 1 Score: 81.6481 bits (200), Expect = 9.581e-18
Identity = 39/90 (43.33%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  359 SSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALR 622
            + +A+  + RK++E SDVI  VLDARDP+G R  + E+ +  A  NK ++ VLNKIDLVP++ ++ W+  L  E  T+AFKA+ Q   ++
Sbjct:   54 TRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEETVLRAEGNKKLVLVLNKIDLVPKEIVEKWLEYLLNELPTVAFKASTQHHQVK 143          
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Match: sp|Q21086|GNL3_CAEEL (Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 9.555e-79
Identity = 152/428 (35.51%), Postives = 237/428 (55.37%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSS---LMEKDAEKKRLLAMRI-LRKSKPVDKHEEMKAKMIKDSS-----------------------RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN--DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP-AGIAGDSIDV 1252
            L K +KR S  ++YK+ KKV+ H+R VKK  K   +      ++ +P  CPFK++++ +  Q      + ++A K+     RI  RK+      E M AK  K  +                       +A+  ++RK +E +DVI  VLDARDP+G+RS   E  +    K ++ +LNKIDLVPR+N++ W+  L  +  TIAFKA+ Q+Q   +G  N +  +N + S C   G D ++  + +  +N       +      VG+ G PN GKSSVINS+KR++ C  GNL G+T+ +Q V LD +I LIDSPG+IL      DP E AL+N +RV+ + DP+A   AI  RC +  + + Y L +F+++ +F+   A R+  L++G  P++  AA +++ DWN+GK+ Y + PP  G A + I V
Sbjct:    6 LKKTSKRVSCAKRYKIEKKVRDHNRKVKKEAKKNGTTNKKEKTISVPNSCPFKEEILVQAEQEREKIKVRQEAAKEAAKIHRIEKRKNNLPANFESMVAKASKQGTEFDKKVASAAEHEKFNTLDDKTIKAYASEVRKTVEIADVIIQVLDARDPLGSRSKSVEDQVLKGGKRLVLLLNKIDLVPRENVQKWLEYLRGQFPTIAFKASTQEQKSNIGRFNSAILNNTETSKCV--GADIVMKILANYCRNKDIKTSIR------VGVVGFPNVGKSSVINSLKRRKACNVGNLPGITKEIQEVELDKNIRLIDSPGVILVSQKDLDPIEVALKNAIRVDNLLDPIAPVHAILRRCSKETIMLHYNLADFNSVDQFLAQLARRIGKLRRGARPDVNAAAKRVLNDWNTGKLRYYTHPPEQGTAKEDIVV 425          
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Match: sp|Q54KS4|GNL3_DICDI (Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum OX=44689 GN=gnl3 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.681e-74
Identity = 160/448 (35.71%), Postives = 243/448 (54.24%), Query Frame = 2
Query:   71 NKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQ-----SSLMEKDAEKKRLLAMRILRK---SKPVD-KHEEMK-----------------AKMIKDSS-RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRP---SNEKNSTCASYGVDNLI----NYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVNSIS 1306
            +KR SLH K+KV KKV +HHR VK+  K             IP   PFK+ ++ ++ Q     S   +   EK+RL  M   R+   S   D K  E +                  K  KDSS + F  +++K+IE  DVI  VLDARDPMG R LE EK+I  +  NK I+ +LNKIDLVPR+N+  W+  L     T+AFK + Q Q   LG   G +P   SN+  ++  S G + L+    NY +SLN  T           + VGI G PN GKSS+INS+KR R    G   G T+  Q V LD ++ L+DSPGI+  + N      LRN +++EK+ DP+A  +AI +RC + Q+  +Y++ ++ + T+F+   A++   + KGG+ +L+  AI +I+DW  GKI + ++PP  +   ++  +  + + +  +D ++++S
Sbjct:    7 SKRQSLHHKHKVLKKVAEHHRKVKRFAKQHPELNKSRKDPGIPNLWPFKEDMLNKIEQQKQKASEEKKNKKEKRRLEQMAEARRDIASMAADAKRRESEFQERQQLKQQQKQQGKFEKEGKDSSLKQFYREVKKVIEAGDVILQVLDARDPMGCRCLEIEKMILERYTNKKIVLILNKIDLVPRENVLMWLKYLRNFYPTLAFKCSTQQQKRNLGQQGGIQPELASNDMLNSTESLGAEQLLQLLKNYSRSLNIKTS----------VTVGIIGYPNVGKSSLINSLKRTRSVGVGATPGFTKFAQEVHLDKNVKLLDSPGIVPIKGNVDENIILRNVVKLEKVLDPIAPVDAILSRCSQKQILDIYEIAQYQSTTDFLTQVAAKRKKIVKGGIADLRSTAISVIRDWTGGKIPFYTQPPKVLVKSTLLSQFSDELNIDQSDLISTVS 444          
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Match: sp|Q8MT06|GNL3_DROME (Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster OX=7227 GN=Ns1 PE=1 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 2.638e-73
Identity = 152/431 (35.27%), Postives = 233/431 (54.06%), Query Frame = 2
Query:   62 SKRNKRTSLHQKYKVAKKVKQHHR-DVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVT---QSSLMEKDAEKKRLLAMRILRKSKPVDK---------------HE---------EMKAKMIKDSS-RAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEK---NSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDV 1252
            +K++KR +   K+K+ KKV+ H++ + + + KN K        +QIP  CPFKD ++KEV    Q    E+ A ++   A R   K K ++                HE         + K  + K+ S + +  + RK+IE +DV+  V+DARDP+GTR  E E+ ++ A  NK ++ VLNK DLVPR+NL  WI    +     AFKA+ QDQA RLG         EK    S C   G + L++ + +  +N     G K++  + VG+ G+PN GKSS+INS+ R R C  G+  G+T+++Q V LD+ I LID PGI+     + +   L+N  RV  ++DP  +AE++  R  +     +Y +  +DT  EF    A+RM    K GVP++  AA  ++ DWN+GKI YC++PP    G S+ +
Sbjct:    8 TKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKQKLIQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESMVEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVC--IGAELLMSMLGNYCRNK----GIKTS--IRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAAARSVLNDWNTGKIKYCTQPPEVQEGQSVHI 430          
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Match: sp|Q9M8Z5|NSN1_ARATH (Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 5.484e-70
Identity = 142/363 (39.12%), Postives = 214/363 (58.95%), Query Frame = 2
Query:  194 IPMECPFKDQVIK--EVTQSSLMEKDAEKKRLLAMRILRKSKPV--DKHEEMKAKMIKD----------SSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAA--NKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLG--SSNGSRPSNE-KNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGII-LAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            IP + PFK+Q +K  EV ++  +E+  +KK     R  ++   +  D+  + + + I+D          S RAF  ++ K+IE SDVI  VLDARDP+GTR  + E+++  A  NK ++ +LNKIDLVPR+  + W+  L +E   +AFK + Q+Q   LG  SS  S+PSN  + S C   G D LI  +K+ +++       +    + VGI G+PN GKSS+INS+KR  +   G   GLTR+LQ V LD ++ L+D PG++ L  S + A  ALRNC R+EK++DPV+  + I   C +  L  LYK+P F+ + +F+   A+    LKKGG+ ++  AA  ++ DWN GKI Y + PP
Sbjct:   53 IPNDWPFKEQELKALEVRRARALEEIEQKKEARKERAKKRKLGLVDDEDTKTEGETIEDLPKVVNVRDNSERAFYKELVKVIELSDVILEVLDARDPLGTRCTDMERMVMQAGPNKHLVLLLNKIDLVPREAAEKWLMYLREEFPAVAFKCSTQEQRSNLGWKSSKASKPSNMLQTSDC--LGADTLIKLLKNYSRSH------ELKKSITVGIIGLPNVGKSSLINSLKRAHVVNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSGNDASIALRNCKRIEKLDDPVSPVKEILKLCPKDMLVTLYKIPSFEAVDDFLYKVATVRGKLKKGGLVDIDAAARIVLHDWNEGKIPYYTMPP 407          
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Match: sp|Q6DRP2|GNL3_DANRE (Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=gnl3 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 3.557e-59
Identity = 139/438 (31.74%), Postives = 224/438 (51.14%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQ-SSLMEKDAEKKRLLAMRILRKSKPVDKHEE-------------------MKAKMIK-DSSRAF-IGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSN---EKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA-----GIAGDSIDVELDESITL 1276
            L K +KR S  ++YK+ KKV++H+R +KK+ K +   +     + +P   PFK++V++E  Q    +E   E+ +++  +     +  +K                       +A ++K  S++ F   ++ K+IE SDVI  VLDARDP+G R  + E+++      K ++F+LNKIDLVP+DNL+ W+  L  E  T  FK+++Q +   +      R +N   + +   + +G D L+  +  L     G    K      VG+ G PN GKSS+INS+K  R C AG   GLTR +Q V +   + +IDSPGI+ A SN  +  ALR+    EK E P      +  +C +  + + Y +P++ +  EF+  FA +   L+KGGV + +LAA   + DW   K+SY S  P          D+I  EL   + +
Sbjct:    6 LKKASKRLSCAKRYKIQKKVREHNRKLKKAAKKQGISRKAKKDIGVPNSAPFKEEVLREAEQRKQELETLKEQNKIVKQQEKAAKRKKEKDAASSVKEPAAKKAKKAAKIKEARAAIVKVKSAKTFKCQELNKVIEASDVIVEVLDARDPLGCRCPQLEEMVLKHEGKKKLLFILNKIDLVPKDNLEKWLHFLEAECPTFLFKSSMQLKDRTVQQKRQQRGTNAVLDHSRAASCFGKDFLLQTLNDLANKKEGETMLK------VGVVGFPNVGKSSIINSLKEMRACNAGVQRGLTRCMQEVHITKKVKMIDSPGILAALSNPGSAMALRSLQVEEKEESPQEAVRNLLKQCNQQHVMLQYNVPDYRSSLEFLTTFAMKHGLLQKGGVADTELAATTFLNDWTGAKLSYYSRVPERQGLPSYLSDAIVTELQSDVDM 437          
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Match: A0A504YRQ1 (Guanine nucleotide-binding protein 3 protein OS=Fasciola gigantica OX=46835 GN=FGIG_11233 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.263e-89
Identity = 164/425 (38.59%), Postives = 250/425 (58.82%), Query Frame = 2
Query:   68 RNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNST-----CASYGVDNLINYIKSLNKNTPGAAGTK--SADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA------GIAGDSIDVELDESITLQPTDGVNSI 1303
            ++KR + H++YK+ +KV++HHR V+K  K   ++        IP   PFK++V K V +      +  K  L+       SKP D  +   A +    S AF  +  K+I E+DVI  VLDARDP+GTR +E+E+ + AA K ++ +LNKIDL+P+ NL++W+  L +    + FKAN Q Q   L         NE  S        ++GVD+L++ + + ++N    A ++  SA  L VG+ G+PNTGKS++IN++KR+++C +GN+ G+TR  Q + +D  + LIDSPGI++++S DP+E  LRNC+R E++ DPV   EAI +RC + QL   Y + ++   TEF+V  A R+  LKKGGVPN  +AA  LI DW +GKI Y +E P        ++ D   +  DE I   P+D   S+
Sbjct:    9 KSKRVTCHKRYKILRKVREHHRKVRKEAKKNINQHKRKDP-GIPNSFPFKEEVFKHVEEFKKQTNEVRKYNLI-----HGSKPTDAAKVTNAPV----SPAFHREADKVIMEADVILEVLDARDPLGTRCMETEQKVLAAKKRLVLILNKIDLIPKANLQSWLCYLRQFFPVLPFKANTQQQNKHLSRGKWIENVNEDISIKGKKFTKAFGVDDLLSLLANYSRNGSHKATSEKNSAGCLTVGVIGLPNTGKSAIINTLKRQKVCASGNVPGMTRQCQRIRIDKDLFLIDSPGIVVSKSTDPSELVLRNCIRPEQLPDPVPAVEAILSRCPKQQLMSKYDIDDYSNTTEFLVHLAHRLGRLKKGGVPNTTMAARSLINDWITGKIVYFTELPGITEGLPTVSHDDQQIASDEDI---PSDSDQSM 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Match: A0A4E0R070 (Putative guanine nucleotide-binding protein 3 OS=Fasciola hepatica OX=6192 GN=D915_010222 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.615e-87
Identity = 163/425 (38.35%), Postives = 248/425 (58.35%), Query Frame = 2
Query:   68 RNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNST-----CASYGVDNLINYIKSLNKNTPGAAGTK--SADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAG------DSIDVELDESITLQPTDGVNSI 1303
            ++KR + H++YK+ +KV++HHR V+K  K   ++        IP   PFK++V K V +      +  K  L+       +KP D  +   A +    S A   +  K+I E+DVI  VLDARDP+GTR +E+E+ + AA K ++ +LNKIDL+P+ NL++W+  L +    + FKAN Q Q   L         NE  S        ++GVD+L++ + + ++N    A ++  SA  L VG+ G+PNTGKS++IN++KR+++C +GN+ G+TR  Q + +D  + LIDSPGI++++S DP+E  LRNC+R E++ DPV   EAI +RC + QL   Y + ++   TEF+V  A R+  LKKGGVPN  +AA  LI DW +GKI Y +E P    G      D   +  DE I   P+D   S+
Sbjct:    9 KSKRVTCHKRYKILRKVREHHRKVRKEAKKNINQHKRKDP-GIPNSFPFKEEVFKHVEEFKKQTNEVRKYNLI-----HGNKPTDAVKVTNAPV----SPALHREADKVIIEADVILEVLDARDPLGTRCMETEQKVLAAKKRLVLILNKIDLIPKANLQSWLCYLRQFFPVLPFKANTQQQNKHLSRGKWIENVNEDISVKGKKFTKAFGVDDLLSLLANYSRNGSQKATSEKNSAGCLTVGVIGLPNTGKSAIINTLKRQKVCASGNVPGMTRQCQRIRIDKDLFLIDSPGIVVSKSTDPSELVLRNCIRPEQLPDPVPAVEAILSRCPKQQLMSKYDIDDYSNTTEFLVHLAHRLGRLKKGGVPNTTMAARSLINDWITGKIVYFTELPGVTEGLPTVSPDDQQIASDEDI---PSDSDQSM 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Match: G7YKT6 (Guanine nucleotide-binding protein-like 3-like protein OS=Clonorchis sinensis OX=79923 GN=nst-1 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 4.321e-86
Identity = 157/407 (38.57%), Postives = 239/407 (58.72%), Query Frame = 2
Query:   68 RNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSN------EKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESI 1270
            ++KR + H++YK+ +KV++HHR ++K  K   +         +P   PFKD+++K V      E  A    +    ++   KP   HE+  +K  +  S +   +   LI E DVI  VLDARDP+GTR LE E+ + AA K ++ +LNKIDL+PR NL+ W+  L +    + FKAN Q Q+  L  S G+ P N       K  T    GVD L++ + + ++++  +  +     + VG+ G+PNTGKS++IN++KR+++C + N+ GLTR  Q V LD +I L+DSPGI+  +S+D AE  L+NCL+ E + DPV   EAI  RC + Q+   Y L ++   T F+V  A R+  LKKGGVPN  +AA  +I DW +GK++YC++PP   +  S   E+DE I
Sbjct:   30 KSKRVTCHKRYKILRKVREHHRKLRKEAKKNVTHHKRKDP-GVPNSLPFKDEILKHVE-----EMKATSNEVRIFNLINAGKP---HEDAASKE-RHFSSSLHKETENLINECDVILEVLDARDPLGTRGLEIEEKVNAAKKRLVLLLNKIDLIPRANLQLWLNYLRQWYTVLPFKANTQKQSTNL--SRGNIPWNIDVSLKSKEQTSKGMGVDELMSLLANYSRSSRDSKESTRI-PITVGVIGLPNTGKSAIINTLKRQKVCMSSNVPGLTRQCQRVRLDKNIFLVDSPGIVTCKSSDTAELVLKNCLKPESLPDPVPAVEAILRRCSKHQMMSKYNLGDYADTTAFLVQLAHRLGRLKKGGVPNTTMAARAVISDWITGKLTYCTQPPECPSATS---EMDEDI 420          
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Match: A0A183MWV7 (CP-type G domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS20532 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 8.746e-85
Identity = 149/411 (36.25%), Postives = 247/411 (60.10%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSS------NGSRPSNEKNSTCASYGVDNLINYIKSLNKN-TPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESI 1270
            L  ++KR + H++YK+ KKVK+HHR ++K  K   ++        +P   PFK+  +K+V ++ +  ++A  K +   +  +  K    HE++    ++        D++ +I +SDVI  VLDARDPMGTR LE E+ +   NK ++ ++NKIDLVPR NL+AW+  L K    I FKAN Q Q+  L         +G  PS         +G   L++ + + +++ +   + T +   L VG+ G+PNTGKS++IN++KR+++C +GN+ GLTR  Q V +D ++ L+D+PG ++++S+D ++  L+NC++ E + DPV   EAI  RC + QL   YK+ E++ ++EF+V  A R+  +KKGG+P+  +AA  +I DW  GKI+Y +EPP     D+++  LD S+
Sbjct:    6 LKNKSKRVTCHKRYKIIKKVKEHHRKLRKEAKKNLTRHRKDPG--VPNILPFKESFLKDVAEAKIKLEEARLKNIEYSQTYKSPK----HEDVSHSTVQH-------DVKDVINQSDVILEVLDARDPMGTRCLEIEETVLRENKRLVLLINKIDLVPRSNLEAWVNYLRKTHTVITFKANTQRQSNHLSCGKPYLLKDGKMPS-------KGFGTSELLSLLANYSRDPSSSPSNTNTRLSLTVGVVGLPNTGKSALINTLKRQKVCISGNVPGLTRQSQRVRIDKNLFLLDTPGTLISKSSDASDLVLKNCIKPEMLPDPVPAVEAILRRCSQAQLVSKYKIEEYNNVSEFLVKLAHRLGRMKKGGIPDTTMAARSVINDWIIGKITYYTEPP---YTDTVEENLDLSL 393          
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Match: G4VDL0 (Putative gtp-binding protein-animal OS=Schistosoma mansoni OX=6183 GN=Smp_021070 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.848e-84
Identity = 145/404 (35.89%), Postives = 247/404 (61.14%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGA-AGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP-AGIAGDSIDVELDE 1264
            L  ++KR + H++YK+ KKVK+HHR ++K  K   ++        +P   PFK+  +K+V ++ +  ++A  K +   +  +  K    HE++   +++        D++ +I +SDVI  VLDARDPMGTR  E E+++   NK ++ ++NKIDLVPR NL+AW+  L K    I FKAN Q Q+  L         + K  T   +G   L++ + + +++   + + T +   L VG+ G+PNTGKS++IN++KR+++C +GN+ GLTR  Q V +D ++ L+D+PG ++++S+D ++  L+NC++ E + DPV   EAI  RC + QL   YK+ E++ ++EF+V  A R+  +KKGG+P+  +AA  +I DW  GKI+Y +EPP      +++D+ L++
Sbjct:    6 LKNKSKRVTCHKRYKIIKKVKEHHRKLRKEAKKNLNRHRKDPG--VPNILPFKESFLKDVAEAKMKLEEARLKNIEYSQTYKSQK----HEDVAHSIVQH-------DVKDVINQSDVILEVLDARDPMGTRCPEIEEIVLGENKRLVLLINKIDLVPRSNLEAWVNYLRKTHTVITFKANTQRQSNHLSYGKPYLLKDGKMPT-KGFGTSELLSLLANYSRDPSSSLSNTNARLSLTVGVVGLPNTGKSALINTLKRQKVCISGNVPGLTRQSQRVRIDKNLFLLDTPGTLVSKSSDASDLVLKNCVKPEMLSDPVPAVEAILRRCSQAQLVSKYKIEEYNNVSEFLVKLAHRLGRMKKGGIPDTTMAARSVINDWIIGKITYYTEPPYTNTVKENLDLSLED 395          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Match: gnl3l (G protein nucleolar 3 like [Source:NCBI gene;Acc:103043878])

HSP 1 Score: 230.335 bits (586), Expect = 8.658e-69
Identity = 123/298 (41.28%), Postives = 175/298 (58.72%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLI----NYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            ++S +A+  + +K+IE +DVI  VLDARDP+G R  + E+ +     NK I+ VLNKIDLVP+D ++ WI  L  E  T+AFKA+ Q Q   L  S    ++ S E   + A  G + L+    NY ++ +  T           + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A SN  A   LRNC+++E++ DPV   EAI  RC + Q+   Y + +F T  EF+   A R   L+KGG+P+   AA  ++ DW  G+ISY + PP
Sbjct:  111 ENSRKAYYREFKKVIEAADVILEVLDARDPLGCRCPQVEQAVVQSGTNKKIVLVLNKIDLVPKDLVEKWIKYLRNEFPTVAFKASTQQQNRNLKRSQVPVTQASAELLGSSACVGAECLMKLLGNYCRNQDIKT----------TITVGVVGFPNVGKSSLINSLKRTRACSVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSNSDAVMILRNCVKIEQLVDPVPAVEAILRRCSKTQIMEFYSVSDFHTAPEFLALLARRQGKLRKGGLPDSDAAAKSVLMDWTGGRISYFTHPP 398          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Match: gnl3 (G protein nucleolar 3 [Source:NCBI gene;Acc:103035717])

HSP 1 Score: 197.978 bits (502), Expect = 1.509e-56
Identity = 142/445 (31.91%), Postives = 232/445 (52.13%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSK------PVDKHEEMKAKMI------------------KDSSRAF-IGDIRKLIEESDVICMVLDARDPMGTR--SLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKA--NVQDQAL--RLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIE-DPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVN 1297
            L K +KR S  +++K+ KKV++HH+ ++K  K    K+ L   +++P   PFK++V++E  Q     ++ ++K  LA +  R  K       V   EE K+K +                  + S++ F   ++ K+IE SDVI  VLDARDP+G R   LE   L     K ++FV+ KIDLVP++NL+ W+  L +E  T  FKA   +QD+ +  +   +NG     + +   +S+G D+L+  +  L+         +S   L VGI G P  GKSS+INS+K  R C AG   GLT+ +Q V +   + +IDSP ++ A S+   +  LR+ L+VE+ E  P+   + +   C +  + + Y +P++    EF+  FA +   L+KG +PN++ AA   + DW   K+SY ++ P       +   L E +  Q   G+N
Sbjct:    6 LKKGSKRVSCAKRFKIQKKVREHHKKLRKEAKKSGIKRKLKKDIEVPNSAPFKEEVLREAEQRKQELEELKEKNRLAKQKERAEKRKAAKDGVSGAEEPKSKRVKKEEKVKAQRQARAAVAKEKSNKVFRCKELNKVIEASDVIIEVLDARDPLGCRCPQLEEAVLKHEGKKRLLFVMTKIDLVPKENLEKWVEYLKEECPTFVFKACMRIQDKTVMEKKQKANGKV---DLSRAASSFGCDSLMQTLSDLSNKL------ESESMLKVGIVGFPGVGKSSIINSLKGIRACHAGVQRGLTKCMQEVHISKKVKMIDSPAMVAAPSSSGEKLVLRS-LQVEENEASPLEAVQTLLKHCNQQDIMLEYTVPDYRNALEFLTLFAKKRGFLQKGALPNVEQAATVFLNDWTGPKLSYHTKVP---ERQGLPPHLTEDLVAQMQAGMN 437          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Match: gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:ZFIN;Acc:ZDB-GENE-040426-2317])

HSP 1 Score: 170.629 bits (431), Expect = 6.577e-46
Identity = 101/295 (34.24%), Postives = 155/295 (52.54%), Query Frame = 2
Query:  329 EEMKAKMIKDS-SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGK 1198
            EE++ ++ K   S+   G++ K+I+ SDV+  VLDARDPMGTRS   E  IK   + K +IFVLNK DL+P    K W+A LS+E  T+AF A++ +                      S+G  +LI  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    LAG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI +P     A+  R +   +Q  Y++P + +  +F+   A R   L KGG P+L   +  ++ DW  G+
Sbjct:  191 EEVREEIFKKGQSKRIWGELYKVIDSSDVVIQVLDARDPMGTRSKNIETYIKKEKSWKHLIFVLNKCDLIPTWVTKRWVAVLSQEYPTLAFHASLTN----------------------SFGKGSLIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPLAGETKVWQYITLMRRIFLIDCPGVVYPSEDSETDIVLKGVVQVEKIRNPEDHIGAVLERAKAEYIQKTYRIPSWSSAEDFLEKLAFRTGKLLKGGEPDLPTVSKMVLNDWQRGQ 455          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Match: gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:ZFIN;Acc:ZDB-GENE-040426-2317])

HSP 1 Score: 170.629 bits (431), Expect = 8.974e-46
Identity = 101/294 (34.35%), Postives = 153/294 (52.04%), Query Frame = 2
Query:  329 EEMKAKMIKDS-SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSG 1195
            EE++ ++ K   S+   G++ K+I+ SDV+  VLDARDPMGTRS   E  IK     K +IFVLNK DL+P    K W+A LS+E  T+AF A++ +                      S+G  +LI  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    LAG T+  Q++ L   I LID PG++    +   +  L+  ++VEKI +P     A+  R +   +Q  Y++P + +  +F+   A R   L KGG P+L   +  ++ DW  G
Sbjct:  191 EEVREEIFKKGQSKRIWGELYKVIDSSDVVIQVLDARDPMGTRSKNIETYIKKEKSWKHLIFVLNKCDLIPTWVTKRWVAVLSQEYPTLAFHASLTN----------------------SFGKGSLIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPLAGETKVWQYITLMRRIFLIDCPGVVYPSEDSETDIVLKGVVQVEKIRNPEDHIGAVLERAKAEYIQKTYRIPSWSSAEDFLEKLAFRTGKLLKGGEPDLPTVSKMVLNDWQRG 454          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Match: lsg1 (large 60S subunit nuclear export GTPase 1 [Source:NCBI gene;Acc:323464])

HSP 1 Score: 64.6994 bits (156), Expect = 1.193e-10
Identity = 54/211 (25.59%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  638 GSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQS-NDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQ----RIQLQVLYKL----PEFD-------TITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            G+R S+   ++      D L+   KS +     +  T    +L VG+ G PN GKSS IN+I + +        G T++ Q + ++  + L D PG+++    +  AE      L ++++ D V     I ++      R  L+  Y      P  D       T  E + A+      +   G P+   +A  ++KD+ SGK+ YC  PP
Sbjct:  330 GARKSSSFYNSSRLLHKDELLEMFKSAH-----SGPTCKEGQLTVGLVGYPNVGKSSTINTIFQNKKVSVSATPGHTKHFQTLFVEPSLCLCDCPGLVMPSFVSTKAEMICCGILPIDQMRDHVPAISLISSQYSLTIPRTVLEGTYGFNIIRPREDEDPDRPPTAEELLAAYGCMRGFMTAHGQPDQSRSARYVLKDYVSGKLLYCHPPP 535          

HSP 2 Score: 53.1434 bits (126), Expect = 4.387e-7
Identity = 38/139 (27.34%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  188 MQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRA--FIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIK--AANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAF 592
            ++IP   P+ +    EV Q +      E+   L  R     + + + EE +  ++    R   F   + ++IE SDV+  +LDAR+P+  R  + EK +K  +  K  + +LNK DL+ R+  + W     KE     F
Sbjct:  108 LRIPRRPPWDESTSPEVLQQT------ERDTFLTWR-----RDLARLEEEQKLILTPFERNLDFWRQLWRVIERSDVVVQILDARNPLLFRCPDLEKYVKEVSGQKVNMLLLNKADLLTREQRRTWARYFQKEGIRAVF 235          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Sea Lamprey
Match: gnl2 (guanine nucleotide binding protein-like 2 (nucleolar) [Source:ZFIN;Acc:ZDB-GENE-040426-2317])

HSP 1 Score: 173.326 bits (438), Expect = 2.475e-47
Identity = 111/344 (32.27%), Postives = 171/344 (49.71%), Query Frame = 2
Query:  221 QVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDS-SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAG 1237
            Q + E  Q+S    D EK R L +      +     EE + ++ K   S+   G++ K+I+ SDV+  VLDARDPMGTRS   EK ++     K +IFV NK DLVP    + W+A LS E  T+AF A++                        S+G   LI  ++          G    DK  + VG  G PN GKSS+IN+++ K++C+   +AG T+  Q++ L   I LID PG++    +   E  L+  +++EKI+ P      + NR +   +Q  YK+  + +  +F+   A RM  L KGG P+ +  A  ++ D+  G+I +  +PPA   G
Sbjct:  161 QALLESAQTSADTYDLEKDRDLVV------EDSGIREEAREEIFKKGQSKRIWGELYKVIDSSDVVIQVLDARDPMGTRSKHIEKYLRKEKPWKHLIFVFNKCDLVPTWVTQRWVAILSSEYPTLAFHASI----------------------TKSFGKGALIQLLRQF--------GKLHIDKKHISVGFIGYPNVGKSSIINTLRSKKVCKVAPIAGETKVWQYITLMKRIFLIDCPGVVYPSGDTETEIVLKGVVQIEKIKTPEDHIPEVLNRVKPDYIQKTYKIESWSSPEDFLEKMAFRMGKLLKGGEPDCQTVAKMVLNDFQRGRIPFFVKPPAAPGG 468          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001200.1 (pep scaffold:Pmarinus_7.0:GL478700:12557:17182:-1 gene:ENSPMAG00000001073.1 transcript:ENSPMAT00000001200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 4.287e-16
Identity = 65/213 (30.52%), Postives = 111/213 (52.11%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQ------IPMECPFKDQVIK--EVTQSSLME-----KDAEKKRLLAMRILRKS--KPV---DKHEEMKAKMIKDSSRAFI-----------GD-IRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQ 607
            L K +KR +  +++K+ KKV++H R  +K  K KK       + +      +P   PFKD V++  E+ +    E     K+A +K +   R  R S   PV    K E +  +++ +  +              GD   +++  +DV+ +VLDARDP+G R  + E+ +  A K ++F+LNKIDLVP+D+ + W++ L +E  T+ FK + Q
Sbjct:    6 LKKASKRMTCSKRFKIQKKVREHKRKQRKEAKKKKGTGAGSAARRARKDPGVPNLAPFKDAVLRDAELKKQQAEELKAKRKEARQKEMQKKRDERISVQDPVAMKTKPEALNKRLLNELHKGRCANELICVCDGGGDGAGQVLGLADVVLLVLDARDPLGCRCPQLEQTVLEAGKPLVFLLNKIDLVPKDSAEKWLSFLGREHPTVLFKCSTQ 218          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Sea Lamprey
Match: lsg1 (large 60S subunit nuclear export GTPase 1 [Source:NCBI gene;Acc:323464])

HSP 1 Score: 64.3142 bits (155), Expect = 2.817e-11
Identity = 46/171 (26.90%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  761 KLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQS-NDPAEYALRNCLRVEKIEDPV-AVAEAIYNRCQRIQ---LQVLYKL----PEFD-------TITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            +  +G+ G PN GKSS IN+I + +        G T++ Q + +D+ + L D PG+++    +  AE A    L ++++ D V  V+    + CQ I    L+  Y +    P  D       T  E + A+      +   G P+   +A  ++KD+ +GK+ +C  PP 
Sbjct:  384 QTTIGLVGYPNVGKSSTINTILQNKKVPVSATPGRTKHFQTLFVDSDLCLCDCPGLVMPSFVSTKAEMACSGILPIDQMRDHVPPVSLMPRHVCQHIPRAVLEATYGINIVRPREDEDPDRPPTAEELLSAYGYMRGYMTAHGQPDQPRSARYILKDYVNGKLLFCYPPPG 554          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Yeast
Match: NOG2 (Putative GTPase; associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation; recruited by ribosomal proteins L17, L35, and L37 to assembling ribosomes after 27SB pre-rRNA is generated, immediately preceding removal of ITS2 [Source:SGD;Acc:S000005336])

HSP 1 Score: 159.844 bits (403), Expect = 4.537e-44
Identity = 96/288 (33.33%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  353 KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIK--AANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYAL-RNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISY 1207
            K  S+    ++ K+I+ SDV+  VLDARDP+GTR    E+ +K    +K +I+VLNK DLVP     AW+  LSKE  T+AF A++ +                      S+G  +LI  ++  ++            ++ VG  G PNTGKSS+IN++++K++C+   + G T+  Q++ L   I LID PGI+   S D  E  L R  +RVE +  P      +  RCQ   L+  Y++  +   TEF+   A +   L KGG P+    + +++ D+N GKI +
Sbjct:  205 KGQSKRIWNELYKVIDSSDVVIHVLDARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWVAAAWVKHLSKERPTLAFHASITN----------------------SFGKGSLIQLLRQFSQLH------TDRKQISVGFIGYPNTGKSSIINTLRKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDSEEDILFRGVVRVEHVTHPEQYIPGVLKRCQVKHLERTYEISGWKDATEFIEILARKQGRLLKGGEPDESGVSKQILNDFNRGKIPW 464          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Yeast
Match: NUG1 (GTPase that associates with nuclear 60S pre-ribosomes; required for export of 60S ribosomal subunits from the nucleus [Source:SGD;Acc:S000000808])

HSP 1 Score: 145.591 bits (366), Expect = 1.193e-38
Identity = 102/309 (33.01%), Postives = 160/309 (51.78%), Query Frame = 2
Query:  350 IKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLE-SEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNE-KNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKR-----ICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSN-------DPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRI-----QLQVLYKLP-----EFDTITE-FMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKI 1201
            ++ S +A+    + +I+ SDVI  VLDARDP  TRS +  E ++++  K +I +LNK+DL+P   L+ W+  L     TI  +A+        G+ NG+  + +   +T AS  +++L  Y  S N N   +        ++VG+ G PN GKSSVIN++  +R      C  GN AG+T +L+ + +DN + ++DSPGI     N         AE AL N L  + I DP      +  R  +        + LY++P     + DT T+ F++  A +   L KGG+PNL  A + ++ DW  GKI
Sbjct:  158 LEKSRKAYDKIFKSVIDASDVILYVLDARDPESTRSRKVEEAVLQSQGKRLILILNKVDLIPPHVLEQWLNYLKSSFPTIPLRASS-------GAVNGTSFNRKLSQTTTASALLESLKTY--SNNSNLKRS--------IVVGVIGYPNVGKSSVINALLARRGGQSKACPVGNEAGVTTSLREIKIDNKLKILDSPGICFPSENKKRSKVEHEAELALLNALPAKHIVDPYPAVLMLVKRLAKSDEMTESFKKLYEIPPIPANDADTFTKHFLIHVARKRGRLGKGGIPNLASAGLSVLNDWRDGKI 449          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Yeast
Match: LSG1 (Putative GTPase involved in 60S ribosomal subunit biogenesis; required for the release of Nmd3p from 60S subunits in the cytoplasm [Source:SGD;Acc:S000003067])

HSP 1 Score: 82.0333 bits (201), Expect = 4.357e-17
Identity = 68/313 (21.73%), Postives = 136/313 (43.45%), Query Frame = 2
Query:  383 IRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACL-SKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVD---NLINYIKSLN-------------KNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQ-SNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLP------------EFDTITEFMVAFASRMCPLKKG-GVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            + +++E SD++  ++DAR+P+  RS++ E+ +K ++  K  + ++NK DL+ +    AW     SK      + A   +Q L      G     +        G D    ++  +K L+                           + +G+ G PN GKSS INS+   +     +  G T++ Q + L + ++L D PG++    + +  E      L ++++ D +  A  +  R  +  ++ +Y +             +  T  E +VA+A     + +G G  +   A+  ++KD+ +GK+ Y + PP
Sbjct:  191 LWRVVERSDLVVQIVDARNPLLFRSVDLERYVKESDDRKANLLLVNKADLLTKKQRIAWAKYFISKNISFTFYSALRANQLLEKQKEMGEDYREQDFEEADKEGFDADEKVMEKVKILSIDQLEELFLSKAPNEPLLPPLPGQPPLINIGLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTIKLSDSVMLCDCPGLVFPNFAYNKGELVCNGVLPIDQLRDYIGPAGLVAERIPKYYIEAIYGIHIQTKSRDEGGNGDIPTAQELLVAYARARGYMTQGYGSADEPRASRYILKDYVNGKLLYVNPPP 503          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Match: EDO46882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM6])

HSP 1 Score: 230.72 bits (587), Expect = 4.099e-71
Identity = 132/371 (35.58%), Postives = 206/371 (55.53%), Query Frame = 2
Query:  194 IPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSK----------PVDKHEEMKAKMIKD--------------SSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKT--IIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            IP   PFKDQ+++++ +  L +++A K+R+   R+   +K           + +  E + K IK               S +A+  + +K++E +DVI  VLDARDP+G R  + E+ + AA  T  ++ +LNKIDLVP+D  + W+  L  E   + FKA+ Q Q   L  S    S    +  S+ +  G + L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+++Q V LD HI L+DSPGI++   +  A   LRNC+++E IEDP+   EAI  RC + Q+   Y +P++    EF+     R+  LKKGGVP++  A   L++DWNSGKI + + PP
Sbjct:    6 IPNLYPFKDQLLRQMEEKKLKDEEA-KQRIKQKRMKEVNKRRNLFNLQEDAIKRAREFEKKTIKTRHLQKYYSYLYPETSLKAYYREFKKVVEAADVILEVLDARDPIGCRCPQVEQAVIAAGATKKLVLILNKIDLVPKDIAEKWLKYLRNEFPAVIFKASTQTQKQNLSHSKVPVSLAGKDVLSSSSCLGAETLLKLLGNYCRN----KDIKTS--ITVGVVGFPNVGKSSIINSLKRSRTCTVGATPGVTKSMQEVQLDKHIKLLDSPGIVMDTGDSDAAIILRNCVKIENIEDPIPPVEAILRRCNKQQVMEKYSVPDYKDSNEFLTHLGKRLGKLKKGGVPDINAAGKTLLRDWNSGKIQFYTHPP 369          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Match: EDO31027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ44])

HSP 1 Score: 194.512 bits (493), Expect = 1.024e-57
Identity = 110/292 (37.67%), Postives = 166/292 (56.85%), Query Frame = 2
Query:  359 SSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKT--IIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNG--SRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            S +A+  + +K++E +DVI  VLDARDP+G R  + E+ + AA  T  ++ +LNKIDLVP+D  + W+  L  E   + FKA+ Q Q   L  S    S    +  S+ +  G + L+  + +  +N       K++  + VG+ G PN GKSS+INS+KR R C  G   G+T+++Q V LD HI L+DSPGI++   +  A   LRNC+++E IEDP+   EAI  RC + Q+   Y +P++    EF+     R+  LKKG   NL  + I  +    SGKI + + PP
Sbjct:   49 SLKAYYREFKKVVEAADVILEVLDARDPIGCRCPQVEQAVIAAGATKKLVLILNKIDLVPKDIAEKWLKYLRNEFPAVIFKASTQTQKQNLSHSKVPVSLAGKDVLSSSSCLGAETLLKLLGNYCRN----KDIKTS--ITVGVVGFPNVGKSSIINSLKRSRTCTVGATPGVTKSMQEVQLDKHIKLLDSPGIVMDTGDSDAAIILRNCVKIENIEDPIPPVEAILRRCNKQQVMEKYSVPDYKDSNEFLTHLGKRLGKLKKGS--NLITSCISSL---YSGKIQFYTHPP 329          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Match: EDO41341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4K1])

HSP 1 Score: 166.392 bits (420), Expect = 7.927e-46
Identity = 102/314 (32.48%), Postives = 161/314 (51.27%), Query Frame = 2
Query:  317 VDKHEEMKAKMI-KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKA--ANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLI-VGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSI 1246
            +D+  E K  +  K  S+    ++ K+++ SDVI  VLDARDP+GTRS   E  IK   ++K +IF+LNK DLVP    + W++ LS+E  T+AF A+V +                       +G   LIN ++  +K         S  K I VG+ G PN GKSS+IN++K K++C+   +AG T+  Q++ L   I L+D PG++    +   E  L+  +RVE +++       +  R +R  L   Y++  +D  T+F+   + R   L KGG P++   A  ++ D+  GK+ Y   PP     D I
Sbjct:  110 LDERPEAKESIYSKGQSKRIWNELYKVVDSSDVILQVLDARDPLGTRSKHIETFIKKEKSHKHLIFILNKCDLVPTWVTQQWVSVLSEEHPTLAFHASVTN----------------------PFGKGALINLLRQFSK-------LHSDKKQISVGLIGYPNVGKSSIINTLKAKKVCKVAPIAGETKVWQYITLMRRIYLVDCPGVVYPTGDTETEIILKGVVRVENVKEAAEHIPTVLERVKREYLAKTYRVQAWDDCTDFLEQVSRRSGKLLKGGEPDINTVAKMILNDFQRGKLPYFVAPPKQENDDRI 394          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Match: EDO40984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J2])

HSP 1 Score: 65.855 bits (159), Expect = 1.917e-11
Identity = 52/219 (23.74%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  695 LINYIKSLNKNTPGAAGTKSADKLI-VGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQS-NDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKL----------PEFDTIT-EFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA--------GIAGDSIDVELDESITLQPTD 1288
            LI+  +++++N   A      D L  +G+ G PN GKSS IN+I + +     +  G T++ Q + L   + L D PG++     +  AE  +   L ++++ D   +   + +R  R+ L+ +Y +          P+      E + A+      +   G P+   +A  ++KD+ +GK+ YC+ PP         G        ++DE +  +P+D
Sbjct:  349 LIDMCQNIHRN---AVADLPEDALTTIGLVGYPNVGKSSTINTILQSKKVAVSSTPGRTKHFQTLQLSPTVCLCDCPGLVFPSFVSTKAEMVVNGILPIDQMRD--HIPPYVCHRIPRLVLEGIYGINIASPAEGEDPDRAPYAHELLNAYGYMRGYMTSSGTPDCPRSARYILKDYVNGKLLYCTPPPGEDAVVFQEGRHATGKYEDMDEVVRHRPSD 562          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Match: EDO38877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBP5])

HSP 1 Score: 58.5362 bits (140), Expect = 2.798e-9
Identity = 53/241 (21.99%), Postives = 100/241 (41.49%), Query Frame = 2
Query:  383 IRKLIEESDVICMVLDARDP-MGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAW------------IACLSKEARTIAFKANVQDQAL----RLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLI-VGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQL 1051
            + +++E SD+I  + D R P +       E ++K   K  I VLNK+DLV  + + AW            + C S   +  + +   Q + L    R    N +    E  + C+    D   + I  +++        ++ D L+ +G  G  N GKSS++N +  K++       G T++ Q + L   + L D PG++     D     L     + ++++P      +  R   + +
Sbjct:   43 LWRVLEVSDIIVCLADIRHPALHFSPALYEYVLKDLKKKFILVLNKVDLVSPELVTAWKCYFQSKYEHLSVVCFSSFPKAESERNKEQGKVLSKKQRRKKFNSAVGPRELLAACSKLCGDK--DEIDQVHEE------VETNDALLTLGFVGHTNVGKSSLLNGLVGKKVVSVSRTPGHTKHFQTIFLTPSVRLCDCPGLVFPSLVDKQLQILSGLFPISQVQEPYTAVGYLAARWPLVHM 275          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Match: gnl3l (guanine nucleotide-binding protein-like 3-like protein [Source:NCBI gene;Acc:101166045])

HSP 1 Score: 235.343 bits (599), Expect = 1.095e-70
Identity = 130/319 (40.75%), Postives = 191/319 (59.87%), Query Frame = 2
Query:  296 ILRKSKPVDKHEEMKA--KMI----KDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLI--KAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGS--RPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPP 1222
            +LR+ +   K  EM++  K +    ++S +A+  + +K++E SDVI  VLDARDP+G R  + E+ +     NK I+ VLNKIDLV ++ ++ WI  L  E  T+AFKA+ Q QA  L  SN S  + + E  ST A  G D L+  + +  +N       K+A  + VG+ G PN GKSS+INS+KR R C  G   G+T+ LQ V LD HI L+D PGI++A S   A   LRNC+++E++ DP+   EAI  RC ++Q+   Y +P+F T  EF+   A R   L+KGG+P+   AA  ++ DW  G+I+Y + PP
Sbjct:   84 LLRQREFEQKETEMRSLEKHVNFENENSRKAYYREFKKVVEASDVILEVLDARDPLGCRCPQVEQAVIQSGTNKKIVLVLNKIDLVSKEIVEKWIKYLRNEFPTVAFKASTQQQAKNLKRSNVSVTQATAELLSTSACIGADCLMRLLGNYCRN----QDIKTA--ITVGVVGFPNVGKSSLINSLKRARACHVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATSTSDAVMILRNCVKIEQLVDPLPPVEAILRRCNKVQIMEHYGVPDFQTAAEFLAMLARRQGKLRKGGLPDTDKAAKSVLMDWTGGRITYFTHPP 396          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Match: gnl3 (G protein nucleolar 3 [Source:NCBI gene;Acc:101160806])

HSP 1 Score: 230.335 bits (586), Expect = 5.399e-69
Identity = 156/438 (35.62%), Postives = 241/438 (55.02%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSL-MEKDAEKKR-----------LLAMRILRKSKPVDKHEE-----MKAKMIKDSSRAFI-GDIRKLIEESDVICMVLDARDPMGTR--SLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKAN--VQDQALRLGSSN--GSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPV-AVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISY-CSEP-----PAGIAGDSIDVELDESITLQ 1279
            L K +KR S  ++YK+ +KV++HHR ++K  K K   K +   + +P   PFK++V++E  Q  L +E++ E++R                   ++ P  K         K   +  SS+ F+  ++ K+I+ SDVI  VLDARDP G+R   LE   L +  NK I+ +LNKIDLVP++NL+ WI  L KE   +AFKA+  +QD+ L+   S    S    +K+   A +G   L + + S       A+ T+S  KL VGI G PN GKSS+INS+K    C AG   G+T+++Q V +  ++ LIDSPGI+ + +N PA  ALR+ L+VE+ +D V   A+ +  +C + Q+ + Y +P++    EF+   A +   L+KGGVP+ + AA   + DW   K+SY C  P     PA +  DS+  E+     L+
Sbjct:    6 LKKASKRLSCSKRYKIQRKVREHHRKLRKEAKKKGVSKRVKKDLGVPSSAPFKEEVLREAEQRKLQIEEEKERQRQANKEERAKKRKKEEAASNETGPQAKKTRKDALARKQAAVNRSSKQFLCAELNKVIDASDVIVEVLDARDPQGSRCPQLEEAVLQREGNKKILLLLNKIDLVPKENLEKWIGFLQKEFPVVAFKASTLIQDKTLQAKKSRIVASNDILDKSRGVACFGSSCLSDLLMSF------ASKTQSEAKLKVGIVGFPNVGKSSLINSMKGILACNAGVKRGITKSMQEVHISKNVKLIDSPGIVASPTNPPASMALRS-LQVEEGQDSVLEAAQTLLKQCDKTQVMLQYNVPDYRNSLEFLTMLAKKRGYLQKGGVPDTQQAATTFLSDWTGAKLSYHCKVPGTHILPAYLM-DSVVAEMQNGWNLK 435          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Match: gnl3 (G protein nucleolar 3 [Source:NCBI gene;Acc:101160806])

HSP 1 Score: 230.335 bits (586), Expect = 1.544e-68
Identity = 156/438 (35.62%), Postives = 241/438 (55.02%), Query Frame = 2
Query:   59 LSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSL-MEKDAEKKR-----------LLAMRILRKSKPVDKHEE-----MKAKMIKDSSRAFI-GDIRKLIEESDVICMVLDARDPMGTR--SLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKAN--VQDQALRLGSSN--GSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPV-AVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISY-CSEP-----PAGIAGDSIDVELDESITLQ 1279
            L K +KR S  ++YK+ +KV++HHR ++K  K K   K +   + +P   PFK++V++E  Q  L +E++ E++R                   ++ P  K         K   +  SS+ F+  ++ K+I+ SDVI  VLDARDP G+R   LE   L +  NK I+ +LNKIDLVP++NL+ WI  L KE   +AFKA+  +QD+ L+   S    S    +K+   A +G   L + + S       A+ T+S  KL VGI G PN GKSS+INS+K    C AG   G+T+++Q V +  ++ LIDSPGI+ + +N PA  ALR+ L+VE+ +D V   A+ +  +C + Q+ + Y +P++    EF+   A +   L+KGGVP+ + AA   + DW   K+SY C  P     PA +  DS+  E+     L+
Sbjct:    6 LKKASKRLSCSKRYKIQRKVREHHRKLRKEAKKKGVSKRVKKDLGVPSSAPFKEEVLREAEQRKLQIEEEKERQRQANKEERAKKRKKEEAASNETGPQAKKTRKDALARKQAAVNRSSKQFLCAELNKVIDASDVIVEVLDARDPQGSRCPQLEEAVLQREGNKKILLLLNKIDLVPKENLEKWIGFLQKEFPVVAFKASTLIQDKTLQAKKSRIVASNDILDKSRGVACFGSSCLSDLLMSF------ASKTQSEAKLKVGIVGFPNVGKSSLINSMKGILACNAGVKRGITKSMQEVHISKNVKLIDSPGIVASPTNPPASMALRS-LQVEEGQDSVLEAAQTLLKQCDKTQVMLQYNVPDYRNSLEFLTMLAKKRGYLQKGGVPDTQQAATTFLSDWTGAKLSYHCKVPGTHILPAYLM-DSVVAEMQNGWNLK 435          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Match: gnl2 (G protein nucleolar 2 [Source:NCBI gene;Acc:101173497])

HSP 1 Score: 181.415 bits (459), Expect = 9.256e-50
Identity = 106/309 (34.30%), Postives = 164/309 (53.07%), Query Frame = 2
Query:  329 EEMKAKMIKDS-SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGD 1240
            EE + ++ K   S+   G++ K+I+ SDVI  VLDARDPMGTRS   E  +K     K +IFVLNK DL+P    K W+A LS+E  T+AF A++ +                      S+G  +LI  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    +AG T+  Q++ L   I LID PG++    +  ++  L+  ++VEKI +P    EA+  R +   +Q  Y++P +++  +F+   A R   L KGG P++   +  ++ DW  G+I +  +PP G  GD
Sbjct:  191 EEAREEIFKKGQSKRIWGELYKVIDSSDVIIQVLDARDPMGTRSKSIETYLKKEKPWKHLIFVLNKCDLIPTWVTKRWVAVLSQEYPTLAFHASLTN----------------------SFGKGSLIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSEDSESDIVLKGVVQVEKIRNPEDHIEAVLERAKPEYVQKTYRIPSWNSTEDFLEKLAFRTGKLLKGGEPDISTVSKMVLNDWQRGRIPFFVKPP-GPEGD 468          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Match: gnl2 (G protein nucleolar 2 [Source:NCBI gene;Acc:101173497])

HSP 1 Score: 181.03 bits (458), Expect = 1.813e-49
Identity = 107/309 (34.63%), Postives = 162/309 (52.43%), Query Frame = 2
Query:  329 EEMKAKMIKDS-SRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAAN--KTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADK--LIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGD 1240
            EE + ++ K   S+   G++ K+I+ SDVI  VLDARDPMGTRS   E  +K     K +IFVLNK DL+P    K W+A LS+E  T+AF A                      S   S+G  +LI  ++          G    DK  + VG  G PN GKSSVIN+++ K++C    +AG T+  Q++ L   I LID PG++    +  ++  L+  ++VEKI +P    EA+  R +   +Q  Y++P +++  +F+   A R   L KGG P++   +  ++ DW  G+I +  +PP G  GD
Sbjct:  191 EEAREEIFKKGQSKRIWGELYKVIDSSDVIIQVLDARDPMGTRSKSIETYLKKEKPWKHLIFVLNKCDLIPTWVTKRWVAVLSQEYPTLAFHA----------------------SLTNSFGKGSLIQLLRQF--------GKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSEDSESDIVLKGVVQVEKIRNPEDHIEAVLERAKPEYVQKTYRIPSWNSTEDFLEKLAFRTGKLLKGGEPDISTVSKMVLNDWQRGRIPFFVKPP-GPEGD 468          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Match: SMESG000075369.1 (SMESG000075369.1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 448/454 (98.68%), Postives = 451/454 (99.34%), Query Frame = 2
Query:   50 MVSLSKRNKRTSLHQKYKVAKKVKQHHRDVXXXXXXXXXXXXXXXXMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVNSISVLSGTNVMRTIVEEEQLMEEXXXXXXXXXXXXMNE 1411
            MVSLSKRNKRTSLHQKYKVAKKVKQHHRDVKKSLKNKKSKKPLPLSMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRS+ESEKLIKAANKTIIFVLNKIDLVPRDNLKAWI+CLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVA DNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGG+PNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQP DGVNSISVLSGTNVMRTIVE EQLMEESDQDSDSGDSVDMNE
Sbjct:    1 MVSLSKRNKRTSLHQKYKVAKKVKQHHRDVKKSLKNKKSKKPLPLSMQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSIESEKLIKAANKTIIFVLNKIDLVPRDNLKAWISCLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVAHDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGIPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPIDGVNSISVLSGTNVMRTIVEGEQLMEESDQDSDSGDSVDMNE 454          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Match: SMESG000075369.1 (SMESG000075369.1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 402/408 (98.53%), Postives = 405/408 (99.26%), Query Frame = 2
Query:  188 MQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVNSISVLSGTNVMRTIVEEEQLMEEXXXXXXXXXXXXMNE 1411
            MQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRS+ESEKLIKAANKTIIFVLNKIDLVPRDNLKAWI+CLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVA DNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGG+PNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQP DGVNSISVLSGTNVMRTIVE EQLMEESDQDSDSGDSVDMNE
Sbjct:    1 MQIPMECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSIESEKLIKAANKTIIFVLNKIDLVPRDNLKAWISCLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVAHDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGIPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPIDGVNSISVLSGTNVMRTIVEGEQLMEESDQDSDSGDSVDMNE 408          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Match: SMESG000075369.1 (SMESG000075369.1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 398/404 (98.51%), Postives = 401/404 (99.26%), Query Frame = 2
Query:  200 MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVNSISVLSGTNVMRTIVEEEQLMEEXXXXXXXXXXXXMNE 1411
            MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRS+ESEKLIKAANKTIIFVLNKIDLVPRDNLKAWI+CLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVA DNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGG+PNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQP DGVNSISVLSGTNVMRTIVE EQLMEESDQDSDSGDSVDMNE
Sbjct:    1 MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSIESEKLIKAANKTIIFVLNKIDLVPRDNLKAWISCLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVAHDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGIPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPIDGVNSISVLSGTNVMRTIVEGEQLMEESDQDSDSGDSVDMNE 404          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Match: SMESG000075369.1 (SMESG000075369.1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 385/404 (95.30%), Postives = 387/404 (95.79%), Query Frame = 2
Query:  200 MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSIDVELDESITLQPTDGVNSISVLSGTNVMRTIVEEEQLMEEXXXXXXXXXXXXMNE 1411
            MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRS+ESEKLIKAANKTIIFVLNKIDLVPRDNLKAWI+CLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVA DNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKG              DWNSGKISYCSEPPAGIAGDSIDVELDESITLQP DGVNSISVLSGTNVMRTIVE EQLMEESDQDSDSGDSVDMNE
Sbjct:    1 MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSIESEKLIKAANKTIIFVLNKIDLVPRDNLKAWISCLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVAHDNHIVLIDSPGIILAQSNDPAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFMVAFASRMCPLKKG--------------DWNSGKISYCSEPPAGIAGDSIDVELDESITLQPIDGVNSISVLSGTNVMRTIVEGEQLMEESDQDSDSGDSVDMNE 390          
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Match: SMESG000026847.1 (SMESG000026847.1)

HSP 1 Score: 155.221 bits (391), Expect = 5.881e-41
Identity = 100/306 (32.68%), Postives = 158/306 (51.63%), Query Frame = 2
Query:  320 DKHEEMKAKMIKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTIIFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRPSNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTGKSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSND---PAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPE-FDTITEFMVAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPA 1225
            DK E         +S     ++ K+I+ SDV+  VLDAR+PMG RS + E  I+   K +IF+LNK+DL+P    + W   L+KE  TI F A+++                         G D L+  ++ +          K   ++ VGI G PNTGKSS+IN++K +++C+   +AG T+  Q+++L   I LID PG + ++ +D     +  LRN +RVEK+ED      A+     R  +  LYK+   +    EF+   A     L KGG P++   A +++KD+NSGK+++  +PP 
Sbjct:  175 DKDEATHGVFRAGTSNRIWQEVYKVIDSSDVLLYVLDARNPMGMRSAKIELDIRNKQKKLIFILNKVDLLPARVTRHWERELNKEYPTIMFYADMK----------------------HPLGKDRLVGLLRQIRDK------MKDRRQISVGIIGFPNTGKSSLINTLKGEKVCKVAPIAGETKVWQYISLMKSIDLIDCPGTVTSEKDDKLSETDLILRNSIRVEKVEDADRHIPALLQIVNREVVDKLYKINRPYSCSEEFLEMVARNRGRLLKGGQPDILTVAKEMLKDFNSGKLAWYVKPPT 452          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNL3L5.214e-5935.93G protein nucleolar 3 like [Source:HGNC Symbol;Acc... [more]
GNL3L5.214e-5935.93G protein nucleolar 3 like [Source:HGNC Symbol;Acc... [more]
GNL33.547e-5831.17G protein nucleolar 3 [Source:HGNC Symbol;Acc:HGNC... [more]
GNL34.114e-5630.84G protein nucleolar 3 [Source:HGNC Symbol;Acc:HGNC... [more]
GNL21.888e-4433.33G protein nucleolar 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nst-17.512e-8035.51Guanine nucleotide-binding protein-like 3 homolog ... [more]
nst-17.512e-8035.51Guanine nucleotide-binding protein-like 3 homolog ... [more]
ngp-11.009e-4331.07Nucleolar GTP-binding protein 2 [Source:UniProtKB... [more]
ngp-11.009e-4331.07Nucleolar GTP-binding protein 2 [Source:UniProtKB... [more]
ngp-11.009e-4331.07Nucleolar GTP-binding protein 2 [Source:UniProtKB... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ns12.631e-7435.27gene:FBgn0038473 transcript:FBtr0083426[more]
Ns22.087e-4533.22gene:FBgn0034243 transcript:FBtr0086906[more]
Ns34.197e-1523.21gene:FBgn0266284 transcript:FBtr0339578[more]
Ns34.197e-1523.21gene:FBgn0266284 transcript:FBtr0070297[more]
CG171412.625e-726.05gene:FBgn0039020 transcript:FBtr0084322[more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnl3l7.185e-6740.82guanine nucleotide binding protein-like 3 (nucleol... [more]
gnl3l7.724e-6740.82guanine nucleotide binding protein-like 3 (nucleol... [more]
gnl34.663e-6031.74guanine nucleotide binding protein-like 3 (nucleol... [more]
gnl21.074e-4834.67guanine nucleotide binding protein-like 2 (nucleol... [more]
gnl21.818e-1730.97guanine nucleotide binding protein-like 2 (nucleol... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rom11.656e-6640.20retinal outer segment membrane protein 1 [Source:X... [more]
rom11.827e-6639.94retinal outer segment membrane protein 1 [Source:X... [more]
rom11.969e-6639.94retinal outer segment membrane protein 1 [Source:X... [more]
rom12.121e-6639.94retinal outer segment membrane protein 1 [Source:X... [more]
rom12.511e-6639.94retinal outer segment membrane protein 1 [Source:X... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnl3l4.682e-5834.07guanine nucleotide binding protein-like 3 (nucleol... [more]
Gnl3l4.682e-5834.07guanine nucleotide binding protein-like 3 (nucleol... [more]
Gnl34.431e-5732.32guanine nucleotide binding protein-like 3 (nucleol... [more]
Gnl21.908e-4333.11guanine nucleotide binding protein-like 2 (nucleol... [more]
Gnl3l9.581e-1843.33guanine nucleotide binding protein-like 3 (nucleol... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q21086|GNL3_CAEEL9.555e-7935.51Guanine nucleotide-binding protein-like 3 homolog ... [more]
sp|Q54KS4|GNL3_DICDI1.681e-7435.71Guanine nucleotide-binding protein-like 3 homolog ... [more]
sp|Q8MT06|GNL3_DROME2.638e-7335.27Guanine nucleotide-binding protein-like 3 homolog ... [more]
sp|Q9M8Z5|NSN1_ARATH5.484e-7039.12Guanine nucleotide-binding protein-like NSN1 OS=Ar... [more]
sp|Q6DRP2|GNL3_DANRE3.557e-5931.74Guanine nucleotide-binding protein-like 3 OS=Danio... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YRQ12.263e-8938.59Guanine nucleotide-binding protein 3 protein OS=Fa... [more]
A0A4E0R0701.615e-8738.35Putative guanine nucleotide-binding protein 3 OS=F... [more]
G7YKT64.321e-8638.57Guanine nucleotide-binding protein-like 3-like pro... [more]
A0A183MWV78.746e-8536.25CP-type G domain-containing protein OS=Schistosoma... [more]
G4VDL02.848e-8435.89Putative gtp-binding protein-animal OS=Schistosoma... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnl3l8.658e-6941.28G protein nucleolar 3 like [Source:NCBI gene;Acc:1... [more]
gnl31.509e-5631.91G protein nucleolar 3 [Source:NCBI gene;Acc:103035... [more]
gnl26.577e-4634.24guanine nucleotide binding protein-like 2 (nucleol... [more]
gnl28.974e-4634.35guanine nucleotide binding protein-like 2 (nucleol... [more]
lsg11.193e-1025.59large 60S subunit nuclear export GTPase 1 [Source:... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gnl22.475e-4732.27guanine nucleotide binding protein-like 2 (nucleol... [more]
ENSPMAT00000001200.14.287e-1630.52pep scaffold:Pmarinus_7.0:GL478700:12557:17182:-1 ... [more]
lsg12.817e-1126.90large 60S subunit nuclear export GTPase 1 [Source:... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NOG24.537e-4433.33Putative GTPase; associates with pre-60S ribosomal... [more]
NUG11.193e-3833.01GTPase that associates with nuclear 60S pre-riboso... [more]
LSG14.357e-1721.73Putative GTPase involved in 60S ribosomal subunit ... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468824.099e-7135.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310271.024e-5737.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413417.927e-4632.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409841.917e-1123.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388772.798e-921.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnl3l1.095e-7040.75guanine nucleotide-binding protein-like 3-like pro... [more]
gnl35.399e-6935.62G protein nucleolar 3 [Source:NCBI gene;Acc:101160... [more]
gnl31.544e-6835.62G protein nucleolar 3 [Source:NCBI gene;Acc:101160... [more]
gnl29.256e-5034.30G protein nucleolar 2 [Source:NCBI gene;Acc:101173... [more]
gnl21.813e-4934.63G protein nucleolar 2 [Source:NCBI gene;Acc:101173... [more]
back to top
BLAST of Guanine nucleotide-binding protein 3 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075369.10.000e+098.68SMESG000075369.1[more]
SMESG000075369.10.000e+098.53SMESG000075369.1[more]
SMESG000075369.10.000e+098.51SMESG000075369.1[more]
SMESG000075369.10.000e+095.30SMESG000075369.1[more]
SMESG000026847.15.881e-4132.68SMESG000026847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030518 ID=SMED30030518|Name=Guanine nucleotide-binding protein 3 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1447bp
GTTTGTTTAAATATTACAATATTTAGAATCTTATAAGCATAGCGTGACAA
TGGTTTCATTAAGTAAAAGAAATAAGCGTACTTCTCTTCATCAAAAATAT
AAAGTTGCCAAAAAGGTTAAACAACATCATAGAGATGTTAAAAAATCTCT
GAAAAATAAAAAATCTAAAAAGCCACTACCTTTATCTATGCAAATTCCAA
TGGAATGTCCGTTTAAGGATCAAGTAATTAAAGAAGTAACCCAATCTTCA
TTGATGGAAAAAGATGCAGAAAAGAAACGGTTATTGGCCATGAGAATTTT
AAGAAAATCTAAGCCTGTCGATAAACATGAAGAAATGAAAGCTAAAATGA
TTAAAGACAGTTCAAGAGCATTTATTGGTGACATCCGAAAATTAATCGAA
GAATCAGATGTTATTTGCATGGTTCTAGACGCCCGTGATCCAATGGGAAC
GAGATCATTAGAATCGGAAAAATTAATTAAAGCTGCTAACAAAACAATTA
TATTTGTTTTGAATAAAATTGATCTCGTCCCAAGAGATAATCTGAAAGCA
TGGATAGCTTGTTTAAGCAAGGAAGCGCGAACAATCGCATTCAAAGCAAA
TGTTCAAGACCAAGCACTTAGACTGGGATCAAGTAACGGTTCTCGGCCGT
CGAATGAGAAAAATTCAACGTGCGCATCATATGGAGTTGATAATTTGATA
AATTATATCAAATCATTGAACAAAAATACACCTGGAGCTGCTGGAACAAA
ATCAGCTGATAAATTAATAGTTGGAATCGCTGGGGTGCCTAATACAGGAA
AATCATCGGTAATAAATAGTATCAAACGCAAACGGATTTGCGAAGCTGGC
AATTTAGCGGGGTTGACAAGAAATCTCCAACACGTTGCACTCGATAATCA
CATCGTATTGATTGATTCACCTGGAATTATTCTCGCCCAATCTAACGATC
CAGCTGAATATGCACTGCGAAATTGTTTGCGAGTTGAAAAAATTGAAGAT
CCCGTTGCTGTTGCCGAGGCCATTTACAATCGTTGCCAGCGTATCCAGCT
GCAAGTATTATACAAGTTACCAGAGTTTGACACTATCACTGAATTCATGG
TTGCTTTTGCATCGCGAATGTGTCCATTGAAGAAGGGAGGTGTACCAAAT
TTAAAATTAGCAGCGATTAAATTGATCAAAGATTGGAATAGTGGTAAAAT
TTCTTATTGCAGTGAGCCACCAGCTGGTATTGCTGGTGATTCAATTGATG
TGGAATTAGACGAATCTATTACTTTGCAGCCTACTGATGGTGTAAATTCG
ATTTCGGTGTTATCCGGAACAAACGTTATGCGAACTATAGTAGAAGAGGA
ACAGTTGATGGAAGAATCAGACCAGGATTCAGATAGTGGCGATTCGGTGG
ACATGAATGAATAATTTTTATCAATATAATTATCTCTTCTAAAAAAA
back to top

protein sequence of SMED30030518-orf-1

>SMED30030518-orf-1 ID=SMED30030518-orf-1|Name=SMED30030518-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MVSLSKRNKRTSLHQKYKVAKKVKQHHRDVKKSLKNKKSKKPLPLSMQIP
MECPFKDQVIKEVTQSSLMEKDAEKKRLLAMRILRKSKPVDKHEEMKAKM
IKDSSRAFIGDIRKLIEESDVICMVLDARDPMGTRSLESEKLIKAANKTI
IFVLNKIDLVPRDNLKAWIACLSKEARTIAFKANVQDQALRLGSSNGSRP
SNEKNSTCASYGVDNLINYIKSLNKNTPGAAGTKSADKLIVGIAGVPNTG
KSSVINSIKRKRICEAGNLAGLTRNLQHVALDNHIVLIDSPGIILAQSND
PAEYALRNCLRVEKIEDPVAVAEAIYNRCQRIQLQVLYKLPEFDTITEFM
VAFASRMCPLKKGGVPNLKLAAIKLIKDWNSGKISYCSEPPAGIAGDSID
VELDESITLQPTDGVNSISVLSGTNVMRTIVEEEQLMEESDQDSDSGDSV
DMNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR023179GTP-bd_ortho_bundle_sf
IPR030378G_CP_dom
IPR006073GTP_binding_domain
IPR014813Gnl3_N_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006073GTP binding domainPRINTSPR00326GTP1OBGcoord: 287..302
score: 28.77
coord: 241..261
score: 39.57
IPR006073GTP binding domainPFAMPF01926MMR_HSR1coord: 241..297
e-value: 2.4E-11
score: 43.7
IPR023179GTP-binding protein, orthogonal bundle domain superfamilyGENE3DG3DSA:1.10.1580.10coord: 302..384
e-value: 2.1E-6
score: 29.8
IPR014813Guanine nucleotide-binding protein-like 3, N-terminal domainPFAMPF08701GN3L_Grn1coord: 14..78
e-value: 1.8E-9
score: 37.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 110..296
e-value: 8.2E-37
score: 128.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 435..454
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 436..454
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..39
NoneNo IPR availablePANTHERPTHR11089:SF30GUANINE NUCLEOTIDE-BINDING PROTEIN-LIKE 3 HOMOLOGcoord: 2..394
NoneNo IPR availablePANTHERPTHR11089GTP-BINDING PROTEIN-RELATEDcoord: 2..394
IPR030378Circularly permuted (CP)-type guanine nucleotide-binding (G) domainPROSITEPS51721G_CPcoord: 109..296
score: 30.187
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 107..301