N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase

Overview
NameN-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Smed IDSMED30030514
Length (bp)1427
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (SMED30030514) t-SNE clustered cells

Violin plots show distribution of expression levels for N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (SMED30030514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (SMED30030514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (SMED30030514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30030514SMESG000080267.1 dd_Smed_v4_6566_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 234.572 bits (597), Expect = 5.555e-71
Identity = 129/272 (47.43%), Postives = 170/272 (62.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCVRAQCPSQCPPLTH----CVYGFCE 1059
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV    P   PP  H    CV G C+
Sbjct:   79 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHE--PRCQPPDCHGHGTCVDGHCQ 346          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 233.802 bits (595), Expect = 2.112e-70
Identity = 129/272 (47.43%), Postives = 170/272 (62.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCVRAQCPSQCPPLTH----CVYGFCE 1059
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV    P   PP  H    CV G C+
Sbjct:   79 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHE--PRCQPPDCHGHGTCVDGHCQ 346          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 214.157 bits (544), Expect = 3.600e-65
Identity = 112/229 (48.91%), Postives = 150/229 (65.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSD 948
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD
Sbjct:   79 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSD 305          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 214.157 bits (544), Expect = 3.600e-65
Identity = 112/229 (48.91%), Postives = 150/229 (65.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSD 948
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD
Sbjct:   79 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSD 305          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 213.772 bits (543), Expect = 6.368e-65
Identity = 112/229 (48.91%), Postives = 150/229 (65.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSD 948
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD
Sbjct:   19 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSD 245          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Zebrafish
Match: nagpa (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-070928-4])

HSP 1 Score: 238.039 bits (606), Expect = 2.902e-71
Identity = 141/375 (37.60%), Postives = 203/375 (54.13%), Query Frame = 1
Query:    1 NLFTFNITKLILLQFLY*FLNIFKTF*SC------------NTDI*STILIYFPMHXXXXXXXXXXXXXXXXHQSCVPYQKKLNNSNELISSFSNASGVISKTFVKD-----SNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDAC--SFFTCERPVSTVLCVRAQC--PSQCPPLTHCVYGFC 1056
            NLF  N+  + L+   + + ++F  F +C            ++     +L Y   H       +       +H +       + +  +  S  SN+  + S  F+ D          + G +  V++PL ++SVL+P     GC  H      E   K   C VA N G+F+T T +C+GN+I+DG L RNSGGI+NA FGI+KDG L FGYLS +++    + F  L+ GV+WL+R G   + ESI  EC+K+QETG+   F +V+SARTAVG    G L+L HV+G+T   G+NL+  AK L+   V++AINLDGGGSAT V+N +L SYPSD C  S + C R +STVLC+  +   P  C     CV G C
Sbjct:    8 NLFHLNVLYICLMAKCFVYFDLFFLFLACLGVCLCQCKDIRHSSDDDLLLPYTKSHGPSHSHRYVRDCQPVAHGT-------VTHETQAASKHSNSPVLESNIFISDITDDSGTHRWVSGHITEVHDPLRSVSVLEPGGPG-GCA-HNHRELVEVTAKTRKCLVAQNGGYFDTHTGQCLGNIISDGKLVRNSGGIQNAQFGIRKDGTLVFGYLSEDDILDQENPFVQLISGVVWLLRKGEIYINESIQAECDKTQETGNFRHFVDVISARTAVGHDKEGKLILFHVDGQTDVRGMNLWQVAKFLKDQNVMNAINLDGGGSATYVLNGSLASYPSDHCNPSKWRCPRAISTVLCIHERLCQPEDCSGHGRCVEGQC 373          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Xenopus
Match: msra.1 (methionine sulfoxide reductase A, gene 1 [Source:Xenbase;Acc:XB-GENE-1011250])

HSP 1 Score: 232.646 bits (592), Expect = 3.124e-69
Identity = 124/260 (47.69%), Postives = 171/260 (65.77%), Query Frame = 1
Query:  301 IYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF---FTCERPVSTVLCVRAQ-C-PSQCPPLTHCVYGFCE 1059
            +YG    ++NPL + SVL+P     GC K+ T  T E  IK GNC VA N G+F+  T  CIGN+++D  L +++ GI+NA FGIK DG L FGYLS E+V  ++  F  L+ GV+WL+RNG+  + +S A EC+K+Q TG  + F NV+SARTAVG   +G L+L HV+G+T   G+NL++ A  L+   V++A+NLDGGGSAT+VIN TL +YPSD C++   + C R +STV+CV    C P  C     CV G C+
Sbjct:  109 VYGHFTFISNPLRSFSVLEPGGPG-GCSKNLT-ATVEETIKYGNCIVAQNGGYFSMDTGSCIGNIVSDRKLVQSAKGIQNAQFGIKADGTLIFGYLSEEQVLETENPFVQLLSGVVWLLRNGTVYINQSKAAECDKTQTTGDFDHFINVISARTAVGHDRDGRLILFHVDGQTEDRGLNLWEVANFLKDQGVINAVNLDGGGSATLVINGTLSNYPSDHCTYDPMWRCPRSISTVVCVHEPFCDPPDCSGHGQCVLGECQ 366          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Mouse
Match: Nagpa (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:MGI Symbol;Acc:MGI:1351598])

HSP 1 Score: 242.662 bits (618), Expect = 7.958e-74
Identity = 132/275 (48.00%), Postives = 176/275 (64.00%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSS--DFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCV---RAQCPSQCPPLTHCVYGFCEPMSN 1071
            +TFV    G  + G +  V +PL T SVL+P     GC +       +TA+ AG C +A N GFF   T EC+GN+++DG L  +SGG++NA FGI++DG +  GYLS EEV      F  L+ GV+WL+RNG+  + ES A EC+++QETGS + F NV+SARTAVG    G L+L H +G+T + G+NL++ A+ L+Q +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV   R Q P  C     CV G CE  S+
Sbjct:   80 RTFVSHFEGRAVAGHLTRVADPLRTFSVLEPGGAG-GCAQKRRATVEDTAVPAG-CRIAQNGGFFRMSTGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTIVTGYLSEEEVLDPVNPFVQLLSGVVWLIRNGNIYINESQAIECDETQETGSFSKFVNVMSARTAVGHDREGQLILFHADGQTEQRGLNLWEMAEFLRQQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQ-PPDCSGHGTCVDGHCECTSH 351          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Mouse
Match: Nagpa (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:MGI Symbol;Acc:MGI:1351598])

HSP 1 Score: 201.83 bits (512), Expect = 6.585e-60
Identity = 107/207 (51.69%), Postives = 143/207 (69.08%), Query Frame = 1
Query:  472 TKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNS--SDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCV---RAQCPSQCPPLTHCVYGFCEPMSN 1071
            T EC+GN+++DG L  +SGG++NA FGI++DG +  GYLS EEV    + F  L+ GV+WL+RNG+  + ES A EC+++QETGS + F NV+SARTAVG    G L+L H +G+T + G+NL++ A+ L+Q +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV   R Q P  C     CV G CE  S+
Sbjct:    3 TGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTIVTGYLSEEEVLDPVNPFVQLLSGVVWLIRNGNIYINESQAIECDETQETGSFSKFVNVMSARTAVGHDREGQLILFHADGQTEQRGLNLWEMAEFLRQQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQ-PPDCSGHGTCVDGHCECTSH 208          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. UniProt/SwissProt
Match: sp|Q8BJ48|NAGPA_MOUSE (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Nagpa PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 5.567e-73
Identity = 132/275 (48.00%), Postives = 176/275 (64.00%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSS--DFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCV---RAQCPSQCPPLTHCVYGFCEPMSN 1071
            +TFV    G  + G +  V +PL T SVL+P     GC +       +TA+ AG C +A N GFF   T EC+GN+++DG L  +SGG++NA FGI++DG +  GYLS EEV      F  L+ GV+WL+RNG+  + ES A EC+++QETGS + F NV+SARTAVG    G L+L H +G+T + G+NL++ A+ L+Q +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV   R Q P  C     CV G CE  S+
Sbjct:   80 RTFVSHFEGRAVAGHLTRVADPLRTFSVLEPGGAG-GCAQKRRATVEDTAVPAG-CRIAQNGGFFRMSTGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTIVTGYLSEEEVLDPVNPFVQLLSGVVWLIRNGNIYINESQAIECDETQETGSFSKFVNVMSARTAVGHDREGQLILFHADGQTEQRGLNLWEMAEFLRQQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHEPRCQ-PPDCSGHGTCVDGHCECTSH 351          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. UniProt/SwissProt
Match: sp|Q9UK23|NAGPA_HUMAN (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGPA PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.014e-69
Identity = 129/272 (47.43%), Postives = 170/272 (62.50%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCVRAQCPSQCPPLTH----CVYGFCE 1059
            +TFV       + G +     PL T SVL+P     GC         ETA +A +C VA N GFF   + EC+GN+++D     +SGG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES ATEC+++QETGS + F NV+SARTA+G    G LVL H +G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV    P   PP  H    CV G C+
Sbjct:   79 RTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPG-GCAARRRATVEETA-RAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVVCVHE--PRCQPPDCHGHGTCVDGHCQ 346          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. UniProt/SwissProt
Match: sp|P68827|NAGPA_BOVIN (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Bos taurus OX=9913 GN=NAGPA PE=1 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 6.961e-69
Identity = 130/271 (47.97%), Postives = 170/271 (62.73%), Query Frame = 1
Query:  268 KTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCV---RAQCPSQCPPLTHCVYGFCE 1059
            +TFV       + G +     PL T SVL+P     GC         ETA  +G C VA N GFF  +T EC+GN+++ G    ++GG++NA FGI++DG L  GYLS EEV  ++  F  L+ GV+WL+RNGS  + ES A EC ++QETGS N F NV+SARTAVG    G LVL+HV+G+T + GINL++ A+ L + +VV+AINLDGGGSAT V+N TL SYPSD C    + C R VSTV+CV   R Q P  C     C+ G C+
Sbjct:   80 RTFVSYFADRAVPGHLTRAPEPLRTFSVLEPGGPG-GCASKRRATVEETARPSG-CTVAQNGGFFRMETGECLGNVVSGGRRVSSAGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQAAECEETQETGSFNRFVNVISARTAVGHDRKGQLVLLHVDGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRRVSTVVCVHEPRCQ-PPDCSGHGTCMEGRCQ 347          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Match: C3ZBT6 (NAGPA domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_166361 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.286e-76
Identity = 137/259 (52.90%), Postives = 174/259 (67.18%), Query Frame = 1
Query:  304 YGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSD--FKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS---FFTCERPVSTVLCVRA-QC-PSQCPPLTHCVYGFCE 1059
            YG   ++NNPL T SV++P   N GC +H   RT E   +A  C VA+NAGFFNT T  C+GNL+ DG   ++SGGI+NANFGI+KDG +  GYLS  +V   D  F  LV GVIWLVRNGS  V ES  TEC   QETG L+ F NVVSARTAVG    G +VLVH++G+T   G+NL++FA  LQ++ +V+AINLDGGGSAT+V+N ++ +YPSD C+    + C R VST LCV +  C P+ C     CV G C+
Sbjct:   67 YGHYTVINNPLRTFSVVEPGGSN-GCIEHRR-RTVENTSQARTCHVAVNAGFFNTHTGACLGNLVTDGKRIQDSGGIQNANFGIRKDGTIVVGYLSELDVLREDNPFVQLVTGVIWLVRNGSVYVNESRTTECADMQETGDLDRFVNVVSARTAVGHDEEGRVVLVHIDGQTGDRGVNLWEFADYLQRLGLVNAINLDGGGSATVVLNGSVANYPSDHCADNPAWRCARAVSTALCVHSLDCEPANCSGHGECVEGQCQ 323          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Match: A0A091URG3 (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (Fragment) OS=Nipponia nippon OX=128390 GN=Y956_05297 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 5.397e-74
Identity = 140/305 (45.90%), Postives = 192/305 (62.95%), Query Frame = 1
Query:  184 QSCVPYQKKLNNSNELISSFSNASGVI--SKTFV-----KDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF---FTCERPVSTVLCVR--AQCPSQCPPLTHCVYGFC 1056
            + C P  K  N ++E   S +   G +  ++TFV     +  +   +YG    V NPL T SVL+P     GC+ +      ETA K GNC VA N G+F+ +T EC+GN+++DG L RNSGG++NA FGI+KDG + FGYLS E+V   ++ F  LV GV+WL+R+G   + +S   EC + Q TG+ N F NV+SARTAVG    G LVLVHV+G+T   G+NL++ A+ L+Q  +++AINLDGGGSAT+V+N TL SYPS+ CSF   + C R +ST+LCV   A  P+ C     CV G C
Sbjct:   24 RDCQP-TKYGNVTHEAWPSDNRTDGPVATTRTFVSYIPLEGKDHKAVYGHFTFVRNPLRTFSVLEPGGAG-GCQAYRRAPVEETA-KLGNCLVAQNGGYFDMETGECLGNVVSDGKLVRNSGGLQNAQFGIRKDGTMVFGYLSEEDVLDQANPFVQLVSGVVWLLRDGEVYISQSQMAECGEIQTTGTFNKFINVISARTAVGHDSQGQLVLVHVDGQTESRGVNLWEMAEFLKQQGIINAINLDGGGSATLVLNGTLASYPSEHCSFDNMWRCPRSISTILCVHEPACQPADCSGHGDCVRGEC 325          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Match: A0A093CFX1 (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (Fragment) OS=Tauraco erythrolophus OX=121530 GN=N340_06230 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.245e-73
Identity = 129/260 (49.62%), Postives = 171/260 (65.77%), Query Frame = 1
Query:  298 LIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF---FTCERPVSTVLCVRAQC--PSQCPPLTHCVYGFC 1056
            ++YG    V NPL T SVL+P     GC+ H      ETA K G C VA N G+FN +T EC GN+++DG L RNSGG++NA FGI++DG + FGYLS E+V    + F  LV GV+WL+R+G   + +S   EC ++Q TG+ N F NVVSARTAVG    G LVLVH++G+T   G+NL++ A+ L+Q  V++AINLDGGGSAT+V+N TL SYPS+ CSF   + C R +STV+C+      P+ C     CV G C
Sbjct:   64 VVYGHFTFVRNPLRTFSVLEPGGTG-GCQAHRRATVEETA-KLGKCLVAQNGGYFNMETGECYGNVVSDGRLVRNSGGLQNAQFGIRRDGTMVFGYLSEEDVLDQVNPFVQLVSGVVWLLRDGEVYISQSQVAECGETQTTGTFNKFINVVSARTAVGHDRRGQLVLVHMDGQTESRGVNLWEMAEFLKQQGVINAINLDGGGSATLVLNGTLASYPSEHCSFDSMWRCPRSISTVMCIHEPTCEPADCSGHGACVEGEC 321          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Match: A0A3Q3BNF8 (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.614e-73
Identity = 138/275 (50.18%), Postives = 187/275 (68.00%), Query Frame = 1
Query:  265 SKTFVKD----SNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDAC--SFFTCERPVSTVLCV---RAQCPSQCPPLTHCVYGFC 1056
            S+ FV D    + G  +YG + +V++PL T+SVL+P   + GC  +      ETA KA  C  A NAGFFNT++ EC+GN++++G L ++SGG++NA FGI+KDG L FGYLS EEV   S+ F  LV GVIWL+RNG   ++ S+  ECNK+QETGSL  FA+VVSARTAVG   +G L+L  ++G+T   G+NL++ A+ L+   V++AINLDGGGS+T V+N +L SYPSD+C  S + C R +STVLCV   R Q P+ C     CV G C
Sbjct:   81 SRVFVTDVEDRNGGRSVYGHMTVVHDPLRTVSVLEPGGPD-GCSMNHKVSVEETA-KAAGCLYAQNAGFFNTKSSECLGNVVSNGRLVQDSGGLQNAQFGIRKDGTLVFGYLSQEEVLDQSNPFVQLVSGVIWLLRNGDIYIKHSLEAECNKTQETGSLQYFADVVSARTAVGHDADGKLILFQIDGQTRARGMNLWELAEFLKNNGVINAINLDGGGSSTYVVNGSLASYPSDSCSDSRWRCSRNISTVLCVHERRCQ-PANCSGHGECVNGNC 352          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Match: A0A093QZ04 (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (Fragment) OS=Phalacrocorax carbo OX=9209 GN=N336_01212 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 3.709e-73
Identity = 128/260 (49.23%), Postives = 171/260 (65.77%), Query Frame = 1
Query:  298 LIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF---FTCERPVSTVLCVRAQC--PSQCPPLTHCVYGFC 1056
            ++YG    V NPL T SVL+P     GC+ H      ETA K G C VA N G+F+  T EC+GN+++DG L RNSGG++NA FGI+KDG + FGYLS E+V   ++ F  LV GVIWL+R+G   + +S   EC + Q TG+ N F NV+SARTAVG    G LVLVHV+G+T   G+NL++ A+ L+Q  +++AINLDGGGSAT+V+N TL SYPS+ CSF   + C R +ST++C+      P+ C     CV G C
Sbjct:   64 VVYGHFTFVRNPLRTFSVLEPGGAG-GCQAHRRTPVEETA-KLGKCLVAQNGGYFDMGTGECLGNIVSDGKLVRNSGGLQNAQFGIRKDGTMVFGYLSEEDVLDQTNPFVQLVSGVIWLLRDGEVYIGQSQMAECGEIQTTGTFNKFINVISARTAVGHDSQGQLVLVHVDGQTESRGVNLWEMAEFLKQQGIINAINLDGGGSATLVLNGTLASYPSEHCSFDNMWRCPRSISTIMCIHEPACEPADCSGHGDCVQGEC 321          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Cavefish
Match: nagpa (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:NCBI gene;Acc:103029606])

HSP 1 Score: 234.187 bits (596), Expect = 5.071e-70
Identity = 131/303 (43.23%), Postives = 187/303 (61.72%), Query Frame = 1
Query:  184 QSCVP-YQKKLNNSNELISSFSNASGVISKTFVKDSNGI-----LIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS--FFTCERPVSTVLCVRAQC--PSQCPPLTHCVYGFC 1056
            + C P +   L +  +  S+ S +  V SKTFV +          + G + +V++PL T+SVL+P     GC+K +      TA +   C VA N G+F+T +  C+GN+++DG L +NSGG++NA FGI+KDG L FGYLS +EV    + F  LV GV+WL+R     + ESI  EC+++QETG    F NVVSARTAVG    G L+L HV+GKT + G++L++ A  L++ +VV+AINLDGGGSAT ++N +L ++PSD+C+   + C R VST+LCV      P  C     CV G C
Sbjct:   54 RDCQPVHHGSLTHETKQASNHSGSPVVESKTFVSNITSSSNTSKWVSGHITVVHDPLRTVSVLEPGGPG-GCEKSDRELVENTA-RTRKCLVAQNGGYFHTHSGLCLGNIVSDGRLVQNSGGLQNAQFGIRKDGTLVFGYLSEDEVLDEINPFVQLVSGVVWLLRASKVYINESIQAECDETQETGRFQRFVNVVSARTAVGHDSKGRLILFHVDGKTDQRGMDLWEVADFLKKHDVVNAINLDGGGSATYILNGSLANFPSDSCAEKMWQCPRAVSTILCVHEPLCQPEDCSQHGDCVDGQC 354          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Sea Lamprey
Match: NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:17378])

HSP 1 Score: 226.483 bits (576), Expect = 1.289e-69
Identity = 126/287 (43.90%), Postives = 170/287 (59.23%), Query Frame = 1
Query:  244 SNASGVISKTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYL----------SSEEVNSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACS---FFTCERPVSTVLCVR--AQCPSQCPPLTHCVYGFCE 1059
            ++  GVI+  FV D     +YG   +V +P  T+SVL+P  D  GC  +      ETA +   C V+ NAGFF   T  C+GN+++DG     + G+RNANFGI++DG +  GYL            +    S +  LV GV+WL+RNGS  + ES A EC  +QETG+ + F +VVSARTAVG    G +VLV ++G+T   G+NL++FA  LQ   V++A+NLDGGGSAT+V+N TL +YPSD C+    + C R VSTVLCV   A  P  C     CV G C 
Sbjct:   51 AHGHGVITHQFVSDIKTSFVYGHWTVVEDPARTLSVLEPGGDG-GCSDYRRETVAETA-ETRRCLVSANAGFFRPYTGRCLGNIVSDGRSVLGANGVRNANFGIRRDGTIVTGYLLDDEAEEEEEEQDGAEQSPWLQLVSGVVWLLRNGSIYINESRAVECGDTQETGTFDRFISVVSARTAVGHDREGRVVLVQIDGQTDARGVNLWEFAAFLQAHGVMNAVNLDGGGSATLVLNGTLANYPSDHCAEDPMWRCARRVSTVLCVHEPACAPPGCGEHGECVAGLCR 335          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Nematostella
Match: EDO37057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGY0])

HSP 1 Score: 218.009 bits (554), Expect = 7.042e-66
Identity = 116/246 (47.15%), Postives = 160/246 (65.04%), Query Frame = 1
Query:  301 IYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSFFTCERPVSTVLCVRAQCPSQCPPL 1032
            ++G V +  NPL T S+L+P  +N GC K       E++ +   C VA NAG+F T+   C+GN++++G L  ++ GI+N NFGI+KDG +  GYLS E V    + F  LV GV+WLVRNG + V+ S   EC   +ETG+++ F NV+SARTA+G    G +V+VHV+G+T   G+NL+ FAKLL +  +V+AINLDGGGS TMV+N T+V+YPSD C  F C R VST+ C        C PL
Sbjct:   66 VHGHVSVAENPLRTFSILEPV-ENGGCNKSLRATVAESS-RQRKCYVASNAGYFRTKNGNCLGNIVSNGNLVIDADGIQNVNFGIRKDGSIVTGYLSEEMVLDQENPFVQLVTGVVWLVRNGQTYVDVSKKAECEDLEETGTVDQFVNVLSARTAIGHDAQGRVVIVHVDGRTSHRGMNLYTFAKLLLKYGLVNAINLDGGGSTTMVVNGTVVNYPSDGCGDFICAREVSTIACFHT---PDCDPL 306          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Nematostella
Match: EDO37056 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGX9])

HSP 1 Score: 150.984 bits (380), Expect = 9.101e-41
Identity = 100/273 (36.63%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  274 FVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINL---FDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF------FTCERPVSTVLCVRAQCPSQCPPLTHCVYGFCE 1059
            F   S    + G V +V NPL+T S+L+P  +  GC K     +   + +   C VA NAGFF T+   C+GN++++G L  ++ G++NANFGI+KDG +  GYLS   V    + F  LV GVIWLVRNG   V  S   EC   QE+GS++ F NV++ARTA+G    G +V+V V+GKT++ G  L   F+ + +     + +   +    + + + NR+ +S PS           F C R VST+ C  A     C PL     G C+
Sbjct:   56 FEDGSRKADVQGHVSVVENPLNTFSILEPG-EVGGCGK-SVRSSVANSSRQKKCHVASNAGFFKTKNGNCLGNIVSNGKLVMDADGVQNANFGIRKDGTIVTGYLSENTVLDQENPFVQLVTGVIWLVRNGEVYVNASKKAECEDLQESGSVDLFVNVLAARTAIGHDAQGRVVIVQVDGKTLQRGCVLSIRFNPSPISNPSPISNPSPIS---NPSPISNRSPISNPSPISILESLHGDFICAREVSTIACFHA---PDCDPLDCNGRGTCQ 320          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Medaka
Match: nagpa (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [Source:NCBI gene;Acc:101159945])

HSP 1 Score: 243.432 bits (620), Expect = 1.578e-73
Identity = 130/271 (47.97%), Postives = 181/271 (66.79%), Query Frame = 1
Query:  265 SKTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEV--NSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSF---FTCERPVSTVLCVRAQC--PSQCPPLTHCVYGFC 1056
            S  FV  +    +YGR+ +V++PL T+SVL+P   + GCK +      ETA KA  C  A NAGFFNT++ +C+GN++++G L ++SGG++NA FGI++DG L FGYLS E+V   S+ F  LV GVIWL+R+    + +S+  EC KSQETG+L+ F NVVSARTAVG   +G+++L  ++G+T   G+NL+D A  L++  VV+AINLDGGGS+T VIN +L SYPSD C+    + C R VST+ CV  +   P  C     CV G C
Sbjct:   82 SNVFVTKAPSGWVYGRLTVVHDPLQTLSVLEPGGPD-GCKNNHRVSVEETA-KAAGCLYAQNAGFFNTKSGQCLGNVVSNGRLVQDSGGVQNAQFGIRRDGSLIFGYLSQEDVLDQSNPFVQLVSGVIWLLRDSEIYINQSLEAECGKSQETGNLSYFVNVVSARTAVGHDGDGNIILFQIDGQTGNRGMNLWDVATFLKEQGVVNAINLDGGGSSTCVINGSLASYPSDHCTSDNRWRCGRDVSTIFCVHQKSCKPENCSGHGECVDGLC 350          
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Planmine SMEST
Match: SMESG000080267.1 (SMESG000080267.1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 373/375 (99.47%), Postives = 374/375 (99.73%), Query Frame = 1
Query:  181 HQSCVPYQKKLNNSNELISSFSNASGVISKTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNDFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSFFTCERPVSTVLCVRAQCPSQCPPLTHCVYGFCEPMSNRNPFSVFMYXXXXXXXXXXXXXXXXXXFAVRWIVRQRNQSKISKWARNEDRLVLYENDDFVHFDSQPLMNDIDYIQEL 1305
            HQSCVPYQKKLNNSNELISSFSNASGVISKTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSDF VLVGGVIWLVRNGSSVVEESIATECNKSQETGSLN+FANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSFFTCERPVSTVLCVRAQCPSQCPPLTHCVYGFCEPMSNRNPFSVFMYVSIALLVVGVLILLINVLFAVRWIVRQRNQSKISKWARNEDRLVLYENDDFVHFDSQPLMNDIDYIQEL
Sbjct:   19 HQSCVPYQKKLNNSNELISSFSNASGVISKTFVKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKAGNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLFFGYLSSEEVNSSDFNVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLNNFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVSAINLDGGGSATMVINRTLVSYPSDACSFFTCERPVSTVLCVRAQCPSQCPPLTHCVYGFCEPMSNRNPFSVFMYVSIALLVVGVLILLINVLFAVRWIVRQRNQSKISKWARNEDRLVLYENDDFVHFDSQPLMNDIDYIQEL 393          
The following BLAST results are available for this feature:
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAGPA5.555e-7147.43N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
NAGPA2.112e-7047.43N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
NAGPA3.600e-6548.91N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
NAGPA3.600e-6548.91N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
NAGPA6.368e-6548.91N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nagpa2.902e-7137.60N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
msra.13.124e-6947.69methionine sulfoxide reductase A, gene 1 [Source:X... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nagpa7.958e-7448.00N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
Nagpa6.585e-6051.69N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8BJ48|NAGPA_MOUSE5.567e-7348.00N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
sp|Q9UK23|NAGPA_HUMAN1.014e-6947.43N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
sp|P68827|NAGPA_BOVIN6.961e-6947.97N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3ZBT61.286e-7652.90NAGPA domain-containing protein (Fragment) OS=Bran... [more]
A0A091URG35.397e-7445.90N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
A0A093CFX12.245e-7349.62N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
A0A3Q3BNF83.614e-7350.18N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
A0A093QZ043.709e-7349.23N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nagpa5.071e-7043.23N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NAGPA1.289e-6943.90N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO370577.042e-6647.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370569.101e-4136.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nagpa1.578e-7347.97N-acetylglucosamine-1-phosphodiester alpha-N-acety... [more]
back to top
BLAST of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080267.10.000e+099.47SMESG000080267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030514 ID=SMED30030514|Name=N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1427bp
AATTTATTTACTTTTAATATTACTAAATTAATATTACTCCAGTTTTTATA
TTAGTTTTTAAACATTTTTAAAACTTTTTAAAGCTGTAACACAGATATTT
AATCCACAATTTTAATTTACTTTCCTATGCACTTTGAATATATATTTTCA
TTATTTTATTTAATTTTAATTATTGAATCTCATCAAAGTTGTGTTCCCTA
CCAGAAAAAACTTAACAATTCTAATGAATTAATCAGCAGTTTTTCTAATG
CAAGCGGTGTAATTTCGAAAACTTTTGTTAAGGATAGTAATGGAATTCTA
ATTTACGGAAGAGTTGTAATAGTAAACAATCCCTTATCAACTATTAGTGT
GTTGCAACCAAATAATGATAATCAGGGTTGCAAAAAACATGAAACCTATC
GTACAACAGAAACGGCTATTAAAGCTGGCAACTGTGAAGTAGCTATAAAT
GCTGGATTTTTTAACACTCAAACCAAGGAATGCATTGGCAATTTAATCAA
TGACGGAATTTTGTATCGTAATTCAGGAGGGATTCGAAATGCCAATTTTG
GCATTAAAAAAGATGGAAAATTATTTTTCGGTTACCTGAGCAGTGAAGAA
GTGAATTCATCTGATTTTAAAGTGCTGGTCGGAGGAGTGATTTGGCTGGT
TCGCAATGGCAGCTCGGTCGTTGAAGAAAGCATTGCAACGGAATGCAATA
AATCTCAGGAAACGGGCTCTCTCAACGATTTTGCCAATGTCGTAAGTGCC
CGAACGGCTGTAGGCGCGTTTATAAACGGTAGCTTAGTGTTAGTGCATGT
CGAAGGGAAAACAGTGAAAGGAGGCATAAATCTATTTGATTTCGCAAAGC
TTCTCCAACAAATGGAAGTCGTATCTGCCATCAATCTCGACGGTGGCGGT
TCAGCCACTATGGTTATCAATCGCACTCTTGTCAGCTATCCGTCTGATGC
ATGCAGCTTTTTCACTTGTGAGCGACCCGTGTCCACCGTCTTGTGCGTCC
GAGCTCAATGCCCCTCTCAGTGTCCTCCTTTGACTCATTGCGTTTATGGA
TTTTGTGAACCCATGTCAAATAGGAATCCGTTTTCTGTATTTATGTACGT
TTCTATAGCTTTGCTCGTTGTTGGTGTGTTAATATTACTAATAAACGTCC
TTTTCGCCGTCCGGTGGATAGTTAGACAGCGTAATCAGTCCAAAATTAGT
AAATGGGCCCGCAACGAAGACCGCCTCGTGTTGTATGAAAACGATGATTT
CGTACATTTCGATTCTCAGCCTCTAATGAACGACATTGATTATATTCAAG
AATTATGATCCTGATTTATTTTGTGGTTTATTTTCTATTTGCTCAATATC
GGATTCTTTTTCACAAAATTTTTTTAATTTTTGTTGTGATTGATAGTTGC
ATTTTAAATAAATGATTTATAAAAAAA
back to top

protein sequence of SMED30030514-orf-1

>SMED30030514-orf-1 ID=SMED30030514-orf-1|Name=SMED30030514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
MHFEYIFSLFYLILIIESHQSCVPYQKKLNNSNELISSFSNASGVISKTF
VKDSNGILIYGRVVIVNNPLSTISVLQPNNDNQGCKKHETYRTTETAIKA
GNCEVAINAGFFNTQTKECIGNLINDGILYRNSGGIRNANFGIKKDGKLF
FGYLSSEEVNSSDFKVLVGGVIWLVRNGSSVVEESIATECNKSQETGSLN
DFANVVSARTAVGAFINGSLVLVHVEGKTVKGGINLFDFAKLLQQMEVVS
AINLDGGGSATMVINRTLVSYPSDACSFFTCERPVSTVLCVRAQCPSQCP
PLTHCVYGFCEPMSNRNPFSVFMYVSIALLVVGVLILLINVLFAVRWIVR
QRNQSKISKWARNEDRLVLYENDDFVHFDSQPLMNDIDYIQEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000082G1/S transition of mitotic cell cycle
GO:0051726regulation of cell cycle
GO:0006486protein glycosylation
GO:0033299secretion of lysosomal enzymes
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0032580Golgi cisterna membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR018711NAGPA
Vocabulary: molecular function
TermDefinition
GO:0003944N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018711Phosphodiester glycosidasePFAMPF09992NAGPAcoord: 102..291
e-value: 1.7E-35
score: 122.7
NoneNo IPR availablePANTHERPTHR40446FAMILY NOT NAMEDcoord: 46..294
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.606
NoneNo IPR availableTMHMMTMhelixcoord: 322..344