LIM homeobox transcription factor 1-alpha

Overview
NameLIM homeobox transcription factor 1-alpha
Smed IDSMED30030505
Length (bp)1721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM homeobox transcription factor 1-alpha (SMED30030505) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30030505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM homeobox transcription factor 1-alpha (SMED30030505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30030505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30030505SMESG000005304.1 dd_Smed_v4_13371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 168.703 bits (426), Expect = 2.833e-46
Identity = 104/285 (36.49%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   75 IINLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPS--CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            +++ +K  EN     +T     S  F+    +  +P   C GC  VI D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK ++ +  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:    1 MLDGLKMEENFQSAIDT-----SASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTAEEGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 168.703 bits (426), Expect = 2.833e-46
Identity = 104/285 (36.49%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   75 IINLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPS--CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            +++ +K  EN     +T     S  F+    +  +P   C GC  VI D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK ++ +  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:    1 MLDGLKMEENFQSAIDT-----SASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTAEEGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 168.703 bits (426), Expect = 2.833e-46
Identity = 104/285 (36.49%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   75 IINLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPS--CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            +++ +K  EN     +T     S  F+    +  +P   C GC  VI D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK ++ +  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:    1 MLDGLKMEENFQSAIDT-----SASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTAEEGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 161.77 bits (408), Expect = 1.080e-43
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 279          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 161.77 bits (408), Expect = 1.459e-43
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 279          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 137.887 bits (346), Expect = 6.971e-36
Identity = 85/248 (34.27%), Postives = 121/248 (48.79%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C+ C+  I D+++  +N   +H SC  CS C++ L  +CF L+++ ++CR H+YK  F TKCS CN  +    V   A N VYHV CF C  CK+ L+ G+EF L   ++ LVC+ DYE     HC+                      EL+        G G                       S+KRPRTT++      L   ++T   P    RE LA E  L ++VVQVWFQN+RAK +++KK
Sbjct:   48 CSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATCF-LREDSMYCRAHFYKK-FGTKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKDDYEQARDKHCN----------------------ELE--------GDG-----------------------SNKRPRTTISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAKEKRLKK 240          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 124.405 bits (311), Expect = 1.035e-30
Identity = 71/256 (27.73%), Postives = 130/256 (50.78%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDE-FILHGPESLLVCRADYESGA------YLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C  C   I D+Y+F++    WH+SC  C  C   +  +CF  +D  + C+  + +  ++ +C+GC+  ++  ++   A ++V+H+ CF CS C++LL  GD+ +I+ G  +  VC++D+++         +H   +  ++C+      + +       ++     E   GK +S DS++ K+             + PRTT+   Q   L   F     P    RE LA E  L ++V+QVWFQN+R+K R++K+L
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFS-RDGLILCKTDFSRR-YSQRCAGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEG--NRFVCQSDFQTATKTSTPTSIHRPVSNGSECNSDVEEDNVDACD----EVGLDDGEGDCGKDNSDDSNSAKR-------------RGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKERRMKQL 302          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 108.227 bits (269), Expect = 1.207e-25
Identity = 75/258 (29.07%), Postives = 119/258 (46.12%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQ-THEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNY----FSSY---NSKVSSKR-PRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C  CN  I D+Y++ +++  +H++C  C+ICE  L E CF  K+ +++C  HYYK     +C+GC   +  T  V       V+HV C  CS C + L  G++ ++      + C + Y             N      S  D    S +     Y   E  +         +   YN+    FS +   +S++  +R PRTT+  +Q   L   F     P+   R  LA E  L ++V+QVWFQN+R+K R++K L
Sbjct:   29 CNCCNEQIYDRYIYRMDNRSYHENCVKCTICESPLAEKCF-WKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQILVDDTMMTVSCMSHYPPQM-------DDNAPGAIGSAVDIPSCSTENPIAPYPIDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRMLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKERRLKHL 278          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-6 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4RV72])

HSP 1 Score: 106.301 bits (264), Expect = 4.127e-25
Identity = 71/250 (28.40%), Postives = 115/250 (46.00%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLE--ESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C+GC  +I D+Y++ + +  +H+SC  CS C+  L   + CF    N ++C  H ++  +  +C  C   +   ++        YH  CF+C  C++    GDE+  H  +  + CR DY+S     C+  T+           SN   + E  +  + H                          + + KRPRT L   Q+R+    F+    P+ K RE LA E  L ++VVQVWFQNQRAK++++ K
Sbjct:   42 CSGCGCLIKDRYIYRVMEDSYHESCLRCSCCQLSLSSFKKCFSRHGN-IYC-EHDHQMLYGKRCRRCMTLLLPTDIVHRVHFMYYHAQCFSCCSCQRPFNLGDEY--HVFDGEVFCRNDYQSI----CNFQTI-----------SNPDPLMEEVVRSEIH--------------------------RKTPKRPRTILNAQQRRQFKTAFERSSKPSRKVREQLANETGLSVRVVQVWFQNQRAKIKKLNK 246          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-6 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4RV72])

HSP 1 Score: 105.145 bits (261), Expect = 1.155e-24
Identity = 71/250 (28.40%), Postives = 115/250 (46.00%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLE--ESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C+GC  +I D+Y++ + +  +H+SC  CS C+  L   + CF    N ++C  H ++  +  +C  C   +   ++        YH  CF+C  C++    GDE+  H  +  + CR DY+S     C+  T+           SN   + E  +  + H                          + + KRPRT L   Q+R+    F+    P+ K RE LA E  L ++VVQVWFQNQRAK++++ K
Sbjct:   42 CSGCGCLIKDRYIYRVMEDSYHESCLRCSCCQLSLSSFKKCFSRHGN-IYC-EHDHQMLYGKRCRRCMTLLLPTDIVHRVHFMYYHAQCFSCCSCQRPFNLGDEY--HVFDGEVFCRNDYQS----ICNFQTI-----------SNPDPLMEEVVRSEIH--------------------------RKTPKRPRTILNAQQRRQFKTAFERSSKPSRKVREQLANETGLSVRVVQVWFQNQRAKIKKLNK 246          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309834)

HSP 1 Score: 130.568 bits (327), Expect = 9.636e-33
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            P C GC+ +I D+++  + +  WH  C  CS C   L + CF  ++ +LFC+  ++K  + TKCS C++ +   +V   A + VYH+ CF C+ C + L  GDEF L   +  L+C+ DYE                         E   K L +      DG        S +G Q N           KRPRTT+T  Q   L   +     P    RE L+++  L ++VVQVWFQN+RAK +++KK
Sbjct:    5 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFA-RNGQLFCKEDFFKR-YGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLM-EDRKLICKRDYE-------------------------EAKAKGLYL------DG--------SLDGDQPN-----------KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 201          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081170)

HSP 1 Score: 130.183 bits (326), Expect = 2.163e-32
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            P C GC+ +I D+++  + +  WH  C  CS C   L + CF  ++ +LFC+  ++K  + TKCS C++ +   +V   A + VYH+ CF C+ C + L  GDEF L   +  L+C+ DYE                         E   K L +      DG        S +G Q N           KRPRTT+T  Q   L   +     P    RE L+++  L ++VVQVWFQN+RAK +++KK
Sbjct:   40 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFA-RNGQLFCKEDFFKR-YGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLM-EDRKLICKRDYE-------------------------EAKAKGLYL------DG--------SLDGDQPN-----------KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 236          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081169)

HSP 1 Score: 130.954 bits (328), Expect = 3.472e-32
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            P C GC+ +I D+++  + +  WH  C  CS C   L + CF  ++ +LFC+  ++K  + TKCS C++ +   +V   A + VYH+ CF C+ C + L  GDEF L   +  L+C+ DYE                         E   K L +      DG        S +G Q N           KRPRTT+T  Q   L   +     P    RE L+++  L ++VVQVWFQN+RAK +++KK
Sbjct:  120 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFA-RNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLM-EDRKLICKRDYE-------------------------EAKAKGLYL------DG--------SLDGDQPN-----------KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309832)

HSP 1 Score: 130.954 bits (328), Expect = 3.472e-32
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            P C GC+ +I D+++  + +  WH  C  CS C   L + CF  ++ +LFC+  ++K  + TKCS C++ +   +V   A + VYH+ CF C+ C + L  GDEF L   +  L+C+ DYE                         E   K L +      DG        S +G Q N           KRPRTT+T  Q   L   +     P    RE L+++  L ++VVQVWFQN+RAK +++KK
Sbjct:  120 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFA-RNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLM-EDRKLICKRDYE-------------------------EAKAKGLYL------DG--------SLDGDQPN-----------KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309833)

HSP 1 Score: 130.954 bits (328), Expect = 3.472e-32
Identity = 80/250 (32.00%), Postives = 119/250 (47.60%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            P C GC+ +I D+++  + +  WH  C  CS C   L + CF  ++ +LFC+  ++K  + TKCS C++ +   +V   A + VYH+ CF C+ C + L  GDEF L   +  L+C+ DYE                         E   K L +      DG        S +G Q N           KRPRTT+T  Q   L   +     P    RE L+++  L ++VVQVWFQN+RAK +++KK
Sbjct:  120 PKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFA-RNGQLFCKEDFFK-RYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLM-EDRKLICKRDYE-------------------------EAKAKGLYL------DG--------SLDGDQPN-----------KRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 169.859 bits (429), Expect = 5.582e-47
Identity = 97/246 (39.43%), Postives = 142/246 (57.72%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC+  I+D++L  +ND+ WH+ C  CS+C+++L  SC+  +D+KL+C+ H Y+  FATKCSGC   +   E+ M AL  VYH++CF C  C++ L +GDEF+L   E  L+C+ DYE    L  +S  L+D D+S           ++L +  +    G GK  S DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   33 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYS-RDHKLYCK-HDYQQLFATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLK--EGQLLCKTDYEREKDL--ASPDLSDSDKSED---------EDLDVKPEKGAGGQGK-GSDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 250          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 169.474 bits (428), Expect = 6.737e-47
Identity = 97/246 (39.43%), Postives = 142/246 (57.72%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC+  I+D++L  +ND+ WH+ C  CS+C+++L  SC+  +D+KL+C+ H Y+  FATKCSGC   +   E+ M AL  VYH++CF C  C++ L +GDEF+L   E  L+C+ DYE    L  +S  L+D D+S           ++L +  +    G GK  S DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   31 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYS-RDHKLYCK-HDYQQLFATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLK--EGQLLCKTDYEREKDL--ASPDLSDSDKSED---------EDLDVKPEKGAGGQGK-GSDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 169.474 bits (428), Expect = 6.737e-47
Identity = 97/246 (39.43%), Postives = 142/246 (57.72%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC+  I+D++L  +ND+ WH+ C  CS+C+++L  SC+  +D+KL+C+ H Y+  FATKCSGC   +   E+ M AL  VYH++CF C  C++ L +GDEF+L   E  L+C+ DYE    L  +S  L+D D+S           ++L +  +    G GK  S DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   31 CEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLLTMSCYS-RDHKLYCK-HDYQQLFATKCSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLK--EGQLLCKTDYEREKDL--ASPDLSDSDKSED---------EDLDVKPEKGAGGQGK-GSDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1al (LIM homeobox transcription factor 1, alpha-like [Source:ZFIN;Acc:ZDB-GENE-131213-1])

HSP 1 Score: 154.066 bits (388), Expect = 6.716e-41
Identity = 89/248 (35.89%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC S I D++L  +N+  WH++C  C++C   L  +C+  +D  L+C+ H Y+  F  KCS C   +   E+ M  L +VYH+ CF+C  C++ LQRGDEF+L   E  L+CR DYE    +  + +       + S K  +E             E G          +GK++           SKRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK+++I +
Sbjct:   60 CAGCESPIADRFLLRVNELSWHETCVKCAVCRSALSGTCY-CRDRLLYCK-HDYEKLFVRKCSACLQAIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLK--EGQLLCRGDYEKEREMLAAISPA----PTESVKSEDE-------------EGGGVSVGGKAGDDGKEHK---------RSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMKKIAR 277          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lmx1al (LIM homeobox transcription factor 1, alpha-like [Source:ZFIN;Acc:ZDB-GENE-131213-1])

HSP 1 Score: 153.68 bits (387), Expect = 8.728e-41
Identity = 88/248 (35.48%), Postives = 127/248 (51.21%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC S I D++L  +N+  WH++C  C++C   L  +C+  +D  L+C+ H Y+  F  KCS C   +   E+ M  L +VYH+ CF+C  C++ LQRGDEF+L   E  L+CR DYE    +  + +      +S   +D                E G          +GK++           SKRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK+++I +
Sbjct:   52 CAGCESPIADRFLLRVNELSWHETCVKCAVCRSALSGTCY-CRDRLLYCK-HDYEKLFVRKCSACLQAIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLK--EGQLLCRGDYEKEREMLAAISPAP--TESVKSED---------------EEGGGVSVGGKAGDDGKEHK---------RSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMKKIAR 269          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:NCBI gene;Acc:100492433])

HSP 1 Score: 159.844 bits (403), Expect = 3.743e-43
Identity = 100/285 (35.09%), Postives = 140/285 (49.12%), Query Frame = 3
Query:   78 INLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGA-YLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            + + +NI+N+      T   LS  F +  ++     C GC  VI D++L  ++D+ WH+ CA C  C+E LE SCF  +D KL+CRN Y K  FA KC  C   +   E  M A   VYH+ CF C  C + LQ+GDEF+L   +  L+C++DYE     L   S   +D  +S    D+ +             +D  G     D                   KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:    5 LKMEENIQNVI----ETSAALSSLFGRGMEQ--KWVCEGCERVICDRFLLRISDSLWHEQCAQCCTCKEPLESSCFY-RDKKLYCRNDYEKL-FAVKCGTCLDTITPSEFVMRAQKNVYHLGCFCCCVCDRQLQKGDEFVLK--DGQLLCKSDYERERDLLSLVSPAASDSGKSEDEDDAGK------------FDDSKGPEDGKDQKR---------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 252          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: dcp1b (decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-877165])

HSP 1 Score: 154.451 bits (389), Expect = 3.401e-41
Identity = 92/251 (36.65%), Postives = 132/251 (52.59%), Query Frame = 3
Query:  177 NPSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            N  C GC + I+D++L  +ND  WH+ C  C+ C ++L  +C+  ++ +L+C+  Y K  FATKC+ C   +   E+ M  L+ VYHV CF C  C++ L+RGDEF+L   E  L+CR+DYE    +  S+ +L     S S K  +E              DG      +D     +            SKRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK+++I +
Sbjct:   24 NEVCAGCGNTISDRFLLRVNDRSWHECCVKCAACLQILSGTCY-YRNRQLYCKEDYDKL-FATKCNSCLKTVLPSELIMRVLSNVYHVACFFCCECERRLERGDEFVLK--EGQLLCRSDYEREKEM-LSALSLTP---SGSVKSEDE--------------DGASLQGKSDEGKDPK-----------RSKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMKKIAR 241          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: LMX1B (LIM homeobox transcription factor 1, beta, gene 1 [Source:NCBI gene;Acc:100495130])

HSP 1 Score: 152.14 bits (383), Expect = 2.936e-40
Identity = 86/248 (34.68%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N+  WH+ C  C++C++ L  SC+  +D KLFC+  Y +  FA KCSGC   +   E  M AL  VYH++CF C  C++ L++GDEF+L   E  L+C++DYE         + L+      S    ++    +++    +   G G     D                   KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   56 CEGCQRPISDRFLMRVNEASWHEECLQCTVCQQPLTTSCY-FRDRKLFCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLSCFCCCVCERQLRKGDEFVLK--EGQLLCKSDYEK------EKDLLSSGSPDDSDSVKSDDEEGDVKPGKCHVNQGKGSDDGKDPRR---------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 278          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 142.51 bits (358), Expect = 1.007e-36
Identity = 86/251 (34.26%), Postives = 130/251 (51.79%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSS-NTLNDC-DQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C GC   I D++L ++ D  WH  C  C  C+  L E CF  ++ KL+C+  +++  F TKC+GC+L +   ++   A N+V+H+ CF C  C + L  G+E  +   E+  VC+ DY S + L  SS N+++ C D+S S          +LQ   Q     T   +S+D       N     NS    + PRTT+   Q   L   F     P    RE LA+E  L ++V+QVWFQN+R+K R++K+L
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFS-REGKLYCKTDFFRR-FGTKCAGCSLGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIID-ENKFVCKEDYASASSLKESSLNSVSSCTDRSLS---------PDLQDPIQDESKETDHSTSSDKETANNEN--EEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQL 241          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 125.946 bits (315), Expect = 7.864e-31
Identity = 79/250 (31.60%), Postives = 124/250 (49.60%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSM-KELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C GC   I D++L ++ D  WH  C  C  C+  L E CF  ++ KL+C+N +++  F TKC+GC   +   ++   A ++V+H+ CF C  C + L  G+E  +   E+  VC+ DY +    + ++   N    SF     ++ S+  E Q   Q  +D     S+  S      N     N     + PRTT+   Q   L   F     P    RE LA+E  L ++V+QVWFQN+R+K R++K+L
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFS-REGKLYCKNDFFRR-FGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIID-ENKFVCKEDYLNNNNNNNNAAKEN----SFISVTGSDPSLSPESQDPLQ--DDAKDSESANISDKEAGVNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQL 244          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 175.252 bits (443), Expect = 7.648e-49
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGASEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 175.252 bits (443), Expect = 7.648e-49
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGASEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 161.77 bits (408), Expect = 4.208e-44
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   23 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 246          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 161.77 bits (408), Expect = 4.986e-44
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   33 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 256          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lhx5 (LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:107792])

HSP 1 Score: 136.732 bits (343), Expect = 9.002e-35
Identity = 84/251 (33.47%), Postives = 128/251 (51.00%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYL-HCSSNTLNDC-DQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C GC   I D++L ++ D  WH  C  C  C+  L E CF  ++ KL+C+N +++  F TKC+GC   +   ++   A ++V+H+ CF C  C + L  G+E  +   E+  VC+ DY S + L   S N+++ C D+S S          +LQ   Q     T   +S+D       N     NS    + PRTT+   Q   L   F     P    RE LA+E  L ++V+QVWFQN+R+K R++K+L
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFS-REGKLYCKNDFFRR-FGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVID-ENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLS---------PDLQDPLQDDPKETDNSTSSDKETANNEN--EEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQL 241          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q9JKU8|LMX1A_MOUSE (LIM homeobox transcription factor 1-alpha OS=Mus musculus OX=10090 GN=Lmx1a PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.350e-48
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGASEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q04650|LMX1A_MESAU (LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus OX=10036 GN=LMX1A PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 6.499e-48
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTSEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q8TE12|LMX1A_HUMAN (LIM homeobox transcription factor 1-alpha OS=Homo sapiens OX=9606 GN=LMX1A PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.360e-45
Identity = 104/285 (36.49%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   75 IINLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPS--CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            +++ +K  EN     +T     S  F+    +  +P   C GC  VI D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK ++ +  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:    1 MLDGLKMEENFQSAIDT-----SASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTAEEGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|O88609|LMX1B_MOUSE (LIM homeobox transcription factor 1-beta OS=Mus musculus OX=10090 GN=Lmx1b PE=1 SV=3)

HSP 1 Score: 161.77 bits (408), Expect = 5.184e-43
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 279          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|O60663|LMX1B_HUMAN (LIM homeobox transcription factor 1-beta OS=Homo sapiens OX=9606 GN=LMX1B PE=1 SV=3)

HSP 1 Score: 161.77 bits (408), Expect = 7.005e-43
Identity = 94/249 (37.75%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETS-MKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I+D++L  +N++ WH+ C  C+ C++ L  SC+  +D KL+C+  Y +  FA KCSGC   +   E  M AL  VYH+ CF C  C++ L++GDEF+L   E  L+C+ DYE    L  S +     D+S S K  +E   MK  +        G G  S     +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   56 CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRKLYCKQDY-QQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK--EGQLLCKGDYEKEKDLLSSVSP----DESDSVKSEDEDGDMKPAK--------GQGSQSKGSGDDGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 279          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: F1LRJ8 (LIM homeobox transcription factor 1 alpha OS=Rattus norvegicus OX=10116 GN=Lmx1a PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.522e-45
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGASEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: Q543W2 (LIM homeobox transcription factor 1 alpha OS=Mus musculus OX=10090 GN=Lmx1a PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.586e-45
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGASEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A1U7Q2H5 (LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus OX=10036 GN=Lmx1a PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.926e-45
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+ HY K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELL----SLVSPAASDSGKSDDEESLCK-------SAHGAGKGTSEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: G5AQ28 (LIM homeobox transcription factor 1-alpha OS=Heterocephalus glaber OX=10181 GN=GW7_21146 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.364e-45
Identity = 107/286 (37.41%), Postives = 150/286 (52.45%), Query Frame = 3
Query:   75 IINLMKNIENIHWGENTTVGKLSVDFNKKRKKVDNPS--CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYE-SGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            +++ +K  EN      T     S  F+    +  +P   C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE     L   S   +D  +S    D  E+  K  Q        GTGK ++ D  + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:    1 MLDGLKMEENFQSAIET-----SASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKERELLSLVSPAASDSGKS----DDEESLCKSAQ--------GTGKGATEDGKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A452FMY9 (LIM homeobox transcription factor 1 alpha OS=Capra hircus OX=9925 GN=LMX1A PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 4.595e-45
Identity = 100/246 (40.65%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC  VI+D++L  LND+FWH+ C  C+ C+E LE +CF  +D KL+C+  Y K  FA KC GC   +  +E  M A   VYH++CF C  C++ LQ+GDEF+L   E  L+C+ DYE    L     +L     S S K  +E S+ +          G GK +S DS + K+             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYDYEKL-FAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLK--EGQLLCKGDYEKEQELL----SLVSPAASDSGKSDDEESLCK-------STHGAGKGASEDSKDHKR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 155.221 bits (391), Expect = 2.749e-42
Identity = 90/246 (36.59%), Postives = 133/246 (54.07%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I D++L  +N++ WH+ C  C++C++ L  SC+  +D K++C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C++ L +GDEF+L   +S L+C+ DYE         + LN      S   S +   +++ +  +    G  K  S DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   31 CAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPLTMSCY-CRDRKVYCK-HDYQRLFATKCSGCLEKIAPTEFVMRALKSVYHLGCFCCCVCERQLCKGDEFVLK--DSQLLCKKDYER------EKDLLNAISPEMSDSKSED---EDVDVKPEKGSGGQNK-GSDDSKDSRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 250          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 154.836 bits (390), Expect = 3.190e-41
Identity = 93/246 (37.80%), Postives = 135/246 (54.88%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I+D++L  +N+  WH+ C  C++C++ L  SC+ L++ KL+C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C + L++GDEF+L   +  L+C++DYE    L  S         S    +S ++  +EL I  +    G GK    DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   68 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCY-LRERKLYCK-HDYQQLFATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLK--DGQLLCKSDYEKEKDLLGSV--------SPDDSESEKSEDEELDIKPEKCSGGPGK--GDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 287          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 153.68 bits (387), Expect = 6.430e-41
Identity = 93/246 (37.80%), Postives = 135/246 (54.88%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I+D++L  +N+  WH+ C  C++C++ L  SC+ L++ KL+C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C + L++GDEF+L   +  L+C++DYE    L  S         S    +S ++  +EL I  +    G GK    DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   36 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCY-LRERKLYCK-HDYQQLFATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLK--DGQLLCKSDYEKEKDLLGSV--------SPDDSESEKSEDEELDIKPEKCSGGPGK--GDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 255          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 153.68 bits (387), Expect = 6.430e-41
Identity = 93/246 (37.80%), Postives = 135/246 (54.88%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I+D++L  +N+  WH+ C  C++C++ L  SC+ L++ KL+C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C + L++GDEF+L   +  L+C++DYE    L  S         S    +S ++  +EL I  +    G GK    DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   36 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCY-LRERKLYCK-HDYQQLFATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLK--DGQLLCKSDYEKEKDLLGSV--------SPDDSESEKSEDEELDIKPEKCSGGPGK--GDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 255          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:103022970])

HSP 1 Score: 154.066 bits (388), Expect = 7.693e-41
Identity = 93/246 (37.80%), Postives = 135/246 (54.88%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I+D++L  +N+  WH+ C  C++C++ L  SC+ L++ KL+C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C + L++GDEF+L   +  L+C++DYE    L  S         S    +S ++  +EL I  +    G GK    DS + ++             KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:   68 CEGCQRPISDRFLMRVNEASWHEECLQCAVCQQPLTTSCY-LRERKLYCK-HDYQQLFATKCSGCLEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLK--DGQLLCKSDYEKEKDLLGSV--------SPDDSESEKSEDEELDIKPEKCSGGPGK--GDDSKDPRR------------PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 287          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 70.4774 bits (171), Expect = 1.817e-14
Identity = 44/138 (31.88%), Postives = 62/138 (44.93%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEE---SCFMLKDNKLFCRNHYYKS-SFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESG-AYLHCSSNTLND 584
            C GC   I D++L    D +WH  C  CS C+  L +   SC+  +   + CR+ Y +    +  C+ C   +   E+ M     VYH+ CFAC+ C+  L  GD F  H     L C  D  +G   L     TL D
Sbjct:   18 CAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYT-RQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRF--HYVNGSLFCEHDRPAGPGPLTAHRGTLGD 152          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.172e-12
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEF 494
            P C  C   I  + + +L  T WH +C +C+ C +    S F ++D + +C   Y    F+TKC GC+ P++  +  + AL   +H TCF C+ C   L+ G  F
Sbjct:  476 PDCAKCRKKIMGEIMHALRQT-WHTTCFVCASCGKPFGNSLFHMEDGEPYCEKDYV-VLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLE-GQPF 577          

HSP 2 Score: 60.077 bits (144), Expect = 9.409e-10
Identity = 32/98 (32.65%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  177 NPSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQ 470
             P C  CN +I   +L +L  + WH +   C+ C   L E+ F+ +   ++C   Y K  FA  C+ C   +   E+ MHAL + +H TCF C+ C +
Sbjct:  416 TPMCGQCNQIIRGPFLVALGKS-WHPAEFNCAQCHTTLTETGFVEEQGNVYCETCYEK-YFAPDCAKCRKKIMG-EI-MHALRQTWHTTCFVCASCGK 509          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 63.5438 bits (153), Expect = 2.754e-12
Identity = 35/109 (32.11%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFML--KDNKLFCRNHYYKSSFA--TKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFIL 500
            C GC   I+D+YL    + FWH+ C  C +C   L E    L  K  +  CR  Y +  F     C+ C   ++  E+ M   ++VYH+ CF C+ C++    GD ++L
Sbjct:   30 CGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRL-FGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLL 137          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 62.7734 bits (151), Expect = 6.294e-12
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFML--KDNKLFCRNHYYKS-SFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFIL 500
            C GC   I+D+YL    + FWH+ C  C +C   L E    L  K  +  CR  Y +       C+ C   ++  E+ M   ++VYH+ CF C+ C++    GD ++L
Sbjct:   29 CGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLL 136          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 61.2326 bits (147), Expect = 4.606e-10
Identity = 38/108 (35.19%), Postives = 54/108 (50.00%), Query Frame = 3
Query:  186 CTGCNS-VINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHG 506
            CTGC S ++N + L +L D  WH  C  C  C +VL    ++ KD   +C    Y+S F  KC  C     T +V + A  + YH +C  C  CKQ+   G+E  + G
Sbjct:  141 CTGCGSDIMNGQALLAL-DKQWHLGCFKCKTCGKVLTGE-YISKDGVPYCEQD-YQSQFGIKCEECGK-FITGKV-LEAGEKHYHPSCARCVRCKQMFSEGEEMFMQG 243          

HSP 2 Score: 55.0694 bits (131), Expect = 3.787e-8
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 3
Query:  225 FSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHG 506
              + D  +H  C +C +C   L ++ F +K  +  C  H Y+    T+C+GC   ++   V   AL + YH  CF C+ C+     GD    +G
Sbjct:   26 LRVQDRHFHIKCFICKVCGCDLAQNGFFMKSGEYLC-THDYQQQHGTRCTGCGDFVEGEVVT--ALGKTYHPQCFVCAVCRCPFPAGDRVTFNG 116          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 131.724 bits (330), Expect = 2.613e-35
Identity = 81/250 (32.40%), Postives = 116/250 (46.40%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKR--PRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I DK+L  + D  WH  C  CS C+  L E CF  ++ KLFC+  +Y+  + TKCSGC+  +  +++   A + V+HV CF CS CK+ +  GDE    G  S  +CR DY                                      YH   T    + D      Y      ++ ++SKR  PRTT+   Q   L   F     P+   RE LA+E  L ++V+QVWFQN+R+K R++K+
Sbjct:    5 CAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFS-REGKLFCKTDFYRR-YGTKCSGCDQGISPNDMVRRAKHLVFHVDCFVCSYCKRQITTGDELYYIGDGS-FICRDDY--------------------------------------YHSHPTNLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKERRLKQ 213          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 119.398 bits (298), Expect = 1.674e-30
Identity = 80/249 (32.13%), Postives = 121/249 (48.59%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVL--EESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNT-LNDCDQSFSHKDSNETSMKELQ-ISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQ 920
            C GC S I +++     D  WH  C  CS CE  L  E +CF  KD  + CR  YY+     KCS C+  + + E+ M A ++VYHV CFAC  CK++L  G+ F + G    + C+ DYE        + T +N   +    K    T+++ +  + Y    D  G+   T  ++G+              KR RT+    Q R +  +F    NP+ K  + L+++  L  +V+QVWFQN RAK R+
Sbjct:    9 CAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFS-KDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRGIR--IYCKEDYEELLREESRNPTKINSLSKGRPRKRRIATAIESITNLGYDL-SDRPGEL--TTGADGR-------------PKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRR 238          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 112.849 bits (281), Expect = 9.214e-28
Identity = 76/244 (31.15%), Postives = 112/244 (45.90%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVL--EESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAK 911
            C GC + I D+YL  ++   WH  C  C +C + L  E +C+  KD K++C+  Y +  F TKC+ C   +  ++    A N VYH+ CFAC  CK+ L  G+EF L   +  ++C+  Y            L   D S + +D  E           +  D  G  S     +G+             +KR RTT T DQ + L   F    NP+ +  E +A+   L  +V QVWFQN RA+
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYT-KDGKIYCKADYARQ-FGTKCARCGRSIHANDWVRRAKNCVYHLACFACDNCKRQLSTGEEFALK--DGHVLCKLHY------------LEALDTSPAERDYQEV----------FSPDVDGDDSPNSLKSGRH-----------KAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRAR 234          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 113.62 bits (283), Expect = 9.284e-28
Identity = 77/259 (29.73%), Postives = 114/259 (44.02%), Query Frame = 3
Query:  150 FNKKRKKVDNPSCTGCNSVINDKYLFSLN-DTFWHKSCALCSICEEVLEESCF-MLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRP---RTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAK 911
            F+ ++++V    C GC S I+D+Y+  +  D  WH SC  C+ C   L+E C   +++ K +C+  Y +  F TKC+ C+L    ++  M A N++YH+ CF C  C + L  GDEF L   E  L C+AD+                          E   K    +   H    G+ SS             S  SK  + RP   RT L   Q   L   +     P+   +E L E   L  +V++VWFQN+R K
Sbjct:    7 FSAEKRRVS--MCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRL-FGTKCAKCSLNFSKNDFVMRARNKIYHIDCFRCVACSRQLVPGDEFALR--EDGLFCKADH--------------------------EIVEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRPTRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCK 234          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO44223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW85])

HSP 1 Score: 75.0998 bits (183), Expect = 1.070e-15
Identity = 61/196 (31.12%), Postives = 86/196 (43.88%), Query Frame = 3
Query:  369 CSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESG----------AYLHCSSNTLND--CDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQ 920
            C+GCN P++     M  ++  +H +C  C  C+  L R         +  L CR DYE            ++  C+ N      C        SN T   E  I     E  T  +S +D S+     +    + K   KRPRT LT  Q++     F+    P  K RE L+ E  L ++VVQVWFQNQRAKV++
Sbjct:    1 CTGCNEPIE-DRFLMKVVDEAWHESCLQCCICRSQLSRS----CFSKDRKLYCRTDYEKTFGHRTTIWHLSFAVCTDNVFEKSLCLSLPCCDVSNNTMPTERDIK---EEIKTEANSDSDDSSV----HGDDDDDKKGPKRPRTILTSQQRKVFKSAFEISSKPCRKVREELSRETGLSVRVVQVWFQNQRAKVQK 184          

HSP 2 Score: 60.8474 bits (146), Expect = 7.385e-11
Identity = 28/56 (50.00%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKS 353
            CTGCN  I D++L  + D  WH+SC  C IC   L  SCF  KD KL+CR  Y K+
Sbjct:    1 CTGCNEPIEDRFLMKVVDEAWHESCLQCCICRSQLSRSCFS-KDRKLYCRTDYEKT 55          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1bb (LIM homeobox transcription factor 1 beta [Source:NCBI gene;Acc:101159592])

HSP 1 Score: 155.606 bits (392), Expect = 4.189e-41
Identity = 91/246 (36.99%), Postives = 132/246 (53.66%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQI 923
            C GC   I+D++L  +ND+ WH+ C  C++C++ L  SC+ L++ KL+C+ H Y+  FATKCSGC   +   E  M AL  VYH+ CF C  C + L++GDEF+L   E  L+C+ DYE         + L+      S  + ++    +++      E G G     D  +GK              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++
Sbjct:  120 CEGCQRPISDRFLMRVNDSSWHEECLQCAVCQQPLTTSCY-LRERKLYCK-HDYQQLFATKCSGCMEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLK--EGQLLCKVDYER------EKDLLSSVSPDDSDSEKSDDEELDIK-----PEKGIGSQGKGD--DGKDPR---------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 339          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1ba (LIM/homeobox protein LMX-1.2-like [Source:NCBI gene;Acc:101158371])

HSP 1 Score: 147.132 bits (370), Expect = 3.518e-39
Identity = 86/243 (35.39%), Postives = 122/243 (50.21%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKV 914
            C GC  VI D++L  +N   WH+ C  C+ C + L  +C++  D+KL+CR  Y +  F+ KCSGC   +   ++ + AL RVYH++CF C  C+  L +GDEF+L   E  L C+ DY+    L  +    +D D+S   +D  E   +    + +  +D                            KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAKV
Sbjct:   13 CQGCRRVICDRFLLWVNGACWHEECLRCAACRQPLATTCYV-NDSKLYCRRDY-RRLFSAKCSGCLERIAATDLVIRALERVYHLSCFCCCICEHQLCKGDEFVLK--EGQLFCKKDYDKERNLSSTGGDNSDSDKS---RDDFEAESEHFVTAVKGSDDN---------------------KDPFRPKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKV 227          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1al (LIM homeobox transcription factor 1-alpha [Source:NCBI gene;Acc:101160412])

HSP 1 Score: 145.976 bits (367), Expect = 3.922e-38
Identity = 87/249 (34.94%), Postives = 124/249 (49.80%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYE-SGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC S I+D++L  +N+  WH++C  C++C   L  +C+  +D  L+C+  Y K  F  KCS C   +   E+ M  L +VYH+ CF+C  C++ LQRGDEF+L   E  L+CR DYE     L   S T  +  +S        +   +     + H+                            SKRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK+++I +
Sbjct:   55 CAGCESPISDRFLLRVNERSWHETCVKCAVCLSTLTGTCY-CRDRLLYCKLDYEKL-FVRKCSACLQVIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLK--EGQLLCRMDYEKEREMLAAISPTPTESVKSEDEDGGGGSGSGKGGDESKEHK---------------------------RSKRPRTILTTQQRRAFKASFEVSAKPCRKVRETLAAETGLTVRVVQVWFQNQRAKMKKIAR 272          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1a (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:101175472])

HSP 1 Score: 138.272 bits (347), Expect = 9.933e-36
Identity = 88/248 (35.48%), Postives = 118/248 (47.58%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKK 929
            C GC   I D++L  + D  WH+ C  C+ C + L  SCF+L + KL+C+   Y S FA  C GC   +   E+ M A   V+H++CF CS C   L+ GD  IL     LL  R DY        SS+     D      +  E S K +        D  G+  S D  N +              KRPRT LT  Q+R     F+    P  K RE LA E  L ++VVQVWFQNQRAK++++ +
Sbjct:   16 CVGCQRRITDRFLLRVADGLWHERCVRCAACGDALRNSCFLL-ERKLYCKRD-YSSLFAVHCGGCAEAISPSELVMRAGAAVFHLSCFTCSVCFHHLKTGDRCILQDGR-LLCAREDYHQLQASPPSSDIGKSGDD-----EEEEPSAKVM--------DKPGR--SHDQENKR-------------PKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLAR 232          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:101166400])

HSP 1 Score: 131.724 bits (330), Expect = 3.827e-33
Identity = 84/253 (33.20%), Postives = 128/253 (50.59%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYES-GAYLHCSSNTLNDC-DQSFSH--KDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKL 932
            C GC   I D++L ++ D  WH  C  C  C   L E CF  +D KL+C+  +++  F TKC+GC   +  +++   A ++V+H+ CF C  C + L  G+E  +   E+  VC+ DY S G+    S N+++ C D+S S    D  +  +KE           T   +S+D       N     NS    + PRTT+   Q   L   F     P    RE LA+E  L ++V+QVWFQN+R+K R++K+L
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCDCNCNLTEKCFS-RDGKLYCKMDFFRR-FGTKCAGCLQGISPNDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVID-ENKFVCKEDYLSPGSIKEVSLNSVSSCTDRSLSPDLPDPTQDDIKE-----------TDNSTSSDKETNNIEN--EEQNSGAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQL 241          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000005304.1 (SMESG000005304.1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 439/440 (99.77%), Postives = 439/440 (99.77%), Query Frame = 3
Query:   87 MKNIENIHWGENTTVGKLSVDFNKKRKKVDNPSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLXXXXXXXXXXXXXXPSNVDNEPLDQCVSSVNKESDIDQNYGVDNRSDIDFNYNCDQEKPNCQISQSTEDHNSPPEDLSDCQNYTPQDEHWHLNSKSKSYRTNNSSNIVKMKSESYMSHDPVNFIKLKSESDYSSKPINYLSSLSEPWLDSSNSRSKFS 1406
            MKNIENIHWGENTTVGKLSVDFNKKRKKVDNPSCTGCN VINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLSNQISNSQHHSSDDPSNVDNEPLDQCVSSVNKESDIDQNYGVDNRSDIDFNYNCDQEKPNCQISQSTEDHNSPPEDLSDCQNYTPQDEHWHLNSKSKSYRTNNSSNIVKMKSESYMSHDPVNFIKLKSESDYSSKPINYLSSLSEPWLDSSNSRSKFS
Sbjct:    1 MKNIENIHWGENTTVGKLSVDFNKKRKKVDNPSCTGCNGVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLSNQISNSQHHSSDDPSNVDNEPLDQCVSSVNKESDIDQNYGVDNRSDIDFNYNCDQEKPNCQISQSTEDHNSPPEDLSDCQNYTPQDEHWHLNSKSKSYRTNNSSNIVKMKSESYMSHDPVNFIKLKSESDYSSKPINYLSSLSEPWLDSSNSRSKFS 440          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000020988.1 (SMESG000020988.1)

HSP 1 Score: 186.422 bits (472), Expect = 8.782e-53
Identity = 122/332 (36.75%), Postives = 176/332 (53.01%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLXXXXXXXXXXXXXXPSNVDNEPLDQCVSSVNKESDIDQNY---GVDNRSDIDFN-YNCDQEKP-NCQISQSTEDHNSPPEDLS 1166
            C  CN +I +K+LF + D++WHKSC  C  C+  L+E+CF++K N L CRN Y KSS+ TKC GC LPMQTHEVAM++LN+ YH++CF C+ CK L+ +GD+FI+      L+C+ DYE+G     +++ ++   +  SHK  N                          SNG                R +T ++ +Q++ L  F+   QNP  KQR  +A+E+ LP+KVVQ WF N R K++  +                    +NE     +   N++  ID N     V  ++ I    +  DQ+ P NCQISQSTEDH S P+DLS
Sbjct:   53 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLDETCFLVK-NTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQPYHLSCFKCNYCKNLISKGDKFIISN--GFLICKQDYENG---RINNSAVSQTSKPQSHKSDNPP-----------------------ESNG---------------VRRKTKISTEQRQYLENFYLKYQNPTIKQRAYIADELSLPVKVVQTWFCNYRTKMKLQR--------------------NNE-----IKIFNEKLQIDDNESENSVQVKNMIQQQCFTPDQDCPTNCQISQSTEDHTS-PQDLS 314          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000001774.1 (SMESG000001774.1)

HSP 1 Score: 115.546 bits (288), Expect = 2.142e-28
Identity = 73/247 (29.55%), Postives = 115/247 (46.56%), Query Frame = 3
Query:  186 CTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEE--SCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQ 920
            C+GC  VI DKY    ++  WH SC  C ICE+ L++  SC+  ++   +C++ Y++     KC+ C   ++  E+ M  LN V+H+ CF C  C + L  G+ F+L+G  ++L C+ +    +     S   +     F     N  S+ E   S        G        N    +           KR RT+    Q R +  +F    NP+ K  + L+E+  L  +V+QVWFQN RAK R+
Sbjct:   12 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYK-RNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNG--NILFCQDEIRKSSI----STIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 251          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000039808.1 (SMESG000039808.1)

HSP 1 Score: 113.62 bits (283), Expect = 5.438e-27
Identity = 80/270 (29.63%), Postives = 133/270 (49.26%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNK--LFCRNHYYKSSFATKCSGCNLPMQTHEVAMHA-LNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRAD--YESG----------AYLHCSSN----TLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKVSS--------KRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRA 908
            P C  C + I DK++  ++D FWH++C +C+ C   L + C+  K +K  +FCR  + K   ++KC  C + +Q  ++ +   L+ ++H +CF CS C   L+ GD ++L   + ++VC A   + +G            L+   N       + D S      N TS   +  +Y         H S +S   +  ++ +S+ + +++        KRPRT L   Q+R+    F +   P+ K RE LA E  L ++VVQVWFQNQRA
Sbjct:    2 PFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTK-DYVIVCVAFCYHATGSSSINSTNSNVLLYIEQNHKINRAGNIDNSI-----NVTSGAIIDDNYMMKS-----HLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 260          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000022856.1 (SMESG000022856.1)

HSP 1 Score: 106.686 bits (265), Expect = 6.429e-25
Identity = 78/264 (29.55%), Postives = 117/264 (44.32%), Query Frame = 3
Query:  180 PSCTGCNSVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNT----LNDCDQSFSHKDSNETSM-----KELQISYQYHEDGTGKH------SSTDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIK 926
            P C  CN  INDK++  + D  WH  C  C+ C   L   CF L DN+  C   Y +  F            + +V       ++H  CF C+ C Q L  GD +  + P S++VC+ DY S  +     ++    +N  +  FS  DS E +      K   I   Y    +  +      S  D S  + Y   +  + ++  + PRTT+   Q   L   F     P+ + RE LAE   L ++V+QVWFQN+R+K R+ K
Sbjct:    4 PICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFEL-DNEFLCPEDYSRKKFKKCSKCKGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNRRSKERRSK 266          
The following BLAST results are available for this feature:
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMX1A2.833e-4636.49LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A2.833e-4636.49LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A2.833e-4636.49LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1B1.080e-4337.75LIM homeobox transcription factor 1 beta [Source:H... [more]
LMX1B1.459e-4337.75LIM homeobox transcription factor 1 beta [Source:H... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-146.971e-3634.27Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
lin-111.035e-3027.73pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
mec-31.207e-2529.07Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
lim-64.127e-2528.40LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4... [more]
lim-61.155e-2428.40LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim39.636e-3332.00gene:FBgn0002023 transcript:FBtr0309834[more]
Lim32.163e-3232.00gene:FBgn0002023 transcript:FBtr0081170[more]
Lim33.472e-3232.00gene:FBgn0002023 transcript:FBtr0081169[more]
Lim33.472e-3232.00gene:FBgn0002023 transcript:FBtr0309832[more]
Lim33.472e-3232.00gene:FBgn0002023 transcript:FBtr0309833[more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1ba5.582e-4739.43LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1ba6.737e-4739.43LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1ba6.737e-4739.43LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1al6.716e-4135.89LIM homeobox transcription factor 1, alpha-like [S... [more]
lmx1al8.728e-4135.48LIM homeobox transcription factor 1, alpha-like [S... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMX1A3.743e-4335.09LIM homeobox transcription factor 1 alpha [Source:... [more]
dcp1b3.401e-4136.65decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-8771... [more]
LMX1B2.936e-4034.68LIM homeobox transcription factor 1, beta, gene 1 ... [more]
klf21.007e-3634.26Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
gfm27.864e-3131.60G elongation factor, mitochondrial 2 [Source:Xenba... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmx1a7.648e-4940.65LIM homeobox transcription factor 1 alpha [Source:... [more]
Lmx1a7.648e-4940.65LIM homeobox transcription factor 1 alpha [Source:... [more]
Lmx1b4.208e-4437.75LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1b4.986e-4437.75LIM homeobox transcription factor 1 beta [Source:M... [more]
Lhx59.002e-3533.47LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JKU8|LMX1A_MOUSE5.350e-4840.65LIM homeobox transcription factor 1-alpha OS=Mus m... [more]
sp|Q04650|LMX1A_MESAU6.499e-4840.65LIM homeobox transcription factor 1-alpha OS=Mesoc... [more]
sp|Q8TE12|LMX1A_HUMAN1.360e-4536.49LIM homeobox transcription factor 1-alpha OS=Homo ... [more]
sp|O88609|LMX1B_MOUSE5.184e-4337.75LIM homeobox transcription factor 1-beta OS=Mus mu... [more]
sp|O60663|LMX1B_HUMAN7.005e-4337.75LIM homeobox transcription factor 1-beta OS=Homo s... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1LRJ81.522e-4540.65LIM homeobox transcription factor 1 alpha OS=Rattu... [more]
Q543W21.586e-4540.65LIM homeobox transcription factor 1 alpha OS=Mus m... [more]
A0A1U7Q2H51.926e-4540.65LIM homeobox transcription factor 1-alpha OS=Mesoc... [more]
G5AQ282.364e-4537.41LIM homeobox transcription factor 1-alpha OS=Heter... [more]
A0A452FMY94.595e-4540.65LIM homeobox transcription factor 1 alpha OS=Capra... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1ba2.749e-4236.59LIM homeobox transcription factor 1, beta a [Sourc... [more]
lmx1bb3.190e-4137.80LIM homeobox transcription factor 1 beta [Source:N... [more]
lmx1bb6.430e-4137.80LIM homeobox transcription factor 1 beta [Source:N... [more]
lmx1bb6.430e-4137.80LIM homeobox transcription factor 1 beta [Source:N... [more]
lmx1bb7.693e-4137.80LIM homeobox transcription factor 1 beta [Source:N... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo4b1.817e-1431.88LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
ENSPMAT00000007081.12.172e-1232.38pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
lmo22.754e-1232.11LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo26.294e-1231.48LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ablim1a4.606e-1035.19actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LHX12.613e-3532.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433541.674e-3032.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343709.214e-2831.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460739.284e-2829.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442231.070e-1531.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1bb4.189e-4136.99LIM homeobox transcription factor 1 beta [Source:N... [more]
lmx1ba3.518e-3935.39LIM/homeobox protein LMX-1.2-like [Source:NCBI gen... [more]
lmx1al3.922e-3834.94LIM homeobox transcription factor 1-alpha [Source:... [more]
lmx1a9.933e-3635.48LIM homeobox transcription factor 1-alpha-like [So... [more]
lhx53.827e-3333.20LIM homeobox 5 [Source:NCBI gene;Acc:101166400][more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005304.10.000e+099.77SMESG000005304.1[more]
SMESG000020988.18.782e-5336.75SMESG000020988.1[more]
SMESG000001774.12.142e-2829.55SMESG000001774.1[more]
SMESG000039808.15.438e-2729.63SMESG000039808.1[more]
SMESG000022856.16.429e-2529.55SMESG000022856.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030505 ID=SMED30030505|Name=LIM homeobox transcription factor 1-alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1721bp
TTTAATAAACATAATATCATTTTAACTTATGAAAAATAAATCTTTAAATT
AATATTTGATAAAGCAATTTTTAAATTATCAATCTTATGAAAAATATTGA
AAATATTCATTGGGGTGAAAACACAACTGTCGGTAAACTATCTGTAGATT
TTAATAAAAAGCGAAAGAAAGTTGATAATCCAAGTTGCACTGGCTGTAAT
AGTGTTATAAATGATAAATATTTATTTTCTCTCAACGATACATTCTGGCA
TAAATCGTGCGCTTTATGTTCGATTTGTGAAGAGGTTTTGGAAGAATCAT
GCTTTATGTTAAAAGACAATAAATTATTTTGTCGAAATCATTATTATAAA
AGCTCGTTTGCAACAAAATGTTCCGGCTGTAATCTTCCTATGCAGACTCA
TGAAGTGGCTATGCATGCGCTTAATCGTGTCTATCACGTCACATGCTTTG
CTTGTTCGTGCTGTAAACAGTTATTGCAAAGGGGAGATGAGTTTATTCTG
CATGGCCCAGAATCCTTGCTCGTGTGTCGAGCGGATTATGAAAGTGGTGC
GTATTTGCATTGCTCATCTAACACATTAAACGATTGCGACCAGTCATTTT
CACATAAAGACTCCAATGAGACTTCAATGAAAGAATTGCAGATTTCTTAT
CAATATCACGAAGATGGAACAGGGAAACATAGTAGCACTGATTCATCGAA
TGGAAAACAATACAATTATTTTTCATCCTACAACTCAAAAGTGTCTTCTA
AACGGCCGAGAACAACGTTGACTTTTGATCAGAAACGAAGACTAATGGTA
TTTTTCAAAACTTGTCAAAATCCAAATTACAAACAACGGGAAGCTCTTGC
AGAAGAAATGAAATTACCTCTTAAAGTTGTCCAAGTATGGTTTCAAAATC
AACGAGCGAAAGTTCGTCAAATTAAAAAACTGAGCAATCAAATTTCAAAT
TCTCAACATCATTCAAGTGATGATCCGTCCAATGTCGATAATGAGCCATT
AGATCAATGCGTTTCGTCTGTAAATAAAGAATCAGATATTGATCAAAATT
ACGGAGTTGACAATCGATCTGATATCGATTTCAATTACAATTGTGATCAA
GAGAAACCCAATTGTCAAATCAGTCAGTCAACTGAAGATCATAATTCTCC
TCCAGAAGATTTATCAGACTGCCAAAACTATACTCCGCAAGATGAACATT
GGCATCTCAATTCAAAATCAAAATCATACAGAACAAATAATTCGTCAAAC
ATTGTAAAAATGAAATCAGAATCATACATGTCTCATGATCCTGTTAATTT
TATTAAACTCAAATCTGAATCAGACTACTCCTCAAAGCCGATTAACTATT
TATCGTCGCTCTCTGAGCCATGGCTAGATTCATCCAACAGTAGATCAAAG
TTTTCATGATACAATTGGATCAGTATTACGAATCTGGTTATTCAGCATAA
TAAATCAAATCCATTAAAAAAAATCAAAAAAACAGATTTAATATAACAGG
CATTTATTGGAACGCTTTATTATTTCTTACAATTTGGAATCTATTACTTC
CAGAAAGTTATCTCAACTCCGACAACTCTACAGATTGTGATTTTTTTTAT
AACAGTATTAATCTAATCGGTGTTGATTAGATTTCTTCTTTATTATTTCT
TCTCTTTTTATTATCTCACGATCTAGGTTCTAGTCCAAAATAATTTTCTA
TACTTATGATAAAATAATCTG
back to top

protein sequence of SMED30030505-orf-1

>SMED30030505-orf-1 ID=SMED30030505-orf-1|Name=SMED30030505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
MKNIENIHWGENTTVGKLSVDFNKKRKKVDNPSCTGCNSVINDKYLFSLN
DTFWHKSCALCSICEEVLEESCFMLKDNKLFCRNHYYKSSFATKCSGCNL
PMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRAD
YESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSS
TDSSNGKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQ
REALAEEMKLPLKVVQVWFQNQRAKVRQIKKLSNQISNSQHHSSDDPSNV
DNEPLDQCVSSVNKESDIDQNYGVDNRSDIDFNYNCDQEKPNCQISQSTE
DHNSPPEDLSDCQNYTPQDEHWHLNSKSKSYRTNNSSNIVKMKSESYMSH
DPVNFIKLKSESDYSSKPINYLSSLSEPWLDSSNSRSKFS*
back to top
Aliases
The feature 'LIM homeobox transcription factor 1-alpha' has the following synonyms
Synonym
lhx*-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD
IPR001356Homeobox_dom
IPR001781Znf_LIM
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0072164mesonephric tubule development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 33..85
e-value: 2.7E-12
score: 56.8
coord: 94..150
e-value: 2.8E-11
score: 53.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 95..152
e-value: 2.8E-12
score: 46.7
coord: 34..89
e-value: 4.5E-11
score: 42.8
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 95..130
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 32..92
score: 12.771
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 93..157
score: 11.633
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 221..283
e-value: 9.9E-16
score: 68.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 222..278
e-value: 7.4E-16
score: 57.7
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 219..279
score: 15.71
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 222..277
e-value: 7.70107E-16
score: 69.5796
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 216..283
e-value: 4.4E-18
score: 66.8
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 3..155
e-value: 5.2E-34
score: 119.4
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 30..385
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 61..127
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 31..58
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 254..277
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 201..280