Chromosome X CXorf58 homolog

Overview
NameChromosome X CXorf58 homolog
Smed IDSMED30030499
Length (bp)1007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome X CXorf58 homolog (SMED30030499) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome X CXorf58 homolog (SMED30030499) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome X CXorf58 homolog (SMED30030499) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome X CXorf58 homolog (SMED30030499) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030499

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030499SMESG000061012.1 Contig48105newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030499SMESG000061012.1 Contig48105uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030499SMESG000061012.1 Contig24297newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30030499SMESG000061012.1 dd_Smed_v6_8151_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030499SMESG000061012.1 dd_Smed_v4_8151_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Human
Match: CXorf58 (chromosome X open reading frame 58 [Source:HGNC Symbol;Acc:HGNC:26356])

HSP 1 Score: 84.3445 bits (207), Expect = 7.533e-18
Identity = 53/195 (27.18%), Postives = 97/195 (49.74%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST----------------------IC-----------IKNDQKLFPS-------ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFM 527
            +A  I+  ++ + NK +F+LLK  I AAE  +T+++L+K++P+E+   K+   ++ KI+FRF G  FPP + +KIF ++                        C           I  D+++FP        +  ++    QY  + DE PA  GG+NN W+KL+   + R   +++++ + +S   S  L++ M
Sbjct:   45 SAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPT-MQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEM 238          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Human
Match: CXorf58 (chromosome X open reading frame 58 [Source:HGNC Symbol;Acc:HGNC:26356])

HSP 1 Score: 66.6254 bits (161), Expect = 5.411e-13
Identity = 29/75 (38.67%), Postives = 52/75 (69.33%), Query Frame = 3
Query:   75 IENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNS 299
            I+  ++ + NK +F+LLK  I AAE  +T+++L+K++P+E+   K+   ++ KI+FRF G  FPP + +KIF ++
Sbjct:   23 IQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPT-MQCKIRFRFRGETFPPFIVFKIFLHT 96          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Human
Match: CXorf58 (chromosome X open reading frame 58 [Source:HGNC Symbol;Acc:HGNC:26356])

HSP 1 Score: 66.2402 bits (160), Expect = 1.422e-11
Identity = 30/76 (39.47%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIF 290
            +A  I+  ++ + NK +F+LLK  I AAE  +T+++L+K++P+E+   K+   ++ KI+FRF G  FPP + +KIF
Sbjct:   45 SAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPT-MQCKIRFRFRGETFPPFIVFKIF 119          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Xenopus
Match: ENSXETT00000001118.1 (chromosome X open reading frame 58 [Source:NCBI gene;Acc:100127618])

HSP 1 Score: 117.857 bits (294), Expect = 1.122e-29
Identity = 90/321 (28.04%), Postives = 148/321 (46.11%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST------ICIKN----------------------DQKLFPS------------ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNL-DLSVATLT--------------------NQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNADFMTDNDFECS-KANLKNSLNLVAFPINDADWEDEALVLYEWTRNLS 839
            AA++I+  + CY N++LFKLLK T  AAE S +  +LRKISP+E++  ++   ++ K++FRF G EFPP + +KIF+ S       IC K                       DQ ++              +  +V    +Y  ++DE PA  GG++N W++L    + R   +++++++ +S   S  LK  M     V    DL V  L+                      +   +  HS  +S K+R K +K KR  + I +    +  D   +N  E S + N    ++     I+D DW++EA  LY W++ LS
Sbjct:   47 AAIRIQRTWRCYNNRKLFKLLKHTARAAETSASYGILRKISPLEAELLRDP-GMQCKVRFRFAGHEFPPFIVFKIFHRSGAFGNRYICGKRILHPSSEAAADACKLMGHRAYYDQMIYDELEYQKHKITDIVDVATVKDYVKYKSHLDETPAYLGGRDNCWRRLSLKNMPRTTIMYDIVEYAESGALSERLKGEMQLLLQVPRTEDLQVRQLSAITQSRSPGPPPSPVSSANKTPQRPPLLWHSARRSQKARLKAVKMKRL-YSIRNETKELMDDTTEENRLEFSERTNAGEKVH-----ISDEDWDEEAEKLYRWSQGLS 360          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Mouse
Match: AL646049.1 (family with sequence similarity 90, member A1B [Source:NCBI gene;Acc:631145])

HSP 1 Score: 93.9745 bits (232), Expect = 3.194e-21
Identity = 80/329 (24.32%), Postives = 140/329 (42.55%), Query Frame = 3
Query:   45 RSNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNS-----------------------TICIKNDQKLFPSESQ-----------------SVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDS--------KKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKSRAKNI-----KNKRYNWKIPDCEATMNADFMTDNDFECSKANLKNSL--------NLVAFPINDADWEDEALVLYEWTRNLSNAH 848
            ++N + +A KI+  +  Y +K LFKLLK T+ AAE  + ++LL+K+SP E+   K+   +K K++FRF G  FPP + +KIF  S                          I  ++K +    Q                 +V    Q+    DE PA  GGKNN W++L+ S + R   +++++D+ +S        K+   +L+    +E  +  LD+ V+ +    I +I     P   K   K++     K ++   K+         +  +  +   S+  +K  +         L    + D D E E   L+ W ++L   H
Sbjct:   38 KANRETSAAKIQRAWYIYVDKSLFKLLKHTVCAAEYCVAHELLKKVSPTEAALLKDPS-MKCKVRFRFSGETFPPCIVFKIFLKSDSRGFTYFSGKNLLKPSSKAVADAYKIMGERKFYQQIMQDEYIFQKFKIADHMDVVTVQDYMQFCSLTDETPASSGGKNNYWRRLNLSNIPRTMMMYDIVDYAESGVISDRLQKEKKYLLQKPRTEEMRLHQLDI-VSKVRYPTITTIRPFYQPWEQKREMKHLGRRSKKAQKRVEKMKKAYKESKEEKASSQEPPASRTQIKKKVIFYTPSFEILKVEELIDTDLESEERELFAWYQDLYVKH 364          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Mouse
Match: 4930550C14Rik (RIKEN cDNA 4930550C14 gene [Source:MGI Symbol;Acc:MGI:1922561])

HSP 1 Score: 48.9062 bits (115), Expect = 3.797e-6
Identity = 38/140 (27.14%), Postives = 63/140 (45.00%), Query Frame = 3
Query:   48 SNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNSTICIKNDQKLFPSESQSVSSGNQYSGYIDELPAKYGG--KNNPWKKLDQSVLVRRC 461
            SN + AA  I+  +  + N  +++  K  I          ++R I+P E+     +    ++++FR GG  FPP +YYKIF +  I           E    +S   Y+    +LPA+Y    K++P +  D S   RR 
Sbjct:   10 SNQEIAARIIQRAWKTFLNVSVYQHFKSLIDLRRQGEPRQIVRYINPKEAQLL--DAAAGVQVRFRLGGVRFPPEIYYKIFTHRHI-----------EDLCANSPRDYT----KLPARYTSHNKDDPPQVEDNSGWYRRV 132          
BLAST of Chromosome X CXorf58 homolog vs. UniProt/SwissProt
Match: sp|Q96LI9|CX058_HUMAN (Putative uncharacterized protein CXorf58 OS=Homo sapiens OX=9606 GN=CXorf58 PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 3.617e-17
Identity = 53/195 (27.18%), Postives = 97/195 (49.74%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST----------------------IC-----------IKNDQKLFPS-------ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFM 527
            +A  I+  ++ + NK +F+LLK  I AAE  +T+++L+K++P+E+   K+   ++ KI+FRF G  FPP + +KIF ++                        C           I  D+++FP        +  ++    QY  + DE PA  GG+NN W+KL+   + R   +++++ + +S   S  L++ M
Sbjct:   45 SAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPT-MQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEM 238          
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Match: A0A3M6V099 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00016370 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.638e-29
Identity = 98/319 (30.72%), Postives = 148/319 (46.39%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST------ICIKNDQKLFPSESQSVSS----GN--------------------------------QYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKAS--LMLKSFMFQEFLVSNLDLSVATL-----------TNQKINSINRHSLPKSHKSRAKNIKNKRYNW---KIPDCE--ATMNADFMTDNDFECSKANLKNSLNLVAFPINDADWEDEALVLYEWTRNLS 839
            AA KIE Y+  YR+KQ+FKLLK  I AAE SLT ++LRK+SP+E+D  ++   ++ +++FRFGGSEFPP + +KIF +S        C K   K  P+   +  S    GN                                QY  ++DE PA  GGK+N W++L    + R   +H++  +V    ++  L+ +         +  ++ VA++           T+  I+S  R S  K  K+R   ++ K +     K+P+    AT       D+ FE                  D DWED+A  LYEWT+NLS
Sbjct:   26 AARKIERYWCSYRDKQMFKLLKYAICAAEHSLTYEVLRKVSPLEADLLRDP-VIQARVRFRFGGSEFPPIILFKIFIHSGGHGVKYYCGKKVIK--PASEAACDSLRLMGNRKFYDQLIADTCQQEKDRITDETDVTTMKDYMQYLSHLDECPAATGGKSNTWRRLTLEAIPRHNIVHDIFSYVACGISTPRLLEECPDLLSLRPATQEIQVASIKAIPLYRKKAQTDYTISSPARRS--KQAKARVAKMR-KMFGLDSPKLPESRQGATPATQVPEDDLFE------------------DEDWEDQADKLYEWTQNLS 320          
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Match: A0A2B4RI87 (Uncharacterized protein C11orf65-like OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene19543 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.482e-28
Identity = 89/315 (28.25%), Postives = 145/315 (46.03%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST------ICIKNDQKLFPSESQSVSS----GN--------------------------------QYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKAS---------LMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKSRAKNIKNKRY----NWKIPD-CEATMNADFMTDNDFECSKANLKNSLNLVAFPINDADWEDEALVLYEWTRNLS 839
            AA KIE Y+  YR+KQ+FKLLK  I AAE SLT ++LRK+SP+E+D  ++   ++ +++FRFGG+EFPP + +KIF +S        C K   K  P+   +  S    GN                                QY  ++DE PA  GGK+N W++L    + R+  +H++  +V    ++         L+      QE  V+++         ++++      + +S +++A+  K ++     + K+P+ C        + D D                    D DWED+A  LYEWT+ LS
Sbjct:   19 AARKIERYWCSYRDKQMFKLLKYAICAAEHSLTYEVLRKVSPVEADLLRDP-VIQARVRFRFGGAEFPPIILFKIFIHSGGHGVKYYCGKKVIK--PASEAACDSLKLMGNRKFCDQLIADTCQHEKDRVTDETDVTTMKDYMQYLSHLDECPAATGGKSNTWRRLTLEAIPRQNIVHDIFSYVACGISTTRLLEECPDLLALRPATQEIQVASIKAIPLYRKKRQVDYTISSPIRRSKQAKARVAKMRKMFGMDSPKLPESCPGGTPVTQVPDVDL-----------------FQDEDWEDQADKLYEWTQTLS 313          
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Match: F6URM0 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=zbtb41 PE=4 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 1.762e-26
Identity = 90/321 (28.04%), Postives = 148/321 (46.11%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST------ICIKN----------------------DQKLFPS------------ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNL-DLSVATLT--------------------NQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNADFMTDNDFECS-KANLKNSLNLVAFPINDADWEDEALVLYEWTRNLS 839
            AA++I+  + CY N++LFKLLK T  AAE S +  +LRKISP+E++  ++   ++ K++FRF G EFPP + +KIF+ S       IC K                       DQ ++              +  +V    +Y  ++DE PA  GG++N W++L    + R   +++++++ +S   S  LK  M     V    DL V  L+                      +   +  HS  +S K+R K +K KR  + I +    +  D   +N  E S + N    ++     I+D DW++EA  LY W++ LS
Sbjct:   47 AAIRIQRTWRCYNNRKLFKLLKHTARAAETSASYGILRKISPLEAELLRDP-GMQCKVRFRFAGHEFPPFIVFKIFHRSGAFGNRYICGKRILHPSSEAAADACKLMGHRAYYDQMIYDELEYQKHKITDIVDVATVKDYVKYKSHLDETPAYLGGRDNCWRRLSLKNMPRTTIMYDIVEYAESGALSERLKGEMQLLLQVPRTEDLQVRQLSAITQSRSPGPPPSPVSSANKTPQRPPLLWHSARRSQKARLKAVKMKRL-YSIRNETKELMDDTTEENRLEFSERTNAGEKVH-----ISDEDWDEEAEKLYRWSQGLS 360          
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Match: A8E5V6 (Cxorf58 protein (Fragment) OS=Xenopus tropicalis OX=8364 GN=cxorf58 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.942e-26
Identity = 90/321 (28.04%), Postives = 148/321 (46.11%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST------ICIKN----------------------DQKLFPS------------ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNL-DLSVATLT--------------------NQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNADFMTDNDFECS-KANLKNSLNLVAFPINDADWEDEALVLYEWTRNLS 839
            AA++I+  + CY N++LFKLLK T  AAE S +  +LRKISP+E++  ++   ++ K++FRF G EFPP + +KIF+ S       IC K                       DQ ++              +  +V    +Y  ++DE PA  GG++N W++L    + R   +++++++ +S   S  LK  M     V    DL V  L+                      +   +  HS  +S K+R K +K KR  + I +    +  D   +N  E S + N    ++     I+D DW++EA  LY W++ LS
Sbjct:   58 AAIRIQRTWRCYNNRKLFKLLKHTARAAETSASYGILRKISPLEAELLRDP-GMQCKVRFRFAGHEFPPFIVFKIFHRSGAFGNRYICGKRILHPSSEAAADACKLMGHRAYYDQMIYDELEYQKHKITDIVDVATVKDYVKYKSHLDETPAYLGGRDNCWRRLSLKNMPRTTIMYDIVEYAESGALSERLKGEMQLLLQVPRTEDLQVRQLSAITQSRSPGPPPSPVSSANKTPQRPPLLWHSARRSQKARLKAVKMKRL-YSIRNETKELMDDTTEENRLEFSERTNAGEKVH-----ISDEDWDEEAEKLYRWSQGLS 371          
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Match: W4Y691 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.639e-26
Identity = 93/332 (28.01%), Postives = 146/332 (43.98%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST---------------------------------------ICIKNDQKLFPS-ESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKAS--------LMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKS-------RAKNIKNKRYNWKIPDCEATMNADFMTDNDFECSK----ANLKNSL--------NLVAFPINDA------DWEDEALVLYEWTRNLS 839
            AA  IE  +  YR+KQ+FKLLK  + AAE S+T ++LRK++P E+   K+ + +K +++FRF GSEFPP + +KIF ++                                         C     K+    +  +V    QY   +DE+PA  GG+ N W+KLD +VL R   ++++ID+++    S        L+    + QE  + ++ L ++ L    +  I   SLP S          R++  K +    +      T + D +  N     +     N ++S         N  AF   DA       WEDEA  LY WT+NLS
Sbjct:    2 AARSIERCWCSYRDKQMFKLLKHAVCAAEHSMTYEILRKVAPNEAHLLKD-KSMKARVRFRFAGSEFPPVILFKIFTHTEGHGLKYFSGKKIIKPASDASADACREMGHRKFYDQMLADTCQHERDKITDEIDVTTVKDYMQYLSNLDEMPAYMGGRENLWRKLDLNVLPRTTILYDIIDYLNRGSMSDRLRPEIRLLTSRPLTQEMQLKHIKL-ISKLRTPLLTPIPAGSLPPSRGPSPGVTSRRSRQAKQRASKMRKMYMSPTEDPDMVPQNTARTERLPGPGNHQSSPTPRFDHHGNQDAFDDEDAMDGDMEGWEDEADKLYTWTQNLS 331          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Cavefish
Match: CXorf58 (chromosome unknown CXorf58 homolog [Source:NCBI gene;Acc:103025448])

HSP 1 Score: 76.6406 bits (187), Expect = 1.283e-15
Identity = 49/171 (28.65%), Postives = 83/171 (48.54%), Query Frame = 3
Query:   57 KAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNS-TICIKNDQKLFPSESQSVSS-----GN--------------------------------QYSGYIDELPAKYGGKNNPWKKLDQSVLVR 455
            + +A +I+  +  + N++L + L   I +AE  LT  +L+++SP+E+   ++   +   ++FRF G +FPP + +KIF+   T    + +KLF S +Q+        GN                                QYS ++DELPA  GG+ N W++LD  VL R
Sbjct:   11 EESARRIQTCWRSHHNRKLIQYLITIIRSAEQYLTPAVLQQVSPVEAKLLRDP-SVPSTVRFRFSGEQFPPVIVFKIFHTGRTGQYLSGKKLFRSSNQATVETCRLMGNRKFMDLMVEDEVWWRGRNIADPLDITCMRDYIQYSAHLDELPAGVGGRENRWRRLDLQVLSR 180          
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Nematostella
Match: EDO36487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIK5])

HSP 1 Score: 102.834 bits (255), Expect = 5.872e-26
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 3
Query:   63 AAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNST---ICIKNDQKLFPSESQSVSS-----GNQ--------------------------------YSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHK 629
            A  +IE  +  YR+KQ+FKLLK  I AAE SLT ++LRK+SP+E+D  ++   +  +++FRFGG+EFPP + +KI+ NS+   +   + +K   + SQ+ S      GN+                                Y  ++DE P   GGK+N W++L    + R+  +H++  +V S  AS  L        +    DL       Q I      ++P+ HK
Sbjct:    3 AVQRIERNWYSYRDKQMFKLLKYAICAAEHSLTFEVLRKVSPLEADLLRDPA-VNARVRFRFGGNEFPPIIMFKIYINSSGQGLKYMSGKKTIKASSQAASDSLRLMGNRKFYDQLTADLCQHEKDKITDEIDVTTMKDYMKYLSHLDEAPPDAGGKSNLWRRLTLDAIPRKNIVHDIFSYVISGLASPRL--------IEECQDLLSGRPATQAIQVARIEAIPQYHK 222          
BLAST of Chromosome X CXorf58 homolog vs. Planmine SMEST
Match: SMESG000061012.1 (SMESG000061012.1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 272/274 (99.27%), Postives = 272/274 (99.27%), Query Frame = 3
Query:   30 MDAMIRSNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNSTICIKNDQKLFPSESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNADFMTDNDFECSKANLKNSLNLVAFPINDADWEDEALVLYEWTRNLSNAHV 851
            MDAMIRSNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLT DLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNSTICIKNDQKLFPSESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNAD MTDNDFECSKANLKNSLNLVAFPINDADWEDEALVLYEWTRNLSNAHV
Sbjct:    1 MDAMIRSNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTKDLLRKISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNSTICIKNDQKLFPSESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLIDFVDSKKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHKSRAKNIKNKRYNWKIPDCEATMNADSMTDNDFECSKANLKNSLNLVAFPINDADWEDEALVLYEWTRNLSNAHV 274          
The following BLAST results are available for this feature:
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CXorf587.533e-1827.18chromosome X open reading frame 58 [Source:HGNC Sy... [more]
CXorf585.411e-1338.67chromosome X open reading frame 58 [Source:HGNC Sy... [more]
CXorf581.422e-1139.47chromosome X open reading frame 58 [Source:HGNC Sy... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000001118.11.122e-2928.04chromosome X open reading frame 58 [Source:NCBI ge... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL646049.13.194e-2124.32family with sequence similarity 90, member A1B [So... [more]
4930550C14Rik3.797e-627.14RIKEN cDNA 4930550C14 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q96LI9|CX058_HUMAN3.617e-1727.18Putative uncharacterized protein CXorf58 OS=Homo s... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6V0996.638e-2930.72Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4RI871.482e-2828.25Uncharacterized protein C11orf65-like OS=Stylophor... [more]
F6URM01.762e-2628.04Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A8E5V61.942e-2628.04Cxorf58 protein (Fragment) OS=Xenopus tropicalis O... [more]
W4Y6917.639e-2628.01Uncharacterized protein OS=Strongylocentrotus purp... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CXorf581.283e-1528.65chromosome unknown CXorf58 homolog [Source:NCBI ge... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO364875.872e-2630.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome X CXorf58 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome X CXorf58 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061012.10.000e+099.27SMESG000061012.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030499 ID=SMED30030499|Name=Chromosome X CXorf58 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1007bp
CTCTATATAAATCTTATATGACATAGTAAATGGATGCCATGATCAGATCT
AATCCAAAAGCGGCTGCTGTAAAAATAGAAAATTATTACATTTGTTATAG
AAATAAACAATTATTTAAATTGTTGAAGTTGACCATCTCAGCAGCTGAAT
TATCATTGACCAATGATTTATTAAGAAAGATTTCTCCGATGGAATCAGAT
TTTTTTAAAAATGAACGATTTTTAAAAATGAAAATCAAATTCAGATTCGG
AGGATCTGAATTTCCGCCGGGAGTTTATTATAAAATTTTCAATAATTCTA
CAATTTGCATAAAAAACGATCAAAAATTGTTTCCAAGCGAATCTCAGTCG
GTTTCATCGGGAAATCAATATTCTGGATACATCGATGAGCTGCCGGCCAA
ATACGGCGGTAAAAATAACCCGTGGAAAAAATTAGACCAATCCGTACTTG
TTCGAAGGTGCTTTATTCATAATCTTATTGACTTCGTCGATTCGAAGAAA
GCGAGTCTCATGCTGAAAAGCTTCATGTTTCAGGAATTTCTAGTAAGCAA
TCTGGACTTATCCGTCGCGACTTTGACTAATCAAAAGATAAATTCAATAA
ACCGACACTCTCTACCGAAATCCCACAAGTCAAGGGCAAAAAATATCAAA
AATAAAAGGTACAATTGGAAAATTCCGGACTGTGAGGCGACAATGAACGC
TGATTTCATGACTGACAATGATTTTGAATGTAGCAAAGCAAATTTGAAAA
ACAGTCTGAATTTGGTCGCCTTTCCAATCAATGATGCTGACTGGGAGGAC
GAGGCCCTAGTTTTGTATGAATGGACTAGGAATTTGTCGAATGCCCACGT
TTGACTGTGAATACTGCAAATGAGATTCAATTTCAAATTTATTTATAATA
TTTATATTTATTGCGACCAGGAGATTTGTCAACTGCAATGTGAGGAGAAA
ATTTTCTTTTTTAGGATTGGAAGATTTTTTTTGAGTAATAATAATTAGTT
AGTTCAA
back to top

protein sequence of SMED30030499-orf-1

>SMED30030499-orf-1 ID=SMED30030499-orf-1|Name=SMED30030499-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MDAMIRSNPKAAAVKIENYYICYRNKQLFKLLKLTISAAELSLTNDLLRK
ISPMESDFFKNERFLKMKIKFRFGGSEFPPGVYYKIFNNSTICIKNDQKL
FPSESQSVSSGNQYSGYIDELPAKYGGKNNPWKKLDQSVLVRRCFIHNLI
DFVDSKKASLMLKSFMFQEFLVSNLDLSVATLTNQKINSINRHSLPKSHK
SRAKNIKNKRYNWKIPDCEATMNADFMTDNDFECSKANLKNSLNLVAFPI
NDADWEDEALVLYEWTRNLSNAHV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR33504:SF1coord: 7..93
coord: 113..270
NoneNo IPR availablePANTHERPTHR33504FAMILY NOT NAMEDcoord: 7..93
coord: 113..270