peptidyl prolyl cis trans isomerase FKBP-1

Overview
Namepeptidyl prolyl cis trans isomerase FKBP-1 (AFJ24727.1)
Smed IDSMED30030477
Length (bp)1405
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of peptidyl prolyl cis trans isomerase FKBP-1 (SMED30030477) t-SNE clustered cells

Violin plots show distribution of expression levels for peptidyl prolyl cis trans isomerase FKBP-1 (SMED30030477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of peptidyl prolyl cis trans isomerase FKBP-1 (SMED30030477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for peptidyl prolyl cis trans isomerase FKBP-1 (SMED30030477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030477SMESG000026331.1 SmedASXL_006316SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030477SMESG000026331.1 SmedASXL_006316SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030477SMESG000026331.1 dd_Smed_v4_1921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030477SMESG000026331.1 Contig49356newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030477SMESG000026331.1 Contig49356uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30030477SMESG000026331.1 Contig49356newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30030477SMESG000026331.1 Contig49356uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30030477SMESG000026331.1 dd_Smed_v6_1921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030477SMESG000026331.1 dd_Smed_v6_1921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30030477SMESG000026331.1 dd_Smed_v6_1921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Match: FKBP4 (FKBP prolyl isomerase 4 [Source:HGNC Symbol;Acc:HGNC:3720])

HSP 1 Score: 349.362 bits (895), Expect = 8.412e-116
Identity = 181/402 (45.02%), Postives = 266/402 (66.17%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G  MP+ G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI +ATMK  EVC + CKP YAYG   +   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P E   V+++++G + +  FD+R++ FEIG+  +  L  G+E A ++M+K E SI  +  +YAFG++GK ++ IPPNA + YE+H+K FEK KES+ ++ ++EKL+ +   K R T   + G    A   Y++ +S++EY+S F++EE      L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D+E A++ F K+L   P+N  A+ Q+ +C  +I+  L  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMN-SEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE 420          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Match: FKBP5 (FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HGNC:3721])

HSP 1 Score: 317.005 bits (811), Expect = 3.252e-103
Identity = 179/408 (43.87%), Postives = 255/408 (62.50%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTAD 1317
            EDI+   D+GVLK +   G GE  P+ G KV+VHY G  S    +G+KFDSS DR + F F+LG+GQVIKAWDIGVATMKK E+C L+CKP YAYG   +   IP+N+TL FEIEL D+KG+D+   +DG II+    +G GY +P E   V+I ++G      FD RDV F +G+     +  GI+ A +KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +D TKEKL+ A   K + T   + G    A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +++E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D  +
Sbjct:   23 EDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS----NGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLF--EDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMD-TKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Match: FKBP5 (FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HGNC:3721])

HSP 1 Score: 317.005 bits (811), Expect = 3.252e-103
Identity = 179/408 (43.87%), Postives = 255/408 (62.50%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTAD 1317
            EDI+   D+GVLK +   G GE  P+ G KV+VHY G  S    +G+KFDSS DR + F F+LG+GQVIKAWDIGVATMKK E+C L+CKP YAYG   +   IP+N+TL FEIEL D+KG+D+   +DG II+    +G GY +P E   V+I ++G      FD RDV F +G+     +  GI+ A +KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +D TKEKL+ A   K + T   + G    A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +++E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D  +
Sbjct:   23 EDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS----NGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLF--EDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMD-TKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Match: FKBP5 (FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HGNC:3721])

HSP 1 Score: 317.005 bits (811), Expect = 3.252e-103
Identity = 179/408 (43.87%), Postives = 255/408 (62.50%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTAD 1317
            EDI+   D+GVLK +   G GE  P+ G KV+VHY G  S    +G+KFDSS DR + F F+LG+GQVIKAWDIGVATMKK E+C L+CKP YAYG   +   IP+N+TL FEIEL D+KG+D+   +DG II+    +G GY +P E   V+I ++G      FD RDV F +G+     +  GI+ A +KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +D TKEKL+ A   K + T   + G    A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +++E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D  +
Sbjct:   23 EDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS----NGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLF--EDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMD-TKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Match: FKBP5 (FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HGNC:3721])

HSP 1 Score: 181.03 bits (458), Expect = 3.715e-53
Identity = 98/201 (48.76%), Postives = 131/201 (65.17%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIF 696
            EDI+   D+GVLK +   G GE  P+ G KV+VHY G  S    +G+KFDSS DR + F F+LG+GQVIKAWDIGVATMKK E+C L+CKP YAYG   +   IP+N+TL FEIEL D+KG+D+   +DG II+    +G GY +P E   V+I ++G      FD RDV F +G+     +  GI+ A +KM++ E+ I 
Sbjct:   23 EDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS----NGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLF--EDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCIL 217          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 288.886 bits (738), Expect = 5.455e-93
Identity = 167/401 (41.65%), Postives = 237/401 (59.10%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISAN-YAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKV 1296
            DI+P  D GVLK I  EG G   P  G  V VHYVGT     ++G KFDSSRDR D+FSF LG G VIK WD+GVATM K EV E   +  Y YGD  +   IP  +TL FE+ELF+W  +DISP +DG+I++TI+ +G     P +   V     GT+    F  R+V+F IG+ +  GL +G+E A ++ +  EKS  EI  + Y +GN   +  NIP NAT+ + I +K+FEKV  ++ + T +EKLD A + K R T  LQ GN+  A   Y+R+   +EY+   + E+   R  +L    LNL+L   K ++ ++ I+ CDK LE  P + KALYRK  AL+  ++  +A  +F KI+   P N  A  QI +C   I+E    +KK ++++F+K+
Sbjct:    7 DITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTL----ENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSAEDISPDRDGTILRTIIVEGSKNSFPNDTSKVLAHCVGTYQGTEFYNREVNFHIGEGSEEGLPEGVERALRRFQLGEKSKIEIRGHKYTYGNSPPAGSNIPVNATLEFTIFLKEFEKVPATWEM-TAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKNLFAKI 402          

HSP 2 Score: 51.6026 bits (122), Expect = 7.987e-7
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEG----------QVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIEL 441
            EDISPD D  +L+ II EG   + P + +KV  H VGT+ G E          +RE   +F +GEG          + ++ + +G    +K+++     K +Y     A  +IP N+TL+F I L
Sbjct:  123 EDISPDRDGTILRTIIVEGSKNSFPNDTSKVLAHCVGTYQGTE--------FYNRE--VNFHIGEGSEEGLPEGVERALRRFQLG----EKSKIEIRGHKYTYGNSPPAGSNIPVNATLEFTIFL 233          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 288.886 bits (738), Expect = 5.455e-93
Identity = 167/401 (41.65%), Postives = 237/401 (59.10%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISAN-YAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKV 1296
            DI+P  D GVLK I  EG G   P  G  V VHYVGT     ++G KFDSSRDR D+FSF LG G VIK WD+GVATM K EV E   +  Y YGD  +   IP  +TL FE+ELF+W  +DISP +DG+I++TI+ +G     P +   V     GT+    F  R+V+F IG+ +  GL +G+E A ++ +  EKS  EI  + Y +GN   +  NIP NAT+ + I +K+FEKV  ++ + T +EKLD A + K R T  LQ GN+  A   Y+R+   +EY+   + E+   R  +L    LNL+L   K ++ ++ I+ CDK LE  P + KALYRK  AL+  ++  +A  +F KI+   P N  A  QI +C   I+E    +KK ++++F+K+
Sbjct:    7 DITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTL----ENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSAEDISPDRDGTILRTIIVEGSKNSFPNDTSKVLAHCVGTYQGTEFYNREVNFHIGEGSEEGLPEGVERALRRFQLGEKSKIEIRGHKYTYGNSPPAGSNIPVNATLEFTIFLKEFEKVPATWEM-TAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKNLFAKI 402          

HSP 2 Score: 51.6026 bits (122), Expect = 7.987e-7
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEG----------QVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIEL 441
            EDISPD D  +L+ II EG   + P + +KV  H VGT+ G E          +RE   +F +GEG          + ++ + +G    +K+++     K +Y     A  +IP N+TL+F I L
Sbjct:  123 EDISPDRDGTILRTIIVEGSKNSFPNDTSKVLAHCVGTYQGTE--------FYNRE--VNFHIGEGSEEGLPEGVERALRRFQLG----EKSKIEIRGHKYTYGNSPPAGSNIPVNATLEFTIFL 233          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Match: fkb-2 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U2Q8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.265e-19
Identity = 48/108 (44.44%), Postives = 61/108 (56.48%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELF 444
            GV ++I+ EG     P NG  V  HYV T     ++G+K DSSRDR   F F +G+G+VIK WD GVA M   E  +L       YG +     IPAN+TL FE+EL 
Sbjct:    2 GVDRQILVEGDNVTKPKNGQTVTCHYVLTL----ENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 80.1073 bits (196), Expect = 7.708e-18
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 1
Query:  178 GAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDK-ATGSIPANSTLKFEIELF 444
            G ++ +HY GT      DG +FDSSR R ++F+FTLG+G VIK WD G+  M   E   L   P   YG++ A   IP NS LKF++EL 
Sbjct:   45 GDQLHMHYTGTLL----DGTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELM 130          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 80.1073 bits (196), Expect = 7.708e-18
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 1
Query:  178 GAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDK-ATGSIPANSTLKFEIELF 444
            G ++ +HY GT      DG +FDSSR R ++F+FTLG+G VIK WD G+  M   E   L   P   YG++ A   IP NS LKF++EL 
Sbjct:   45 GDQLHMHYTGTLL----DGTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELM 130          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0079872)

HSP 1 Score: 280.026 bits (715), Expect = 1.786e-89
Identity = 166/405 (40.99%), Postives = 239/405 (59.01%), Query Frame = 1
Query:  103 ISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGD 1308
            I    D GVLK+I+ EG G   P +G  V +HY G       DG +FDSS  R + F F+LG+G VIKA+D+GVATMK  E C L C P+YAYG  A GS   IP ++TL FE+E+  WKG+D+SP +DGSI +TI+       +P +   VK  I G+F+   F++RDV+F+ G+  + G+I G+EIA +KM   E S  +I A YAFG  G  E+ IPPNATV Y + + D  K  E + L + +E+L  A  +K + T   +  N   A K+Y +  + +      N+E K     + ++   N+ALC+ KS+D  +  +EC++ L L+  + KALYR+GQ  +  ++ E+A   F K++   P N  A NQ+ IC  K+KE  N EKKLY +MF+K+   D
Sbjct:    7 IDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLV----DGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYG--AAGSPPAIPPDATLIFELEMLGWKGEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKL-SDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVK----KIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAAND 400          

HSP 2 Score: 52.373 bits (124), Expect = 5.006e-7
Identity = 36/119 (30.25%), Postives = 56/119 (47.06%), Query Frame = 1
Query:  451 KGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTF-DNVSFD---ERDVDFEIGDAASFG---LIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHM 786
            +G  I    DG +++ I+ +G G E+P     V +   G   D   FD    R+  FE     S G   +I+  ++    MK  E+     + NYA+G  G S   IPP+AT+ +E+ M
Sbjct:    3 EGNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEF----SLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAG-SPPAIPPDATLIFELEM 116          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0342837)

HSP 1 Score: 280.026 bits (715), Expect = 1.786e-89
Identity = 166/405 (40.99%), Postives = 239/405 (59.01%), Query Frame = 1
Query:  103 ISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGD 1308
            I    D GVLK+I+ EG G   P +G  V +HY G       DG +FDSS  R + F F+LG+G VIKA+D+GVATMK  E C L C P+YAYG  A GS   IP ++TL FE+E+  WKG+D+SP +DGSI +TI+       +P +   VK  I G+F+   F++RDV+F+ G+  + G+I G+EIA +KM   E S  +I A YAFG  G  E+ IPPNATV Y + + D  K  E + L + +E+L  A  +K + T   +  N   A K+Y +  + +      N+E K     + ++   N+ALC+ KS+D  +  +EC++ L L+  + KALYR+GQ  +  ++ E+A   F K++   P N  A NQ+ IC  K+KE  N EKKLY +MF+K+   D
Sbjct:    7 IDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLV----DGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYG--AAGSPPAIPPDATLIFELEMLGWKGEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKL-SDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVK----KIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAAND 400          

HSP 2 Score: 52.373 bits (124), Expect = 5.006e-7
Identity = 36/119 (30.25%), Postives = 56/119 (47.06%), Query Frame = 1
Query:  451 KGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTF-DNVSFD---ERDVDFEIGDAASFG---LIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHM 786
            +G  I    DG +++ I+ +G G E+P     V +   G   D   FD    R+  FE     S G   +I+  ++    MK  E+     + NYA+G  G S   IPP+AT+ +E+ M
Sbjct:    3 EGNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEF----SLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAG-SPPAIPPDATLIFELEM 116          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Match: Fkbp12 (gene:FBgn0013954 transcript:FBtr0086515)

HSP 1 Score: 103.605 bits (257), Expect = 1.715e-26
Identity = 53/102 (51.96%), Postives = 63/102 (61.76%), Query Frame = 1
Query:  142 INEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            I  G G   P NG KV VHY GT      DG KFDSSRDR   F FT+G+G+VI+ WD GVA +   +  +LIC P YAYG +   G IP NSTL F++EL 
Sbjct:    8 IAPGDGSTYPKNGQKVTVHYTGTLD----DGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0342897)

HSP 1 Score: 83.5741 bits (205), Expect = 4.538e-18
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFD 447
            NG  + +HY GT    + DG+KFDSS DR+  F+F LG GQVIK WD G+  M   E  +L   P   YGD+  G+ IP  +TL F++EL +
Sbjct:   43 NGDSLTMHYTGTL---QADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN 131          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0071703)

HSP 1 Score: 83.5741 bits (205), Expect = 4.538e-18
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFD 447
            NG  + +HY GT    + DG+KFDSS DR+  F+F LG GQVIK WD G+  M   E  +L   P   YGD+  G+ IP  +TL F++EL +
Sbjct:   43 NGDSLTMHYTGTL---QADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN 131          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-514])

HSP 1 Score: 358.607 bits (919), Expect = 8.474e-120
Identity = 189/425 (44.47%), Postives = 278/425 (65.41%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTA 1362
            EDI+P  D GVLK +  EG G  +P+ G KVFVHYVGT      DG +FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+L CKP YAYG  A GS   IP N+TL F++ELFD++G+DI+  +DG I + I+ +G GY  P E   V++ ++G+ ++  FDER++ FE+GD  + GL  G+E A + M++ E+++F I   Y FG  G  ++NIPPNAT+ Y+I MK FEK KES+ ++T  EKL+ +   K + T+  + G    A   Y+R +S++E++S    +++     L L+  LNLA+CYLK  D    +E CDKALEL+  +EKAL+R+G+AL++  +++ AK  F +++   P+N  A++QI IC   ++E    +K+LY +MF K  + D  + D+ +     +N +A
Sbjct:   18 EDITPKKDGGVLKLVKKEGTGTELPMIGDKVFVHYVGTLL----DGSQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGEICQLTCKPEYAYG--AAGSPPKIPPNATLLFQVELFDFRGEDITDDEDGGITRRIITKGEGYTKPNEGATVEVWLEGSHEDRVFDERELKFEVGDGENLGLPLGVEKALQAMEQGEEALFTIKPKYGFGTAGSEKYNIPPNATLQYKIKMKAFEKAKESWEMNTI-EKLEQSVIVKEKGTQYFKEGKYKQAIVQYKRIVSWLEHESSMQPDDEEKAKALRLAAYLNLAMCYLKLQDANPALENCDKALELDANNEKALFRRGEALVVMKEFDMAKVDFQRVIELYPANKAAKSQISICQKHMREQHEKDKRLYANMFQKFAERDAKEADQEKEQDKKQNGSA 435          

HSP 2 Score: 55.4546 bits (132), Expect = 8.446e-8
Identity = 40/120 (33.33%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  454 GKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGT-FDNVSFD-ERD----VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            G+DI+P KDG +++ +  +G G E P     V +   GT  D   FD  RD      FE+G      +I+  +I    MK  E         YA+G  G S   IPPNAT+ +++ + DF
Sbjct:   17 GEDITPKKDGGVLKLVKKEGTGTELPMIGDKVFVHYVGTLLDGSQFDSSRDRGEKFSFELGKGQ---VIKAWDIGVATMKIGEICQLTCKPEYAYGAAG-SPPKIPPNATLLFQVELFDF 132          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-514])

HSP 1 Score: 356.681 bits (914), Expect = 6.216e-119
Identity = 189/418 (45.22%), Postives = 276/418 (66.03%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT---ADKDKNE 1332
            EDI+P  D GVLK +  EG G  +P+ G KVFVHYVGT      DG +FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+L CKP YAYG  A GS   IP N+TL F++ELFD++G+DI+  +DG I + I+ +G GY  P E   V++ ++G+ ++  FDER++ FE+GD  + GL  G+E A + M++ E+++F I   Y FG  G  ++NIPPNAT+ Y+I MK FEK KES+ ++T  EKL+ +   K + T+  + G    A   Y+R +S++E++S    +++     L L+  LNLA+CYLK  D    +E CDKALEL+  +EKAL+R+G+AL++  +++ AK  F +++   P+N  A++QI IC   ++E    +K+LY +MF K  + D    AD++K +
Sbjct:   18 EDITPKKDGGVLKLVKKEGTGTELPMIGDKVFVHYVGTLL----DGSQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGEICQLTCKPEYAYG--AAGSPPKIPPNATLLFQVELFDFRGEDITDDEDGGITRRIITKGEGYTKPNEGATVEVWLEGSHEDRVFDERELKFEVGDGENLGLPLGVEKALQAMEQGEEALFTIKPKYGFGTAGSEKYNIPPNATLQYKIKMKAFEKAKESWEMNTI-EKLEQSVIVKEKGTQYFKEGKYKQAIVQYKRIVSWLEHESSMQPDDEEKAKALRLAAYLNLAMCYLKLQDANPALENCDKALELDANNEKALFRRGEALVVMKEFDMAKVDFQRVIELYPANKAAKSQISICQKHMREQHEKDKRLYANMFQKFAERDAKKEADQEKEQ 428          

HSP 2 Score: 55.4546 bits (132), Expect = 8.842e-8
Identity = 40/120 (33.33%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  454 GKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGT-FDNVSFD-ERD----VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            G+DI+P KDG +++ +  +G G E P     V +   GT  D   FD  RD      FE+G      +I+  +I    MK  E         YA+G  G S   IPPNAT+ +++ + DF
Sbjct:   17 GEDITPKKDGGVLKLVKKEGTGTELPMIGDKVFVHYVGTLLDGSQFDSSRDRGEKFSFELGKGQ---VIKAWDIGVATMKIGEICQLTCKPEYAYGAAG-SPPKIPPNATLLFQVELFDF 132          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Match: fkbp5 (FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-630])

HSP 1 Score: 295.819 bits (756), Expect = 2.797e-95
Identity = 162/404 (40.10%), Postives = 250/404 (61.88%), Query Frame = 1
Query:  103 ISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            ++P+ D GV K +   GV    P+ G +VFVHY G        G+KFDSS DR++ F F +G+GQVIKAWDI V +M+K EVC ++CKP YAYG   +   +P NSTL FEIEL +++G++++  +DG I++ I  +G GY +P E   V + ++G      FD RDV F +G++   G+  G++ A +K++K E  +  +   YAFG  G+ E +I  NA + YE+ +KDFEK KE++ +D  KEKL+ A   K + T+  + G   YA   Y+R ++++E +     E+      LLL   LNLALCYL+  +  +T+E C+K +EL+P +EKALYR+G+A ++++++  A   F ++L  N  N  A++QI IC  KI+EH   +KK+Y +MF +  + D 
Sbjct:   25 VTPNGDSGVCKIVKQHGVEGERPMIGDRVFVHYTGRLL----SGKKFDSSLDRKEPFVFNVGKGQVIKAWDICVCSMQKGEVCLMLCKPEYAYGSAGSPPKVPPNSTLVFEIELLNFRGEELT--EDGGIVRRIKVKGEGYSNPNEGATVHVHLEGWCGGRLFDSRDVTFAVGESEDVGVPLGVDRAMEKLQKGECCLLYLKPKYAFGKEGRKEHDIGSNAELLYEVTLKDFEKAKETWEMD-LKEKLERAVLVKQKGTQYFKAGRYNYAVIQYQRIVNWLEMECGNGKEQLQAIQALLLVAHLNLALCYLRLREYSQTVENCNKVMELDPENEKALYRRGEARLLRNEFSLALMDFKQVLQVNSFNRAARSQILICQHKIREHHERDKKIYANMFQRFAEHDA 421          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Match: fkbp5 (FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-630])

HSP 1 Score: 296.204 bits (757), Expect = 4.035e-95
Identity = 162/404 (40.10%), Postives = 250/404 (61.88%), Query Frame = 1
Query:  103 ISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            ++P+ D GV K +   GV    P+ G +VFVHY G        G+KFDSS DR++ F F +G+GQVIKAWDI V +M+K EVC ++CKP YAYG   +   +P NSTL FEIEL +++G++++  +DG I++ I  +G GY +P E   V + ++G      FD RDV F +G++   G+  G++ A +K++K E  +  +   YAFG  G+ E +I  NA + YE+ +KDFEK KE++ +D  KEKL+ A   K + T+  + G   YA   Y+R ++++E +     E+      LLL   LNLALCYL+  +  +T+E C+K +EL+P +EKALYR+G+A ++++++  A   F ++L  N  N  A++QI IC  KI+EH   +KK+Y +MF +  + D 
Sbjct:   42 VTPNGDSGVCKIVKQHGVEGERPMIGDRVFVHYTGRLL----SGKKFDSSLDRKEPFVFNVGKGQVIKAWDICVCSMQKGEVCLMLCKPEYAYGSAGSPPKVPPNSTLVFEIELLNFRGEELT--EDGGIVRRIKVKGEGYSNPNEGATVHVHLEGWCGGRLFDSRDVTFAVGESEDVGVPLGVDRAMEKLQKGECCLLYLKPKYAFGKEGRKEHDIGSNAELLYEVTLKDFEKAKETWEMD-LKEKLERAVLVKQKGTQYFKAGRYNYAVIQYQRIVNWLEMECGNGKEQLQAIQALLLVAHLNLALCYLRLREYSQTVENCNKVMELDPENEKALYRRGEARLLRNEFSLALMDFKQVLQVNSFNRAARSQILICQHKIREHHERDKKIYANMFQRFAEHDA 438          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Match: fkbp1aa (FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-7275])

HSP 1 Score: 93.5893 bits (231), Expect = 1.005e-22
Identity = 49/108 (45.37%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            GV  + I  G G   P  G    VHYVG+ +    DG KFDSSRDR   F F +G+ +VI+ WD GVA M   +  +L C P +AYG K   G IP N+TL F++EL 
Sbjct:    2 GVEVETITPGDGSTFPKKGQTCVVHYVGSLT----DGRKFDSSRDRGKPFKFKIGKQEVIRGWDEGVAQMSVGQRAKLTCTPDFAYGSKGHPGVIPPNATLIFDVELI 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Match: gcgr (glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918476])

HSP 1 Score: 345.125 bits (884), Expect = 2.568e-114
Identity = 181/428 (42.29%), Postives = 274/428 (64.02%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT-------ADKDKNEPVKLAENST 1359
            DI+P  DQGVLK I  EG GE  P+ G KV VHY G  +    DG +FDSSRDR+DKF+F LG+G+VIKAWDI VATMK  E+C+++CKP YAYG   +   IP N+ L FE+ELFD++G+D++  +DG II+ I  +G GY  P E   V+I +KGT +   FDER++ FE+G+  S G+  G+E A ++M+K EK+I  +   Y FG  G  ++ IPP A + Y+I +K FEK KES+ ++  +EKL+     K R T+  ++G    AT  Y++ I ++E++S  + EE     +L+L+  LNLA CYLK  +    ++ C+KALEL+P++EK L+R+G+A +  +D E+A++ F K+L   P+N  A+ Q+  C  +I++    EKK+Y +MF ++ + ++       +D +  EP +  EN +
Sbjct:   20 DITPKGDQGVLKLIKKEGTGENTPMIGDKVSVHYTGWLT----DGTQFDSSRDRKDKFTFDLGKGEVIKAWDIAVATMKVGEICQIVCKPEYAYGTSGSPPKIPPNAVLVFEVELFDFQGEDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTHEGRVFDERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFGTTGSEKYQIPPGAELQYDIRLKSFEKAKESWEMN-AEEKLEQGCLVKERGTQYFKDGRYRQATIQYKKIIQWLEHESGLSKEEDAKAKSLILAASLNLAACYLKLGEHRAALDHCNKALELDPSNEKGLFRRGEAYMCTNDLEQARNDFTKVLQLYPANKAARAQLGQCQVRIRQQTEREKKIYANMFQRLAEKESKEVPPAPSDIEMKEPDENGENGS 442          

HSP 2 Score: 55.4546 bits (132), Expect = 1.095e-7
Identity = 40/122 (32.79%), Postives = 61/122 (50.00%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVI---KAWDIGVATMKKNEVCELICKPSYAYGDKATGS----IPANSTLKFEIEL 441
            ED++ D D G++++I  +G G + P  GA V +H  GT      +G  FD     E +  F +GEG+ I      +  +  M+K E   L  KP Y +G   TGS    IP  + L+++I L
Sbjct:  136 EDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTH-----EGRVFD-----ERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFG--TTGSEKYQIPPGAELQYDIRL 245          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Match: gcgr (glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918476])

HSP 1 Score: 328.176 bits (840), Expect = 7.852e-108
Identity = 173/418 (41.39%), Postives = 266/418 (63.64%), Query Frame = 1
Query:  130 LKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT-------ADKDKNEPVKLAENST 1359
            L+ I  EG GE  P+ G KV VHY G  +    DG +FDSSRDR+DKF+F LG+G+VIKAWDI VATMK  E+C+++CKP YAYG   +   IP N+ L FE+ELFD++G+D++  +DG II+ I  +G GY  P E   V+I +KGT +   FDER++ FE+G+  S G+  G+E A ++M+K EK+I  +   Y FG  G  ++ IPP A + Y+I +K FEK KES+ ++  +EKL+     K R T+  ++G    AT  Y++ I ++E++S  + EE     +L+L+  LNLA CYLK  +    ++ C+KALEL+P++EK L+R+G+A +  +D E+A++ F K+L   P+N  A+ Q+  C  +I++    EKK+Y +MF ++ + ++       +D +  EP +  EN +
Sbjct:   23 LQLIKKEGTGENTPMIGDKVSVHYTGWLT----DGTQFDSSRDRKDKFTFDLGKGEVIKAWDIAVATMKVGEICQIVCKPEYAYGTSGSPPKIPPNAVLVFEVELFDFQGEDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTHEGRVFDERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFGTTGSEKYQIPPGAELQYDIRLKSFEKAKESWEMN-AEEKLEQGCLVKERGTQYFKDGRYRQATIQYKKIIQWLEHESGLSKEEDAKAKSLILAASLNLAACYLKLGEHRAALDHCNKALELDPSNEKGLFRRGEAYMCTNDLEQARNDFTKVLQLYPANKAARAQLGQCQVRIRQQTEREKKIYANMFQRLAEKESKEVPPAPSDIEMKEPDENGENGS 435          

HSP 2 Score: 55.4546 bits (132), Expect = 1.139e-7
Identity = 40/122 (32.79%), Postives = 61/122 (50.00%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVI---KAWDIGVATMKKNEVCELICKPSYAYGDKATGS----IPANSTLKFEIEL 441
            ED++ D D G++++I  +G G + P  GA V +H  GT      +G  FD     E +  F +GEG+ I      +  +  M+K E   L  KP Y +G   TGS    IP  + L+++I L
Sbjct:  129 EDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTH-----EGRVFD-----ERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFG--TTGSEKYQIPPGAELQYDIRL 238          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Match: gcgr (glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918476])

HSP 1 Score: 318.161 bits (814), Expect = 3.584e-104
Identity = 172/428 (40.19%), Postives = 258/428 (60.28%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT-------ADKDKNEPVKLAENST 1359
            DI+P  DQGVLK I  EG GE  P+ G KV VHY G  +    DG +FDSSRDR+DKF+F LG+G+VIKAWDI VATMK  E+C+++CKP YAYG   +   IP N+ L FE+ELFD++G+D++  +DG II+ I  +G GY  P E   V+I +KGT +   FDER++ FE+G+  S G+  G+E A ++M+K EK+I  +   Y FG  G  ++ IPP A + Y+I +K FEK                             +G    AT  Y++ I ++E++S  + EE     +L+L+  LNLA CYLK  +    ++ C+KALEL+P++EK L+R+G+A +  +D E+A++ F K+L   P+N  A+ Q+  C  +I++    EKK+Y +MF ++ + ++       +D +  EP +  EN +
Sbjct:   20 DITPKGDQGVLKLIKKEGTGENTPMIGDKVSVHYTGWLT----DGTQFDSSRDRKDKFTFDLGKGEVIKAWDIAVATMKVGEICQIVCKPEYAYGTSGSPPKIPPNAVLVFEVELFDFQGEDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTHEGRVFDERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFGTTGSEKYQIPPGAELQYDIRLKSFEK-----------------------------DGRYRQATIQYKKIIQWLEHESGLSKEEDAKAKSLILAASLNLAACYLKLGEHRAALDHCNKALELDPSNEKGLFRRGEAYMCTNDLEQARNDFTKVLQLYPANKAARAQLGQCQVRIRQQTEREKKIYANMFQRLAEKESKEVPPAPSDIEMKEPDENGENGS 414          

HSP 2 Score: 55.4546 bits (132), Expect = 1.160e-7
Identity = 40/122 (32.79%), Postives = 61/122 (50.00%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVI---KAWDIGVATMKKNEVCELICKPSYAYGDKATGS----IPANSTLKFEIEL 441
            ED++ D D G++++I  +G G + P  GA V +H  GT      +G  FD     E +  F +GEG+ I      +  +  M+K E   L  KP Y +G   TGS    IP  + L+++I L
Sbjct:  136 EDLTQDEDGGIIRRIQVKGEGYSKPNEGAVVEIHVKGTH-----EGRVFD-----ERELKFEVGEGESIGIPPGVETAIQQMEKGEKAILYLKPKYGFG--TTGSEKYQIPPGAELQYDIRL 245          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 91.6633 bits (226), Expect = 1.518e-19
Identity = 73/283 (25.80%), Postives = 140/283 (49.47%), Query Frame = 1
Query:  478 DGSIIQTIVNQGIGYES-PKECVPVKISIKGTFD--NVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDS--EFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            +G + + I+  G G +S P++   V + +K   +  NV  ++  + F +GD     +IQ +++  + M+  E S+    A Y +G  G+S  +IPPN+ +  E+ + D +   +  +L + +EKL+ AN+ + R     Q  +  +A   Y+ +++ +   S  EF+ EE+    ++ +    NLA   LK       ++ C+  LE  P + KAL+RKG+ L  + +Y +A ++  K L   P+N     ++   + K  +  N+E  +Y+ M    G   T
Sbjct:   71 NGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTFTLGDG---DVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSP-DIPPNSNLNLEVALLDVQDGPDLENL-SGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTIHAELSRLVKKHTDQRNVESAMYKKMLGNPGSAST 348          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 91.6633 bits (226), Expect = 1.561e-19
Identity = 73/283 (25.80%), Postives = 140/283 (49.47%), Query Frame = 1
Query:  478 DGSIIQTIVNQGIGYES-PKECVPVKISIKGTFD--NVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDS--EFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            +G + + I+  G G +S P++   V + +K   +  NV  ++  + F +GD     +IQ +++  + M+  E S+    A Y +G  G+S  +IPPN+ +  E+ + D +   +  +L + +EKL+ AN+ + R     Q  +  +A   Y+ +++ +   S  EF+ EE+    ++ +    NLA   LK       ++ C+  LE  P + KAL+RKG+ L  + +Y +A ++  K L   P+N     ++   + K  +  N+E  +Y+ M    G   T
Sbjct:   70 NGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTFTLGDG---DVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSP-DIPPNSNLNLEVALLDVQDGPDLENL-SGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTIHAELSRLVKKHTDQRNVESAMYKKMLGNPGSAST 347          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Match: Fkbp4 (FK506 binding protein 4 [Source:MGI Symbol;Acc:MGI:95543])

HSP 1 Score: 338.961 bits (868), Expect = 7.624e-112
Identity = 181/404 (44.80%), Postives = 263/404 (65.10%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G   P+ G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI VATMK  EVC + CKP YAYG  A GS   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P +   V+++++G   +  FD+R++ FE+G+  S  L  G+E A ++M+K E SI  +  +YAFG++GK  + IPP+A + YE+ +K FEK KES+ + ++ EKL+ +N  K R T   + G    A   Y++ +S++EY+S F+ EE    + L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D++ A++ F K+L   PSN  A+ Q+ +C  + +  L  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYG--AAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKDRLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVRLKSFEKAKESWEM-SSAEKLEQSNIVKERGTAYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE 420          

HSP 2 Score: 52.7582 bits (125), Expect = 6.905e-7
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 1
Query:  451 KGKDISPGKDGSIIQTIVNQGIGYESPK--ECVPVKIS---IKGTFDNVSFDERD-VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            +G DISP +D  +++ I  +G G E+P   + V V  +   + GT  + S D +D   F++G      +I+  +IA   MK  E         YA+G  G S   IPPNAT+ +E+ + +F
Sbjct:   21 EGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGE---VIKAWDIAVATMKVGEVCHITCKPEYAYGAAG-SPPKIPPNATLVFEVELFEF 137          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Match: Fkbp5 (FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI:104670])

HSP 1 Score: 318.546 bits (815), Expect = 5.504e-104
Identity = 182/419 (43.44%), Postives = 258/419 (61.58%), Query Frame = 1
Query:   58 NILSTTMEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            N  +T  EQ    EDI+   D+GVLK +   G  +  P+ G KV+VHY G  S    DG+KFDSS DR+  F+F+LG+GQVIKAWDIGV+TMKK E+C L+CKP YAYG       IP+N+TL FEIEL D+KG+D+   +D  +I+ I  +G GY +P E   VK+ ++G     +FD RDV F +G+     +  GI+ A  KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +DT KEKL  A   K + T   + G  T A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +D+E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D 
Sbjct:   13 NPAATMTEQ---GEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLS----DGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGEDLF--EDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDT-KEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDA 421          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Match: Fkbp5 (FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI:104670])

HSP 1 Score: 318.546 bits (815), Expect = 5.504e-104
Identity = 182/419 (43.44%), Postives = 258/419 (61.58%), Query Frame = 1
Query:   58 NILSTTMEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            N  +T  EQ    EDI+   D+GVLK +   G  +  P+ G KV+VHY G  S    DG+KFDSS DR+  F+F+LG+GQVIKAWDIGV+TMKK E+C L+CKP YAYG       IP+N+TL FEIEL D+KG+D+   +D  +I+ I  +G GY +P E   VK+ ++G     +FD RDV F +G+     +  GI+ A  KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +DT KEKL  A   K + T   + G  T A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +D+E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D 
Sbjct:   13 NPAATMTEQ---GEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLS----DGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGEDLF--EDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDT-KEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDA 421          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Match: Fkbp5 (FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI:104670])

HSP 1 Score: 318.546 bits (815), Expect = 5.504e-104
Identity = 182/419 (43.44%), Postives = 258/419 (61.58%), Query Frame = 1
Query:   58 NILSTTMEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            N  +T  EQ    EDI+   D+GVLK +   G  +  P+ G KV+VHY G  S    DG+KFDSS DR+  F+F+LG+GQVIKAWDIGV+TMKK E+C L+CKP YAYG       IP+N+TL FEIEL D+KG+D+   +D  +I+ I  +G GY +P E   VK+ ++G     +FD RDV F +G+     +  GI+ A  KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +DT KEKL  A   K + T   + G  T A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +D+E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D 
Sbjct:   13 NPAATMTEQ---GEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLS----DGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGEDLF--EDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDT-KEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDA 421          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Match: Fkbp5 (FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI:104670])

HSP 1 Score: 318.546 bits (815), Expect = 5.504e-104
Identity = 182/419 (43.44%), Postives = 258/419 (61.58%), Query Frame = 1
Query:   58 NILSTTMEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            N  +T  EQ    EDI+   D+GVLK +   G  +  P+ G KV+VHY G  S    DG+KFDSS DR+  F+F+LG+GQVIKAWDIGV+TMKK E+C L+CKP YAYG       IP+N+TL FEIEL D+KG+D+   +D  +I+ I  +G GY +P E   VK+ ++G     +FD RDV F +G+     +  GI+ A  KM++ E+ I  +   Y FG  GK ++ I PNA + YE+ +K FEK KES+ +DT KEKL  A   K + T   + G  T A   Y + +S++E +   +++E     + LL+  LNLA+CYLK  +  K +E CDKAL L+ A+EK LYR+G+A ++ +D+E AK  F K+L  NP N  A+ QI +C  K KEH   ++++Y +MF K  + D 
Sbjct:   13 NPAATMTEQ---GEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLS----DGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGEDLF--EDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDT-KEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDA 421          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Match: sp|Q02790|FKBP4_HUMAN (Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3)

HSP 1 Score: 349.362 bits (895), Expect = 4.040e-115
Identity = 181/402 (45.02%), Postives = 266/402 (66.17%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G  MP+ G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI +ATMK  EVC + CKP YAYG   +   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P E   V+++++G + +  FD+R++ FEIG+  +  L  G+E A ++M+K E SI  +  +YAFG++GK ++ IPPNA + YE+H+K FEK KES+ ++ ++EKL+ +   K R T   + G    A   Y++ +S++EY+S F++EE      L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D+E A++ F K+L   P+N  A+ Q+ +C  +I+  L  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMN-SEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE 420          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Match: sp|Q9TRY0|FKBP4_BOVIN (Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus OX=9913 GN=FKBP4 PE=1 SV=4)

HSP 1 Score: 346.28 bits (887), Expect = 7.342e-114
Identity = 184/408 (45.10%), Postives = 266/408 (65.20%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADK 1320
            DISP  D+GVLK I  EG G   P+ G +VFVHY G       DG KFDSS DR+D+FSF LG+G+VIKAWDI VATMK  EVC + CKP YAYG   +   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P E   V+++++G F +  FD R++ FE+G+  S  L  G+E A ++M+K E SI  +   YAFG+ GK ++ IPPNA + YEIH+K FEK KES+ + +++EKL+ +   K R T   + G    A   Y++ +S++EY+S F+DE+      L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D++ A++ F K+L   PSN  A+ Q+ +C  +I++ L  EKKLY +MF ++ + +T  K
Sbjct:   24 DISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDRFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGLAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYAKPNEGALVEVALEGYFKDQVFDRRELRFEVGEGESMDLPCGLEKAIQRMEKGEHSIVYLKPRYAFGSAGKEKFQIPPNAELKYEIHLKSFEKAKESWEM-SSEEKLEQSTIVKERGTVYFKEGKYKQAVLQYKKIVSWLEYESSFSDEDAEKAQALRLASHLNLAMCHLKLQAFSAAIENCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLVVCQQRIRKQLEKEKKLYANMFERLAEEETKAK 426          

HSP 2 Score: 51.9878 bits (123), Expect = 8.853e-6
Identity = 43/142 (30.28%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  388 KATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKIS-----IKGTFDNVSFDERD-VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            KA  S   ++ L+ E       G DISP +D  +++ I  +G G E+P     V +      + GT  + S D +D   F++G      +I+  +IA   MK  E         YA+G  G S   IPPNAT+ +E+ + +F
Sbjct:    7 KAAESGAQSAPLRLE-------GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDRFSFDLGKGE---VIKAWDIAVATMKVGEVCHITCKPEYAYGLAG-SPPKIPPNATLVFEVELFEF 137          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Match: sp|P30416|FKBP4_MOUSE (Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus OX=10090 GN=Fkbp4 PE=1 SV=5)

HSP 1 Score: 338.961 bits (868), Expect = 5.333e-111
Identity = 181/404 (44.80%), Postives = 263/404 (65.10%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G   P+ G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI VATMK  EVC + CKP YAYG  A GS   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P +   V+++++G   +  FD+R++ FE+G+  S  L  G+E A ++M+K E SI  +  +YAFG++GK  + IPP+A + YE+ +K FEK KES+ + ++ EKL+ +N  K R T   + G    A   Y++ +S++EY+S F+ EE    + L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D++ A++ F K+L   PSN  A+ Q+ +C  + +  L  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYG--AAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKDRLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVRLKSFEKAKESWEM-SSAEKLEQSNIVKERGTAYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE 420          

HSP 2 Score: 52.7582 bits (125), Expect = 4.830e-6
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 1
Query:  451 KGKDISPGKDGSIIQTIVNQGIGYESPK--ECVPVKIS---IKGTFDNVSFDERD-VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            +G DISP +D  +++ I  +G G E+P   + V V  +   + GT  + S D +D   F++G      +I+  +IA   MK  E         YA+G  G S   IPPNAT+ +E+ + +F
Sbjct:   21 EGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGE---VIKAWDIAVATMKVGEVCHITCKPEYAYGAAG-SPPKIPPNATLVFEVELFEF 137          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Match: sp|Q9QVC8|FKBP4_RAT (Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus OX=10116 GN=Fkbp4 PE=1 SV=3)

HSP 1 Score: 337.421 bits (864), Expect = 1.849e-110
Identity = 177/402 (44.03%), Postives = 263/402 (65.42%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G    + G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI VATMK  EVC + CKP YAYG   +   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P +   V+++++G +++  FD+R++ FE+G+  S  L  G+E A ++M+K E SI  +  +YAFG++GK  + IPP+A + YE+H+K FEK K S+ ++ ++EKL+ +N  K R T   + G    A   Y++ +S++EY+S F+ EE    + L L+  LNLA+C+LK       IE C+KALEL+  +EK L+R+G+A +  +D++ A++ F K+L   PSN  A+ Q+ +C  + +  L  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTETAMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEDEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYYNDRLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVHLKSFEKAKASWEMN-SEEKLEQSNIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE 420          

HSP 2 Score: 51.9878 bits (123), Expect = 6.738e-6
Identity = 36/120 (30.00%), Postives = 60/120 (50.00%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIK---AWDIGVATMKKNEVCELICKPSYAYGD--KATGSIPANSTLKFEIEL 441
            ED++ D D G++++I   G G A P +GA V V   G +     +   FD     + +  F +GEG+ +      +  +  M+K E   +  KPSYA+G   K    IP ++ L++E+ L
Sbjct:  140 EDLTEDEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYY-----NDRLFD-----QRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVHL 249          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Match: sp|P27124|FKBP4_RABIT (Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus OX=9986 GN=FKBP4 PE=1 SV=3)

HSP 1 Score: 322.398 bits (825), Expect = 1.101e-104
Identity = 177/402 (44.03%), Postives = 263/402 (65.42%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGK 1302
            DISP  D+GVLK I  EG G   P+ G +VFVHY G       DG KFDSS DR+DKFSF LG+G+VIKAWDI VATMK  E+C + CKP YAYG   +   IP N+TL FE+ELF++KG+D++  +DG II+ I  +G GY  P +   V+++++G + +  FD+R++ FE+G+  S  L  G+E A ++M+K E SI  +  +YAFGN GK ++ IPP A + YE+H+K FEK KES+ + +++EKL+ +   K R T   + G    A   Y++ +S++EY+S F+ EE      L L+  LNLA+C+LK       +E C+KALEL+  +EK L+R+G+A +  +D++ A++ F K+L   PSN  A+ Q+ +C  +I++ +  EKKLY +MF ++ +
Sbjct:   24 DISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLL----DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTDDEDGGIIRRIRTRGEGYARPNDGAIVEVALEGYYKDRLFDQRELRFEVGEGESLDLPCGLEKAIQRMEKGEHSILYLKPSYAFGNAGKEKFQIPPYAELKYEVHLKSFEKAKESWEM-SSEEKLEQSAIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSSEEVQKAQALRLASHLNLAMCHLKLQAFSAAVESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLAVCQQRIRKQIAREKKLYANMFERLAE 420          

HSP 2 Score: 53.5286 bits (127), Expect = 2.880e-6
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  451 KGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKIS-----IKGTFDNVSFDERD-VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            +G DISP +D  +++ I  +G G E+P     V +      + GT  + S D +D   F++G      +I+  +IA   MK  E         YA+G+ G S   IPPNAT+ +E+ + +F
Sbjct:   21 EGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGE---VIKAWDIAVATMKVGELCRITCKPEYAYGSAG-SPPKIPPNATLVFEVELFEF 137          

HSP 3 Score: 53.1434 bits (126), Expect = 3.746e-6
Identity = 41/120 (34.17%), Postives = 60/120 (50.00%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIK---AWDIGVATMKKNEVCELICKPSYAYGD--KATGSIPANSTLKFEIEL 441
            ED++ D D G++++I   G G A P +GA V V   G +    KD   FD    R     F +GEG+ +      +  +  M+K E   L  KPSYA+G+  K    IP  + LK+E+ L
Sbjct:  140 EDLTDDEDGGIIRRIRTRGEGYARPNDGAIVEVALEGYY----KD-RLFDQRELR-----FEVGEGESLDLPCGLEKAIQRMEKGEHSILYLKPSYAFGNAGKEKFQIPPYAELKYEVHL 249          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Match: I1ZI73 (Peptidylprolyl isomerase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 430/430 (100.00%), Query Frame = 1
Query:   76 MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH 1365
            MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHA+EFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVLRNNLLLSLRLNLALCYLKSSDCVKTIEECDKALEL+PASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH
Sbjct:    1 MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHASEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVLRNNLLLSLRLNLALCYLKSSDCVKTIEECDKALELDPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH 430          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Match: A0A3Q3C5Q3 (Peptidylprolyl isomerase OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 2.863e-119
Identity = 192/424 (45.28%), Postives = 289/424 (68.16%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT---ADKDKNEPVKLAENS 1356
            EDI+P  D GVLK I  EG G  +P++G KVFVHYVGT      DG  FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+LICKP YAYG   +   IP ++TL FE+ELF+++G+DI+  +DG II+ I+ +G GY  P E   V++++ GT D+  FDER++ FEIGD  SFGL  G+E A   M++ E+++F I   Y FGN G +++NIP  AT+ Y+I +  FEK KES+ ++T+ EKL+ ++  K + T+  + G   +A+  Y+R +S++E++S  ++E+      L L+  LNLA+C+LK  +  K +E CDK++EL+ ++EKAL+R+G+AL   +++E+A+  F K++   P+N  A+NQ+ +C  +IKE    +K++Y +MF K  + D+   A+K K+E V+  E++
Sbjct:   21 EDITPKKDGGVLKVIKREGTGTELPMSGDKVFVHYVGTLL----DGTHFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGELCQLICKPEYAYGSAGSPPKIPPSATLVFEVELFEFRGEDITEEEDGGIIRRIITKGEGYSKPNEGAAVEVTVIGTCDDSVFDERELKFEIGDGESFGLPAGVEKAIMAMEQGEEAVFTIKPKYGFGNAGNAKFNIPGGATLQYKIKLTAFEKAKESWEMNTS-EKLEQSSIVKEKGTQYFKEGKYKHASVQYKRIVSWLEHESGLSEEDDKKAKALKLAAHLNLAMCFLKLQEPNKALEHCDKSMELDASNEKALFRRGEALFGMNEFEKARDDFQKVVQLYPANKAAKNQVLLCQKRIKEQHEKDKRIYANMFQKFAERDSKKEAEKGKSESVENGEDA 439          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Match: A0A3Q0T3L2 (Peptidylprolyl isomerase OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 5.790e-119
Identity = 189/410 (46.10%), Postives = 276/410 (67.32%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKD 1323
            EDI+P  D GVLK +  EG G   P+ G KVFVHYVGT      DG  FDSSRDR +KFSF LG+GQVIKAWD+GVATMK  E+C+LICKP YAYG   +   IP N+TL FE+ELF+++G+DI+  +DG II+ I+ +G GY  P E   V+++++GT +   FDER++ FEIGD  SF L  G+E A   M++ E+++F I   Y FG+ G  ++NIP  AT+ Y+I +  FEK KES+ ++TT EKL+ ++  K + T+  + G   +A+  Y+R +S++E++S  ++E++     L L+  LNLA+CYLK  +  K +E CDKALEL+ +SEKAL+R+G+AL   +++E A+  F K++   P+N  A+NQ+ +C  +IKE    +K++Y +MF K  + D+  KD
Sbjct:   19 EDITPKKDGGVLKVVKREGTGTEQPMTGDKVFVHYVGTLL----DGTHFDSSRDRGEKFSFELGKGQVIKAWDVGVATMKIGELCQLICKPEYAYGSAGSPPKIPPNATLVFEVELFEFQGEDITEDEDGGIIRRIITKGEGYSKPNEGAAVEVTVQGTCNERVFDERELKFEIGDGESFNLPAGVEKAIMAMEQGEEALFTIKPKYGFGSAGNVQFNIPGGATLQYKIKLAAFEKAKESWEMNTT-EKLEQSSIVKEKGTQYFKEGRYKHASVQYKRIVSWLEHESGLSEEDEKKAKALQLAAHLNLAMCYLKLQEPNKALEHCDKALELDASSEKALFRRGEALFGMNEFERARDDFQKVVQLYPANKAAKNQVLLCQKRIKEQHEKDKRIYANMFQKFAERDSKVKD 423          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Match: A0A3Q4ICR2 (Peptidylprolyl isomerase OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 9.851e-119
Identity = 190/424 (44.81%), Postives = 288/424 (67.92%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT---ADKDKNEPVKLAENS 1356
            EDI+P  D GVLK I  EG G  +P++G KVFVHYVGT      DG  FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+LICKP Y+YG   +   IP ++TL FE+ELF+++G+DI+  +DG II+ I+ +G GY  P E   V++++ GT D+  FDER++ FEIGD  SFGL  G+E A   M++ E+++F I   Y FGN G +++N+P  A + Y+I +  FEK KES+ ++T+ EKL+ ++  K + T+  + G   +A+  Y+R +S++E++S  ++E+      L L+  LNLA+C+LK  +  K +E CDK++EL+ ++EKAL+RKG+AL   +++E+A+  F K++   P+N  A+NQ+ +C  +IKE    +K++Y +MF K  + D+   A+K K+E V+  E++
Sbjct:   21 EDITPKKDGGVLKVIKREGTGTELPMSGDKVFVHYVGTLL----DGTHFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKTGELCQLICKPEYSYGSAGSPPKIPPSATLVFEVELFEFRGEDITEEEDGGIIRRIITKGEGYSKPNEGAAVEVTVIGTCDDSVFDERELKFEIGDGESFGLPAGVEKAIMAMEQGEEAVFTIKPKYGFGNAGNAKFNVPGGAILQYKIKLTAFEKAKESWEMNTS-EKLEQSSIVKEKGTQYFKEGKYKHASVQYKRIVSWLEHESGLSEEDDKKAKALQLAAHLNLAMCFLKLQEPNKALEHCDKSMELDASNEKALFRKGEALFGMNEFEKARDDFQKVVQLYPANKAAKNQVLLCQKRIKEQHEKDKRIYANMFQKFAERDSKKEAEKGKSESVENGEDA 439          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Match: A0A3P8RFF0 (Peptidylprolyl isomerase OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 1.320e-118
Identity = 191/424 (45.05%), Postives = 288/424 (67.92%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT---ADKDKNEPVKLAENS 1356
            EDI+P  D GVLK I  EG    +P++G KVFVHYVGT      DG  FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+LICKP YAYG   +   IP ++TL FE+ELF+++G+DI+  +DG II+ I+ +G GY  P E   V++++ GT D+  FDER++ FEIGD  SFGL  G+E A   M++ E+++F I   Y FGN G +++NIP  AT+ Y+I +  FEK KES+ ++T+ EKL+ ++  K + T+  + G   +A+  Y+R +S++E++S  ++E+      L L+  LNLA+C+LK  +  K +E CDK++EL+ ++EKAL+R+G+AL   +++E+A+  F K++   P+N  A+NQ+ +C  +IKE    +K++Y +MF K  + D+   A+K K+E V+  E++
Sbjct:   21 EDITPKKDGGVLKVIKREGTSTELPMSGDKVFVHYVGTLL----DGTHFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGELCQLICKPEYAYGSAGSPPKIPPSATLVFEVELFEFRGEDITEEEDGGIIRRIITKGEGYSKPNEGAAVEVTVIGTCDDSVFDERELKFEIGDGESFGLPAGVEKAIMAMEQGEEAVFTIKPKYGFGNAGNAKFNIPGGATLQYKIKLTAFEKAKESWEMNTS-EKLEQSSIVKEKGTQYFKEGKYKHASVQYKRIVSWLEHESGLSEEDDKKAKALQLAAHLNLAMCFLKLQEPNKALEHCDKSMELDASNEKALFRRGEALFGMNEFEKARDDFQKVVQLYPANKAAKNQVLLCQKRIKEQHEKDKRIYANMFQKFAERDSKKEAEKGKSESVENGEDA 439          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:103045630])

HSP 1 Score: 357.836 bits (917), Expect = 1.622e-119
Identity = 189/419 (45.11%), Postives = 273/419 (65.16%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS---IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT---ADKDKNEP 1335
            EDI+P  D GVLK +  EG G  +P+ G KVFVHYVGT      DG +FDSSRDR +KFSF LG+GQVIKAWDIGVATM+  E+C+L CKP YAYG  A GS   IP NSTL F++ELF++ G+DI+  +DG I++ I+ +G GY  P E   V + ++G ++   FD+RD+ FE+GD  +  L  G+E A + M++ E+S+F I   Y FGN G +++NIPP AT+ Y+I +  FEK KES+ ++T  EKL+ +   K + T+  ++G    A   Y+R +S++E++S    E++     L L+  LNL++CYLK  D    +E CDKALEL+  +EKAL+R+G+AL +  ++E AK  F +++   PSN  A++Q+ +C   IKE    +K+LY +MF K  + D    A++ K EP
Sbjct:   18 EDITPKKDGGVLKLVKKEGTGTELPMTGDKVFVHYVGTLL----DGTQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMRIGEICQLFCKPEYAYG--AAGSPPKIPPNSTLIFQVELFEFHGEDITDEEDGGIVRRIITKGEGYTKPNEGASVDVHLEGQYEGRVFDDRDLKFEVGDGENLDLPPGVEKALQAMEQGEESLFTIKPKYGFGNTGYAKFNIPPGATLQYKIKLTAFEKAKESWEMNTC-EKLEQSTIVKEKGTQYFKDGKYKQAAVQYKRIVSWLEHESSLQGEDEEKAKALRLAAHLNLSMCYLKLHDPNPALENCDKALELSANNEKALFRRGEALFVMKEFERAKDDFQRVIQLYPSNKAAKSQVVLCQKHIKEQHEKDKRLYANMFQKFAERDAKKEAEQAKKEP 429          

HSP 2 Score: 52.7582 bits (125), Expect = 5.363e-7
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  454 GKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGT-FDNVSFD-ERD----VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            G+DI+P KDG +++ +  +G G E P     V +   GT  D   FD  RD      FE+G      +I+  +I    M+  E         YA+G  G S   IPPN+T+ +++ + +F
Sbjct:   17 GEDITPKKDGGVLKLVKKEGTGTELPMTGDKVFVHYVGTLLDGTQFDSSRDRGEKFSFELGKGQ---VIKAWDIGVATMRIGEICQLFCKPEYAYGAAG-SPPKIPPNSTLIFQVELFEF 132          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Match: fkbp5 (FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-630])

HSP 1 Score: 275.018 bits (702), Expect = 4.388e-87
Identity = 150/405 (37.04%), Postives = 238/405 (58.77%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            DI+P  D+GV K +   G     P+ G +V+VHY G       +G+KFDSS DR++ F F +G+GQVI+AWDIGV +M+K EVC L+CKP YAYG   +   +P NSTL FE+EL  ++G++++  +DG I++ I  +G GY +P E   V + ++G   +  F  RD+ F +G++   G+  G++ A +KM+K E  +  +   Y FG  GK+E+ I PNA + YE+ +KDF+K                              G   +A   Y+R ++++E +     E++   + LLL   LNLALCYL+  +  +T+E C+K +EL+  +EKALYR+G+A ++++++  A   F ++L  NPSN  A++QI IC  KI+EH   +K++Y +MF +  + D 
Sbjct:   65 DITPGKDRGVCKIVKRHGTEGERPMIGDRVYVHYTGKLL----NGKKFDSSYDRKEPFVFNVGKGQVIRAWDIGVCSMQKGEVCLLLCKPDYAYGSAGSPPKVPPNSTLLFEVELLSFRGEELT--EDGGILRRIKVKGEGYNNPNEGATVHVHLEGRCGDRLFQSRDITFVVGESEDKGIPLGVDRAMEKMQKGECCLLYLKPRYGFGKEGKAEYGIGPNAELLYEVTLKDFDKA-----------------------------GRYYHAVIQYQRIVTWLEMECGLGKEQQQAIHALLLVAYLNLALCYLRLQEYAQTVENCNKVMELDSKNEKALYRRGEARLLRNEFSLALVDFRQVLQVNPSNRAARSQIVICQRKIREHHEQDKRIYANMFQRFAEHDA 434          

HSP 2 Score: 51.6026 bits (122), Expect = 1.039e-6
Identity = 35/126 (27.78%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  439 LFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDN-----VSFDERD-VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFE 798
            LF+ +G DI+PGKD  + + +   G   E P     V +   G   N      S+D ++   F +G      +I+  +I    M+K E  +     +YA+G+ G S   +PPN+T+ +E+ +  F 
Sbjct:   58 LFNSQGIDITPGKDRGVCKIVKRHGTEGERPMIGDRVYVHYTGKLLNGKKFDSSYDRKEPFVFNVGKGQ---VIRAWDIGVCSMQKGEVCLLLCKPDYAYGSAG-SPPKVPPNSTLLFEVELLSFR 179          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Match: fkbp1aa (peptidyl-prolyl cis-trans isomerase FKBP1A [Source:NCBI gene;Acc:103030299])

HSP 1 Score: 93.5893 bits (231), Expect = 8.104e-23
Identity = 49/108 (45.37%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            GV  + I  G G   P  G    VHYVG+ +    DG KFDSSRDR   F F +G+ +VI+ WD GVA M   +  +L C P +AYG K   G IP N+TL F++EL 
Sbjct:    2 GVEVETITPGDGSTFPKKGQTCVVHYVGSLT----DGRKFDSSRDRGKPFKFKIGKQEVIRGWDEGVAQMSVGQRAKLTCTPDFAYGSKGHPGIIPPNATLIFDVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Match: fkbp1ab (peptidyl-prolyl cis-trans isomerase FKBP1A-like [Source:NCBI gene;Acc:103040235])

HSP 1 Score: 92.4337 bits (228), Expect = 2.302e-22
Identity = 47/108 (43.52%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            GV  + I  G G   P  G    VHYVG+ +    DG KFDSSRDR+  F F +G+ +VI+ W+ GV  M   +  +L C P +AYG+K   G IP N+TL F++EL 
Sbjct:    2 GVEIETITPGDGRTFPKKGQTCVVHYVGSLT----DGRKFDSSRDRDKPFKFKIGKQEVIRGWEEGVVQMSVGQRAKLTCSPDFAYGNKGHPGIIPPNATLIFDVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Match: fkbp1b (FKBP prolyl isomerase 1B [Source:NCBI gene;Acc:103027308])

HSP 1 Score: 85.5001 bits (210), Expect = 3.129e-19
Identity = 45/109 (41.28%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  121 QGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
             GV  + I+ G G   P  G    VHY+G      ++G+KFDSSRDR   F F +G  +VIK W+ GVA M   +  ++ C P  AYG     G IP N+TL F++EL 
Sbjct:   58 MGVEVETISPGDGRTFPKKGQTCVVHYIGML----QNGKKFDSSRDRNKPFKFKIGRQEVIKGWEEGVAQMSLGQRAKITCTPDMAYGATGHPGVIPPNATLIFDVELL 162          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Match: fkbp1aa (FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-7275])

HSP 1 Score: 94.7449 bits (234), Expect = 1.431e-23
Identity = 48/108 (44.44%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            GV  + I  G G+  P  G  V VHY GT     +DG+KFDSSRDR+  F F +G+ +VI+ W+ GVA M   +   L C P +AYG     G IP N+TL F++EL 
Sbjct:   27 GVQVETITPGDGQTFPKKGQTVVVHYTGTL----EDGKKFDSSRDRDKPFKFKIGKQEVIRGWEEGVAQMSVGQRARLTCSPDFAYGAIGHPGVIPPNATLLFDVELL 130          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Match: fkbp1b (FKBP prolyl isomerase 1B [Source:ZFIN;Acc:ZDB-GENE-040426-1785])

HSP 1 Score: 77.7962 bits (190), Expect = 3.484e-18
Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  202 VGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            VGTF    ++G+KFDSSRDR+  F FTLG+ QVIK W+ GV  M       + C P  AYG+    G IP N+TL F++EL 
Sbjct:    1 VGTF----RNGKKFDSSRDRKKPFRFTLGKQQVIKGWEEGVGQMSLGMRARITCTPDMAYGETGHPGVIPPNTTLIFDVELL 78          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004854.1 (pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 gene:ENSPMAG00000004388.1 transcript:ENSPMAT00000004854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.418e-17
Identity = 41/92 (44.57%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDK-ATGSIPANSTLKFEIELFD 447
             G  + +HY GT     +DG +FDSS  R   F FTLG GQVIK WD G+  M + E  +L+  P   YGD+ A   IP  +TL FE+EL  
Sbjct:   49 KGDTLHMHYTGTL----EDGTEFDSSIPRNQPFIFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPPELGYGDRGAPPKIPGGATLVFEVELLQ 136          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-050302-4])

HSP 1 Score: 73.559 bits (179), Expect = 1.134e-14
Identity = 70/293 (23.89%), Postives = 133/293 (45.39%), Query Frame = 1
Query:  478 DGSIIQTIVNQGIGYESPKECVPVKISIKG-------TFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFE---KVKESFSLDTTKEK-------LDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKG 1305
            +G +++ ++ +G G   P E   V+++           +D+    + +    +   A   ++ G+E+    M K E + F + ++YA+G +G     IPPN+T+  E+ +  F     V + +++   + K       L  A   +T      Q G    A   Y +++  +E     ++EE+      LL + LNLALCYL+ +    T+    +AL + P + KA +R GQA +M  DY  ++    +     P +    +++K   AK +E    E+++ + MF   G G
Sbjct:   36 NGGVLKIVLQKGSGDIVP-ELSAVRVNYNAYLEYSDEPYDSSHLRKEESRLWLSKGA---VMPGLEVGLLTMCKGELARFLVRSDYAYGALGCPP-RIPPNSTLLLEVELLGFIDCINVDDYYTMTPEERKRLKLEKVLRVAVNERTAGNAHFQAGRYDRAMHKYLKTLRILENAHLSSNEEQSQMEASLLKVLLNLALCYLRRNRPSSTVHYALRALRVQPNNVKACFRLGQAHLMLGDYVRSRYYLLRAQSMAPVHPVITHELKALEAKWQEFNRWEREMCRRMFKGTGGG 323          

HSP 2 Score: 60.4622 bits (145), Expect = 2.075e-10
Identity = 40/110 (36.36%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATG---SIPANSTLKFEIELF 444
            GVLK ++ +G G+ +P   A V V+Y       E   E +DSS  R+++    L +G V+   ++G+ TM K E+   + +  YAYG  A G    IP NSTL  E+EL 
Sbjct:   38 GVLKIVLQKGSGDIVPELSA-VRVNYNAYL---EYSDEPYDSSHLRKEESRLWLSKGAVMPGLEVGLLTMCKGELARFLVRSDYAYG--ALGCPPRIPPNSTLLLEVELL 141          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Match: fkbp11 (FKBP prolyl isomerase 11 [Source:ZFIN;Acc:ZDB-GENE-030616-357])

HSP 1 Score: 63.5438 bits (153), Expect = 4.167e-12
Identity = 38/97 (39.18%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDK-ATGSIPANSTLKFEIELFDWKGKD 462
             G  + VHY G      KDG  FD+S  R D     LG+ QVI  W+ G+  M   E  +L+  P  AYG + A  SIPA++ L FE EL   + K+
Sbjct:   48 QGDTLHVHYTGRL----KDGSVFDTSAMR-DPLQVELGKKQVIPGWEQGLLGMCVGEKRKLVIPPHLAYGKRGAPPSIPADAVLTFETELVSLRHKE 139          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Yeast
Match: FPR1 (Peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function; N-terminally propionylated in vivo; mutation is functionally complemented by human FKBP1A [Source:SGD;Acc:S000005079])

HSP 1 Score: 83.9593 bits (206), Expect = 3.668e-20
Identity = 44/102 (43.14%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  142 INEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            I+ G G   P  G  V +HY GT     ++G+KFDSS DR   F   +G GQVIK WD+G+  +   E   L     YAYG +   G IP NSTL F++EL 
Sbjct:   14 ISPGDGATFPKTGDLVTIHYTGTL----ENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELL 111          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Yeast
Match: FPR2 (Membrane-bound peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; expression pattern suggests possible involvement in ER protein trafficking; relocalizes from nucleus to vacuole upon DNA replication stress; mutation is functionally complemented by human FKBP2 [Source:SGD;Acc:S000002927])

HSP 1 Score: 73.1738 bits (178), Expect = 3.994e-16
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  112 DNDQGVLKKI-INEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWK 453
            D + G++K+I + + + +AMP  G KV VHY G+     + G  FDSS  R    +F LG G+VIK WD GVA M   E  +L    S AYG++   G IP ++ L F++EL D K
Sbjct:   22 DLEIGIIKRIPVEDCLIKAMP--GDKVKVHYTGSL---LESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVK 132          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Yeast
Match: FPR3 (Nucleolar peptidyl-prolyl cis-trans isomerase (PPIase); FK506 binding protein; affects expression of multiple genes via its role in nucleosome assembly; phosphorylated by casein kinase II (Cka1p-Cka2p-Ckb1p-Ckb2p) and dephosphorylated by Ptp1p; PPIase domain acts as a transcriptional repressor when tethered to DNA by lexA, and repressor activity is dependent on PPIase activity; FPR3 has a paralog, FPR4, that arose from the whole genome duplication [Source:SGD;Acc:S000004539])

HSP 1 Score: 72.0182 bits (175), Expect = 3.999e-14
Identity = 39/93 (41.94%), Postives = 53/93 (56.99%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWK 453
             GA+V + Y+G      K+G+ FD +   +  F+F LG G+VIK WDIGVA M       +I    YAYG +A   IPANS L F+++L   K
Sbjct:  323 RGARVGMRYIGKL----KNGKVFDKNTSGK-PFAFKLGRGEVIKGWDIGVAGMSVGGERRIIIPAPYAYGKQALPGIPANSELTFDVKLVSMK 410          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Yeast
Match: FPR4 (Peptidyl-prolyl cis-trans isomerase (PPIase); nuclear proline isomerase; affects expression of multiple genes via its role in nucleosome assembly; catalyzes isomerization of proline residues in histones H3 and H4, which affects lysine methylation of those histones; PPIase domain acts as a transcriptional repressor when tethered to DNA by lexA, and repressor activity is dependent on PPIase activity; contains a nucleoplasmin-like fold and can form pentamers [Source:SGD;Acc:S000004441])

HSP 1 Score: 69.3218 bits (168), Expect = 2.438e-13
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  178 GAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWK 453
            G +V + YVG      K+G+ FD +  +   F F LG+G+VIK WDIGVA M       ++    YAYG +A   IPANS L F+++L   K
Sbjct:  306 GTRVGMRYVGKL----KNGKVFDKNT-KGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRIVIPAPYAYGKQALPGIPANSELTFDVKLVSMK 392          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Match: EDO43207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZA5])

HSP 1 Score: 260.766 bits (665), Expect = 9.162e-82
Identity = 155/400 (38.75%), Postives = 233/400 (58.25%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKS-IFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKV 1296
            DI+P  D GV K+I++EG G  M   G  V V YVG F     +GE+FDS+      F F LGE  VI+ WDIGVATMKK E   L CKP YAYG +    IP N+TL+F +EL DWKG +++    G + + I+ +G G+  P     V   + G++D   F+ER+V+F  G+    GL++G+E A   M   EKS IF     Y  G  G  +  +PPNA +TY I +K FE  KE++ L +  EK+  A + K + T+  ++G    A + Y   I  +E    F++EE+   + +  +  LN+A C+LK  +  K I+ C+KAL+++  + KAL+R+G+AL+   DYE++K  F ++L  +P N +A+ Q+KI    +K+H   EKKLY ++F ++
Sbjct:   29 DITPKKDGGVRKRILSEGHGAEMANVGCTVVVRYVGKFL----NGEEFDSNTGGV-PFEFVLGESVVIQGWDIGVATMKKGEKALLTCKPEYAYGKQGGSKIPPNTTLQFIVELLDWKGINVT--NKGEVSKVILEKGEGHARPNTGAVVNAHVTGSYDGKVFEEREVEFTFGEGTEAGLLEGVEEAIGNMTNKEKSKIFIQPGKYGVGPEGNPQLGLPPNALITYIIDLKHFENFKEAWEL-SNDEKITTALKVKDKGTKFFKDGKYKIACRQYAVVIRVLE--GYFDEEEEKAVDPIKCAGHLNIAACHLKLGNNFKCIKACNKALDIDKENIKALFRRGKALLNLKDYEKSKEDFTQVLELDPKNREAREQLKIVNGMLKDHHQKEKKLYSNIFERL 418          

HSP 2 Score: 60.077 bits (144), Expect = 8.234e-10
Identity = 49/170 (28.82%), Postives = 83/170 (48.82%), Query Frame = 1
Query:  454 GKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDN-VSFDERD----VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVT--YATKLY-ERSISY 939
            G DI+P KDG + + I+++G G E       V +   G F N   FD        +F +G++    +IQG +I    MKK EK++      YA+G  G S+  IPPN T+ + + + D++ +  +   + +K  L+         T  + N +VT  Y  K++ ER + +
Sbjct:   27 GVDITPKKDGGVRKRILSEGHGAEMANVGCTVVVRYVGKFLNGEEFDSNTGGVPFEFVLGESV---VIQGWDIGVATMKKGEKALLTCKPEYAYGKQGGSK--IPPNTTLQFIVELLDWKGINVTNKGEVSKVILEKGEGHARPNTGAVVNAHVTGSYDGKVFEEREVEF 191          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Match: EDO31332 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SY88])

HSP 1 Score: 87.0409 bits (214), Expect = 5.362e-21
Identity = 46/90 (51.11%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA 393
            GV  K +  G G++ P  G  V VHY GT +    DG+KFDSSRDR   F F LG GQVIK WD GVA M   +   L C P YAYG K 
Sbjct:    2 GVDVKTVQPGDGKSFPKAGQTVSVHYTGTLT----DGKKFDSSRDRGKPFQFKLGAGQVIKGWDEGVAQMSLGQKATLTCTPDYAYGPKG 87          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Match: EDO40282 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7S7R3])

HSP 1 Score: 72.4034 bits (176), Expect = 1.609e-15
Identity = 39/92 (42.39%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  172 INGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDK-ATGSIPANSTLKFEIELF 444
            + G  + +HY G      +DG +FDSS  R + F FTLG GQVIK WD G+  M   E  +L+      YGD+ A   IP  +TL FE+EL 
Sbjct:   36 VKGDSLHMHYTGKL----EDGTEFDSSIPRGEPFVFTLGTGQVIKGWDQGLLNMCAGEKRKLVIPSDMGYGDRGAPPKIPGGATLIFEVELL 123          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Match: EDO34418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPD7])

HSP 1 Score: 74.3294 bits (181), Expect = 1.676e-15
Identity = 38/96 (39.58%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  175 NGAKVFVHYVGTFSGGEKDGEKFDSSRDRE---DKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWK 453
            N  KV  H V  ++G  +DG  FD++RD       F FT+G G VIK ++ GV  M   +  +++  P+ AYG K +G +PAN+TL + +ELFD +
Sbjct:   16 NKTKVGDHVVVHYTGWMQDGSLFDTTRDHRKGYQPFEFTIGGGTVIKGFEQGVTGMCVGQKRKIVIPPALAYGKKGSGDVPANTTLTYNLELFDVR 111          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Match: EDO47498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX5])

HSP 1 Score: 70.4774 bits (171), Expect = 4.142e-14
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  178 GAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATG-SIPANSTLKFEIELFDWKG 456
            G  + +HY G  +    +G KFDSS DR   F FTLG+G VI+ W+ G+  M   E  +L   P  AYG+   G +IP ++TL  ++EL + +G
Sbjct:   45 GDTLSMHYTGRLA----NGNKFDSSLDRGKTFDFTLGKGMVIQGWEQGLLDMCIGEKRKLTIPPHLAYGENGAGAAIPPHATLYMDVELVEIQG 134          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:101164056])

HSP 1 Score: 358.607 bits (919), Expect = 8.191e-120
Identity = 182/406 (44.83%), Postives = 275/406 (67.73%), Query Frame = 1
Query:   97 EDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            EDI+P  D GVLK I  EG G  +P+ G KVFVHYVGT      DG  FDSSRDR +KFSF LG+GQVIKAWDIGVATMK  E+C+L+CKP YAYG   +   IP NSTL FE+ELFD++G+DI+  +DG II+ I+ +G GY  P E   V+++++GT D   FDER++ FEIGD  SF L  G+E A   M++ E+++F I   Y +GN G ++ NIP  AT+ Y+I +  FEK KES+ ++T  EKL+ ++  K + T+  ++G    A+  Y++ +S++E++S  ++E++     L L+  LNLA+CYLK  +  + +E CDKALE++ ++EKAL+R+G+AL   +++++A+  F +++   P+N  A++Q+ +C  ++KE    +K++Y +MF K  + D+
Sbjct:   19 EDITPKKDGGVLKVIKREGTGTELPMTGDKVFVHYVGTLL----DGTHFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKVGELCQLVCKPEYAYGSAGSPPKIPPNSTLVFEVELFDFRGEDITEDEDGGIIRRIITKGEGYSKPNEGATVEVTVQGTHDERIFDERELKFEIGDGESFNLPAGLEKAIMAMEQGEEALFTIKPKYGYGNAGNAKLNIPAGATLQYKIKLTAFEKAKESWEMNTP-EKLEQSSIIKEKGTQYFKDGKYKQASVQYKKIVSWLEHESGLSEEDEKKAKTLRLAAHLNLAMCYLKLHEPNQALENCDKALEMDASNEKALFRRGEALFAMNEFDKARDDFQRVVQLYPANKAAKSQVMLCQKRLKEQHEKDKRIYANMFQKFAERDS 419          

HSP 2 Score: 59.3066 bits (142), Expect = 4.447e-9
Identity = 41/120 (34.17%), Postives = 59/120 (49.17%), Query Frame = 1
Query:  454 GKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGT-FDNVSFD-ERD----VDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDF 795
            G+DI+P KDG +++ I  +G G E P     V +   GT  D   FD  RD      FE+G      +I+  +I    MK  E         YA+G+ G S   IPPN+T+ +E+ + DF
Sbjct:   18 GEDITPKKDGGVLKVIKREGTGTELPMTGDKVFVHYVGTLLDGTHFDSSRDRGEKFSFELGKGQ---VIKAWDIGVATMKVGELCQLVCKPEYAYGSAG-SPPKIPPNSTLVFEVELFDF 133          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Match: fkbp5 (peptidyl-prolyl cis-trans isomerase FKBP5 [Source:NCBI gene;Acc:101157675])

HSP 1 Score: 278.87 bits (712), Expect = 5.746e-88
Identity = 154/405 (38.02%), Postives = 241/405 (59.51%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKAT-GSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            D++P+ DQGV+K +   G     P+ G +V VHY G        G+KFD SR+R++ FSF  G+GQV+K+WDIGV +M++ EVC L+CKP YAYG       IP N+++ FE+EL  ++G+ ++   DG +++ I  +G GY  P +   V + ++G  D   FD R+V F +G+A   G+  G++ A  KM+K E  +  +   Y FG+ GK+E+ I P+  + YE+ +KDF + KES+ +D   EK++ A   K +  +  + G    A   Y+R IS++E +     E+       +L+  LNLALC+L+  D    ++ C+K LEL+  +EKA YR+G+A + ++++  AK  F K+L  NP+N  A+ QI IC  KIKEH   +KK+Y +MF K  + D 
Sbjct:   64 DLTPNKDQGVIKVVQCPGFDVDRPMIGDRVTVHYTGRLL----TGKKFDCSRERKEPFSFNAGKGQVLKSWDIGVLSMQRGEVCTLLCKPEYAYGSAGNPDKIPPNASVVFEMELLSFEGESLT--DDGGVVRRIKIKGEGYSQPNDGASVDVYLEGRCDGRLFDSRNVSFIVGEAEDKGVPLGVDRAMDKMQKGECCLLYLKPKYGFGSKGKAEYKIGPDRDIVYEVTLKDFRRAKESWEMDIY-EKVNLAPGVKNKGNQYFKTGQYHQAVIQYQRIISWLEMECGTGIEQHQRIQEFVLTAHLNLALCFLRLKDFSHVVDNCNKVLELDENNEKAFYRRGEARLYRNEFGLAKEDFQKVLQVNPANQAARAQILICQNKIKEHHEQDKKIYANMFQKFAEQDA 461          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Match: fkbp5 (peptidyl-prolyl cis-trans isomerase FKBP5 [Source:NCBI gene;Acc:101157675])

HSP 1 Score: 278.87 bits (712), Expect = 8.199e-88
Identity = 154/405 (38.02%), Postives = 241/405 (59.51%), Query Frame = 1
Query:  100 DISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDT 1311
            D++P+ DQGV+K +   G     P+ G +V VHY G        G+KFD SR+R++ FSF  G+GQV+K+WDIGV +M++ EVC L+CKP YAYG       IP N+++ FE+EL  ++G+ ++   DG +++ I  +G GY  P +   V + ++G  D   FD R+V F +G+A   G+  G++ A  KM+K E  +  +   Y FG+ GK+E+ I P+  + YE+ +KDF + KES+ +D   EK++ A   K +  +  + G    A   Y+R IS++E +     E+       +L+  LNLALC+L+  D    ++ C+K LEL+  +EKA YR+G+A + ++++  AK  F K+L  NP+N  A+ QI IC  KIKEH   +KK+Y +MF K  + D 
Sbjct:   77 DLTPNKDQGVIKVVQCPGFDVDRPMIGDRVTVHYTGRLL----TGKKFDCSRERKEPFSFNAGKGQVLKSWDIGVLSMQRGEVCTLLCKPEYAYGSAGNPDKIPPNASVVFEMELLSFEGESLT--DDGGVVRRIKIKGEGYSQPNDGASVDVYLEGRCDGRLFDSRNVSFIVGEAEDKGVPLGVDRAMDKMQKGECCLLYLKPKYGFGSKGKAEYKIGPDRDIVYEVTLKDFRRAKESWEMDIY-EKVNLAPGVKNKGNQYFKTGQYHQAVIQYQRIISWLEMECGTGIEQHQRIQEFVLTAHLNLALCFLRLKDFSHVVDNCNKVLELDENNEKAFYRRGEARLYRNEFGLAKEDFQKVLQVNPANQAARAQILICQNKIKEHHEQDKKIYANMFQKFAEQDA 474          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Match: ENSORLT00000027603.1 (peptidyl-prolyl cis-trans isomerase FKBP1A [Source:NCBI gene;Acc:101166420])

HSP 1 Score: 101.679 bits (252), Expect = 9.808e-26
Identity = 53/108 (49.07%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELF 444
            GV  + I  G G+  P  G  VFVHYVGT      +G+KFDSSRDR + F F LG G+VI+ WD GVA M   ++ +L C P +AYG +     IP NSTL FE+EL 
Sbjct:    2 GVDVETIRPGDGKTFPQKGRTVFVHYVGTL----MNGKKFDSSRDRGEPFQFKLGAGEVIRGWDDGVARMSVGQLAKLTCSPDFAYGSRGYPPIIPPNSTLIFEVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Match: ENSORLT00000018301.2 (peptidyl-prolyl cis-trans isomerase FKBP1A [Source:NCBI gene;Acc:101168621])

HSP 1 Score: 94.3597 bits (233), Expect = 4.251e-23
Identity = 49/108 (45.37%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELF 444
            GV  + +  G G   P  G +V VHYVGT +    DG+ FDSSR R   F F +G  +VI+ W+ GVA M   +  +LIC P YAYG K   G IP N+TL F++EL 
Sbjct:    2 GVEIETLTPGDGRTFPKKGQRVVVHYVGTLA----DGKVFDSSRSRGKPFKFKIGHQEVIRGWEEGVAQMSVGQRAKLICSPDYAYGSKGHPGVIPPNATLTFDVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Match: SMESG000026331.1 (SMESG000026331.1)

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 430/430 (100.00%), Query Frame = 1
Query:   76 MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVXXXXXXXXXXXXXXXCYLKSSDCVKTIEECDKALELNPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH 1365
            MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHA+EFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVLRNNLLLSLRLNLALCYLKSSDCVKTIEECDKALEL+PASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH
Sbjct:    1 MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYESPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMKKCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLDTTKEKLDHASEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEKVLRNNLLLSLRLNLALCYLKSSDCVKTIEECDKALELDPASEKALYRKGQALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLYQSMFSKVGKGDTADKDKNEPVKLAENSTAH 430          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Match: SMESG000062712.1 (SMESG000062712.1)

HSP 1 Score: 101.679 bits (252), Expect = 7.763e-26
Identity = 56/112 (50.00%), Postives = 67/112 (59.82%), Query Frame = 1
Query:  121 QGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKA-TGSIPANSTLKFEIELFDWK 453
             GV+ + I +G     P  G  V VHYVGT +    +G+KFDSSRDR + F F +G G VIK WD GV  M K E  +L C P YAYG K   G IP NSTL FE+ L D+K
Sbjct:    1 MGVVVETIEQGDCVNYPKVGQNVTVHYVGTLT----NGKKFDSSRDRNEPFKFKIGTGSVIKGWDEGVLKMSKGEKAKLTCSPDYAYGSKGYPGLIPPNSTLVFEVLLIDFK 108          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Match: SMESG000028286.1 (SMESG000028286.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.472e-20
Identity = 49/111 (44.14%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWK 453
            GV  + I  G     P  G  V VHY GT +    +G+KFDSSRDR     F +G G+VIK WD GVA +   E  +L C P YAYG +     IP NS L F++EL   K
Sbjct:    2 GVQIERIKPGDESTYPKKGQTVEVHYTGTLT----NGKKFDSSRDRNRPLKFKIGMGEVIKGWDEGVAQLSLGERAKLTCSPDYAYGSEGIQDVIPPNSVLIFDVELISIK 108          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Match: SMESG000004790.1 (SMESG000004790.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.472e-20
Identity = 49/111 (44.14%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  124 GVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELFDWK 453
            GV  + I  G     P  G  V VHY GT +    +G+KFDSSRDR     F +G G+VIK WD GVA +   E  +L C P YAYG +     IP NS L F++EL   K
Sbjct:    2 GVQIERIKPGDESTYPKKGQTVEVHYTGTLT----NGKKFDSSRDRNRPLKFKIGMGEVIKGWDEGVAQLSLGERAKLTCSPDYAYGSEGIQDVIPPNSVLIFDVELISIK 108          
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Match: SMESG000026974.1 (SMESG000026974.1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.457e-17
Identity = 46/106 (43.40%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  130 LKKIINEGVGEAMPINGAKVFVHYVGTFSGGEKDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSYAYGDKATGS-IPANSTLKFEIELF 444
            +KK IN+   +A   +G  + +HY GT      DG KFDSS DR D   FTLG GQVIK WD+G+  M   E  +L       YGD  +   IP  +TL FE+EL 
Sbjct:   36 IKKRINDCTEKAK--DGDMIHMHYTGTLY---DDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELM 136          
The following BLAST results are available for this feature:
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FKBP48.412e-11645.02FKBP prolyl isomerase 4 [Source:HGNC Symbol;Acc:HG... [more]
FKBP53.252e-10343.87FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HG... [more]
FKBP53.252e-10343.87FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HG... [more]
FKBP53.252e-10343.87FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HG... [more]
FKBP53.715e-5348.76FKBP prolyl isomerase 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkb-65.455e-9341.65Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-65.455e-9341.65Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-21.265e-1944.44Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-17.708e-1845.56Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-17.708e-1845.56Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fkbp591.786e-8940.99gene:FBgn0029174 transcript:FBtr0079872[more]
Fkbp591.786e-8940.99gene:FBgn0029174 transcript:FBtr0342837[more]
Fkbp121.715e-2651.96gene:FBgn0013954 transcript:FBtr0086515[more]
Fkbp144.538e-1845.65gene:FBgn0010470 transcript:FBtr0342897[more]
Fkbp144.538e-1845.65gene:FBgn0010470 transcript:FBtr0071703[more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp48.474e-12044.47FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp46.216e-11945.22FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp52.797e-9540.10FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp54.035e-9540.10FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp1aa1.005e-2245.37FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcgr2.568e-11442.29glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918... [more]
gcgr7.852e-10841.39glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918... [more]
gcgr3.584e-10440.19glucagon receptor [Source:Xenbase;Acc:XB-GENE-5918... [more]
adam331.518e-1925.80ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
adam331.561e-1925.80ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fkbp47.624e-11244.80FK506 binding protein 4 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp55.504e-10443.44FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp55.504e-10443.44FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp55.504e-10443.44FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp55.504e-10443.44FK506 binding protein 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02790|FKBP4_HUMAN4.040e-11545.02Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo ... [more]
sp|Q9TRY0|FKBP4_BOVIN7.342e-11445.10Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos t... [more]
sp|P30416|FKBP4_MOUSE5.333e-11144.80Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus m... [more]
sp|Q9QVC8|FKBP4_RAT1.849e-11044.03Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattu... [more]
sp|P27124|FKBP4_RABIT1.101e-10444.03Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryct... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI730.000e+099.53Peptidylprolyl isomerase OS=Schmidtea mediterranea... [more]
A0A3Q3C5Q32.863e-11945.28Peptidylprolyl isomerase OS=Haplochromis burtoni O... [more]
A0A3Q0T3L25.790e-11946.10Peptidylprolyl isomerase OS=Amphilophus citrinellu... [more]
A0A3Q4ICR29.851e-11944.81Peptidylprolyl isomerase OS=Neolamprologus brichar... [more]
A0A3P8RFF01.320e-11845.05Peptidylprolyl isomerase OS=Astatotilapia callipte... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp41.622e-11945.11FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:1030... [more]
fkbp54.388e-8737.04FKBP prolyl isomerase 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp1aa8.104e-2345.37peptidyl-prolyl cis-trans isomerase FKBP1A [Source... [more]
fkbp1ab2.302e-2243.52peptidyl-prolyl cis-trans isomerase FKBP1A-like [S... [more]
fkbp1b3.129e-1941.28FKBP prolyl isomerase 1B [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp1aa1.431e-2344.44FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
fkbp1b3.484e-1848.78FKBP prolyl isomerase 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000004854.12.418e-1744.57pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 g... [more]
fkbp61.134e-1423.89FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp114.167e-1239.18FKBP prolyl isomerase 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FPR13.668e-2043.14Peptidyl-prolyl cis-trans isomerase (PPIase); bind... [more]
FPR23.994e-1641.38Membrane-bound peptidyl-prolyl cis-trans isomerase... [more]
FPR33.999e-1441.94Nucleolar peptidyl-prolyl cis-trans isomerase (PPI... [more]
FPR42.438e-1341.30Peptidyl-prolyl cis-trans isomerase (PPIase); nucl... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432079.162e-8238.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313325.362e-2151.11Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO402821.609e-1542.39Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO344181.676e-1539.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474984.142e-1439.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp48.191e-12044.83FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:1011... [more]
fkbp55.746e-8838.02peptidyl-prolyl cis-trans isomerase FKBP5 [Source:... [more]
fkbp58.199e-8838.02peptidyl-prolyl cis-trans isomerase FKBP5 [Source:... [more]
ENSORLT00000027603.19.808e-2649.07peptidyl-prolyl cis-trans isomerase FKBP1A [Source... [more]
ENSORLT00000018301.24.251e-2345.37peptidyl-prolyl cis-trans isomerase FKBP1A [Source... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026331.10.000e+099.53SMESG000026331.1[more]
SMESG000062712.17.763e-2650.00SMESG000062712.1[more]
SMESG000028286.11.472e-2044.14SMESG000028286.1[more]
SMESG000004790.11.472e-2044.14SMESG000004790.1[more]
SMESG000026974.17.457e-1743.40SMESG000026974.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030477
GenBankAFJ24727.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030477 ID=SMED30030477|Name=peptidyl prolyl cis trans isomerase FKBP-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1405bp
CTTTGTTTTATTAATTTATTAGAATCATTATAAATTAAAGTTAATCGAAT
TATCTAGAATATATTATCGACTACTATGGAGCAATACGCAGGATTCGAAG
ATATTTCTCCAGATAATGACCAGGGTGTATTAAAAAAGATTATCAACGAA
GGTGTTGGAGAAGCAATGCCAATAAATGGAGCCAAAGTTTTCGTACACTA
TGTTGGAACTTTTTCTGGTGGTGAGAAAGACGGTGAAAAATTTGATTCTA
GCAGAGATAGAGAAGATAAATTTTCATTTACTCTTGGAGAAGGTCAAGTT
ATTAAAGCATGGGATATTGGTGTGGCAACCATGAAGAAAAATGAAGTTTG
CGAATTAATTTGTAAACCTTCATATGCATATGGTGACAAAGCCACTGGAT
CTATTCCTGCCAATTCTACTTTAAAATTTGAAATTGAACTATTTGATTGG
AAAGGCAAGGACATAAGCCCGGGTAAAGATGGAAGCATTATTCAAACTAT
TGTTAACCAAGGCATTGGTTATGAATCTCCAAAGGAATGTGTTCCTGTTA
AAATATCTATTAAAGGAACATTCGACAATGTTTCTTTCGATGAGCGAGAC
GTTGATTTTGAAATTGGAGATGCCGCTAGTTTTGGCTTAATTCAAGGAAT
TGAAATCGCATGTAAAAAAATGAAAAAATGTGAAAAATCTATTTTCGAAA
TTTCCGCCAATTATGCTTTTGGTAATATTGGAAAAAGTGAGTGGAATATT
CCTCCAAATGCCACAGTTACTTATGAAATTCACATGAAAGATTTTGAAAA
AGTTAAGGAATCTTTCTCTTTGGATACAACGAAAGAAAAATTAGATCATG
CAAACGAATTTAAAACCAGAGCAACAGAAAAGTTACAAAATGGAAATGTT
ACTTATGCGACAAAACTGTATGAAAGATCAATTTCCTATATCGAATATGA
CAGTGAATTCAATGACGAAGAAAAGGTGTTGAGAAATAACCTTTTGTTAA
GCTTGAGGTTAAATCTTGCTTTGTGCTATTTAAAATCATCGGATTGCGTG
AAAACAATCGAGGAATGCGATAAAGCTTTGGAACTTAATCCTGCTAGTGA
GAAAGCTCTTTATAGAAAAGGACAGGCTTTGATTATGAAATCTGATTACG
AAGAAGCCAAATCAATGTTTGGGAAAATTTTATTGAATAATCCATCCAAT
TCCCAGGCGCAGAATCAAATTAAAATTTGCCTCGCCAAAATAAAGGAACA
TTTAAATATAGAGAAAAAACTTTATCAATCAATGTTTTCTAAAGTCGGAA
AGGGCGACACTGCCGATAAAGATAAAAATGAACCAGTGAAATTAGCTGAA
AATTCAACAGCTCATTAATTGTTGTTAAATAAATTGTTGTCATTTATAAA
AAAAA
back to top

protein sequence of SMED30030477-orf-1

>SMED30030477-orf-1 ID=SMED30030477-orf-1|Name=SMED30030477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MEQYAGFEDISPDNDQGVLKKIINEGVGEAMPINGAKVFVHYVGTFSGGE
KDGEKFDSSRDREDKFSFTLGEGQVIKAWDIGVATMKKNEVCELICKPSY
AYGDKATGSIPANSTLKFEIELFDWKGKDISPGKDGSIIQTIVNQGIGYE
SPKECVPVKISIKGTFDNVSFDERDVDFEIGDAASFGLIQGIEIACKKMK
KCEKSIFEISANYAFGNIGKSEWNIPPNATVTYEIHMKDFEKVKESFSLD
TTKEKLDHANEFKTRATEKLQNGNVTYATKLYERSISYIEYDSEFNDEEK
VLRNNLLLSLRLNLALCYLKSSDCVKTIEECDKALELNPASEKALYRKGQ
ALIMKSDYEEAKSMFGKILLNNPSNSQAQNQIKICLAKIKEHLNIEKKLY
QSMFSKVGKGDTADKDKNEPVKLAENSTAH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR031212FKBP4
IPR023566PPIase_FKBP
IPR019734TPR_repeat
IPR001179PPIase_FKBP_dom
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0005528FK506 binding
GO:0016853isomerase activity
GO:0031072heat shock protein binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 308..341
e-value: 0.33
score: 20.0
coord: 342..375
e-value: 0.16
score: 21.1
coord: 259..292
e-value: 190.0
score: 3.7
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 308..341
score: 7.67
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 342..375
score: 9.411
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00254FKBP_Ccoord: 32..122
e-value: 4.0E-26
score: 91.2
coord: 151..237
e-value: 8.0E-10
score: 38.9
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50059FKBP_PPIASEcoord: 35..126
score: 24.877
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50059FKBP_PPIASEcoord: 155..241
score: 14.715
NoneNo IPR availableGENE3DG3DSA:3.10.50.40coord: 5..136
e-value: 4.6E-43
score: 148.1
NoneNo IPR availableGENE3DG3DSA:3.10.50.40coord: 137..248
e-value: 3.9E-25
score: 90.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 411..430
NoneNo IPR availableSUPERFAMILYSSF54534FKBP-likecoord: 130..244
NoneNo IPR availableSUPERFAMILYSSF54534FKBP-likecoord: 15..127
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 251..416
e-value: 2.6E-41
score: 142.9
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 253..407
IPR031212Peptidyl-prolyl cis-trans isomerase FKBP4PANTHERPTHR10516:SF25PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP4coord: 12..413
IPR023566Peptidyl-prolyl cis-trans isomerase, FKBP-typePANTHERPTHR10516PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 12..413
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 308..375
score: 15.425