Ribosomal RNA methyltransferase Nop2

Overview
NameRibosomal RNA methyltransferase Nop2
Smed IDSMED30030466
Length (bp)1653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal RNA methyltransferase Nop2 (SMED30030466) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal RNA methyltransferase Nop2 (SMED30030466) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal RNA methyltransferase Nop2 (SMED30030466) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal RNA methyltransferase Nop2 (SMED30030466) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030466

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030466h1SMcG0003629 SmedASXL_013060SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30030466h1SMcG0003629 dd_Smed_v4_7417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30030466h1SMcG0003629 dd_Smed_v4_7417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30030466h1SMcG0003629 dd_Smed_v4_7417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030466h1SMcG0003629 SMED30030466smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Match: NOP2 (NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGNC:7867])

HSP 1 Score: 374.4 bits (960), Expect = 2.914e-122
Identity = 195/368 (52.99%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+   IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  228 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEK--DILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 590          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Match: NOP2 (NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGNC:7867])

HSP 1 Score: 374.4 bits (960), Expect = 2.914e-122
Identity = 195/368 (52.99%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+   IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  228 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEK--DILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 590          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Match: NOP2 (NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGNC:7867])

HSP 1 Score: 378.637 bits (971), Expect = 1.031e-121
Identity = 196/368 (53.26%), Postives = 269/368 (73.10%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D  IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  228 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKD--ILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 590          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Match: NOP2 (NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGNC:7867])

HSP 1 Score: 378.637 bits (971), Expect = 1.031e-121
Identity = 196/368 (53.26%), Postives = 269/368 (73.10%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D  IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  228 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKD--ILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 590          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Match: NOP2 (NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGNC:7867])

HSP 1 Score: 378.637 bits (971), Expect = 1.114e-121
Identity = 196/368 (53.26%), Postives = 269/368 (73.10%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D  IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  232 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKD--ILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 594          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Match: nol-2 (NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:A0A0M7RDQ9])

HSP 1 Score: 332.028 bits (850), Expect = 7.578e-106
Identity = 170/365 (46.58%), Postives = 258/365 (70.68%), Query Frame = 2
Query:  560 VTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIF--NKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVE-TLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVK--NFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKV----GGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHK 1624
            V +L+ +  RI   +++L ++K  +   KS   R+ YV    +DLC ++ YN++L+ KF ++F    +L +FL A++  RP+TIR N+LK +RR L + LI R  NV+    ++KVG+VV+ ++  +GATPEYLAGHY++QG +S+LPVMALAP+ G+R+LD+C+APGGKTSHIA +M N+G++FAND N  R +A+  NL R+GV NTVV CN G     K++   F+R+L DAPC+GTGVI KD+S+K SKD +D++    +Q+QL+ SA+D+       GGY+VYSTCS+LVEENE V+++   +R+ ++  TGL  G+ G+  FR   F+ ++  T+RYYPH +N+DGF++AK++K+ + K
Sbjct:  153 VPNLEIVKQRIADVIQVLGDFKNRRDPQKS---RENYVEVLKKDLCSQYGYNDYLMGKFMDLFPNGAELLEFLEANDNPRPVTIRANSLKVKRRDLAKNLINRGMNVDPAADWTKVGLVVYDSQVPVGATPEYLAGHYMIQGLNSLLPVMALAPQPGDRVLDMCSAPGGKTSHIAALMKNSGVLFANDANFTRCRAIIGNLHRLGVNNTVV-CNLGGEEFSKIRPNGFDRILLDAPCSGTGVIWKDQSVKTSKDSQDVQRRHTMQRQLILSALDSLDANSPNGGYLVYSTCSVLVEENEAVVNFLLERRHCELVPTGLSIGVDGYTRFRDYRFHPSLSMTKRYYPHVHNIDGFYVAKIKKLSNAK 513          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Match: nol-2 (NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:A0A0M7RDQ9])

HSP 1 Score: 261.536 bits (667), Expect = 1.119e-81
Identity = 130/253 (51.38%), Postives = 191/253 (75.49%), Query Frame = 2
Query:  887 FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVK--NFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKV----GGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHK 1624
            ++KVG+VV+ ++  +GATPEYLAGHY++QG +S+LPVMALAP+ G+R+LD+C+APGGKTSHIA +M N+G++FAND N  R +A+  NL R+GV NTVV CN G     K++   F+R+L DAPC+GTGVI KD+S+K SKD +D++    +Q+QL+ SA+D+       GGY+VYSTCS+LVEENE V+++   +R+ ++  TGL  G+ G+  FR   F+ ++  T+RYYPH +N+DGF++AK++K+ + K
Sbjct:    9 WTKVGLVVYDSQVPVGATPEYLAGHYMIQGLNSLLPVMALAPQPGDRVLDMCSAPGGKTSHIAALMKNSGVLFANDANFTRCRAIIGNLHRLGVNNTVV-CNLGGEEFSKIRPNGFDRILLDAPCSGTGVIWKDQSVKTSKDSQDVQRRHTMQRQLILSALDSLDANSPNGGYLVYSTCSVLVEENEAVVNFLLERRHCELVPTGLSIGVDGYTRFRDYRFHPSLSMTKRYYPHVHNIDGFYVAKIKKLSNAK 260          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Match: nsun-5 (Nop2 (NOP2)/SUN domain family member [Source:UniProtKB/TrEMBL;Acc:Q9NAA8])

HSP 1 Score: 94.3597 bits (233), Expect = 3.346e-21
Identity = 71/224 (31.70%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  959 HYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRV---LCDAPCTGTG-VXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGY--VVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            + ILQ  +S LP   L P+ G ++ D CAAPG KTSH A IM N G ++A D   DR+  +   L    V      C D        K F++V   + D PC+G+G V   D+    + ++E L+ L  +Q  +L  A+   K+ G    VYSTCS+  EENEQV+D       V+ +      +     +R     +  +   R  P     +GFF+A  +++
Sbjct:   61 YLILQDKASCLPAFLLNPRPGSQVFDTCAAPGMKTSHAAAIMENQGKVWAMDRAADRVATMKQLLDASKVAIASSFCGDFLKTDVTDKKFSKVKFAIVDPPCSGSGIVKRMDEITGGNAEKERLEKLKNLQAMILKHAL---KLPGLKRAVYSTCSVHEEENEQVVDEVLLDTYVRQNYVLKKNVLPEWTYRGLKTYEVGEHCLRANPKVTLTNGFFVAVFERV 281          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Match: nsun-5 (Nop2 (NOP2)/SUN domain family member [Source:UniProtKB/TrEMBL;Acc:Q9NAA8])

HSP 1 Score: 93.5893 bits (231), Expect = 1.692e-20
Identity = 71/224 (31.70%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  959 HYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRV---LCDAPCTGTG-VXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGY--VVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            + ILQ  +S LP   L P+ G ++ D CAAPG KTSH A IM N G ++A D   DR+  +   L    V      C D        K F++V   + D PC+G+G V   D+    + ++E L+ L  +Q  +L  A+   K+ G    VYSTCS+  EENEQV+D       V+ +      +     +R     +  +   R  P     +GFF+A  +++
Sbjct:  151 YLILQDKASCLPAFLLNPRPGSQVFDTCAAPGMKTSHAAAIMENQGKVWAMDRAADRVATMKQLLDASKVAIASSFCGDFLKTDVTDKKFSKVKFAIVDPPCSGSGIVKRMDEITGGNAEKERLEKLKNLQAMILKHAL---KLPGLKRAVYSTCSVHEEENEQVVDEVLLDTYVRQNYVLKKNVLPEWTYRGLKTYEVGEHCLRANPKVTLTNGFFVAVFERV 371          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Match: nsun-5 (Nop2 (NOP2)/SUN domain family member [Source:UniProtKB/TrEMBL;Acc:Q9NAA8])

HSP 1 Score: 93.9745 bits (232), Expect = 2.429e-20
Identity = 71/224 (31.70%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  959 HYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRV---LCDAPCTGTG-VXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGY--VVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            + ILQ  +S LP   L P+ G ++ D CAAPG KTSH A IM N G ++A D   DR+  +   L    V      C D        K F++V   + D PC+G+G V   D+    + ++E L+ L  +Q  +L  A+   K+ G    VYSTCS+  EENEQV+D       V+ +      +     +R     +  +   R  P     +GFF+A  +++
Sbjct:  215 YLILQDKASCLPAFLLNPRPGSQVFDTCAAPGMKTSHAAAIMENQGKVWAMDRAADRVATMKQLLDASKVAIASSFCGDFLKTDVTDKKFSKVKFAIVDPPCSGSGIVKRMDEITGGNAEKERLEKLKNLQAMILKHAL---KLPGLKRAVYSTCSVHEEENEQVVDEVLLDTYVRQNYVLKKNVLPEWTYRGLKTYEVGEHCLRANPKVTLTNGFFVAVFERV 435          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Match: CG8545 (gene:FBgn0033741 transcript:FBtr0087934)

HSP 1 Score: 384.415 bits (986), Expect = 2.248e-123
Identity = 197/407 (48.40%), Postives = 282/407 (69.29%), Query Frame = 2
Query:  428 LVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAID----ACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            L + E+++    DD+M   +       D+ ++    + G++  K   L  +  RIK    +L ++K  +  ++S   R  Y++    DLC+ +SYNEFL++K  ++    +L ++L ASE  RP+TIRTNTLKTRRR L  ALI R  N++ L +++KVG+VVF+++  +GATPEYLAGHY++QG+SS+LPVMALAP++ ERILD+C+APGGK SHIA IM NTG++FAND N+DR+KA+ +N  R+G++N VV C DG      +  F+RVL DAPCTGTGV+SKD S+K +K E D++    +Q++LL +AID        GGY+VYSTCS+L EENE VIDYA +KRNVK+  TGL FG++GF  FR   F+ +++ T+RYYPH +NMDGF++AKL+K  +  P
Sbjct:  247 LKKREAEEAQLADDEMLETV-------DKQDVFQLPVEGEETEKDLTLQEVQQRIKDVSLVLSDFKRYRQADRS---RGEYIDLLRRDLCLYYSYNEFLMEKLMDMLPLTELMEYLEASEIARPLTIRTNTLKTRRRDLAGALINRGVNLDPLGKWTKVGLVVFNSQVPLGATPEYLAGHYMIQGASSLLPVMALAPQENERILDMCSAPGGKGSHIASIMKNTGVLFANDSNRDRIKAIVANFHRLGIVNAVVSCEDGTKFRNIMTGFDRVLLDAPCTGTGVVSKDPSVKTTKSEVDVQRCYNLQRKLLLTAIDCTDAKSSTGGYIVYSTCSVLPEENEWVIDYALKKRNVKLVPTGLDFGVEGFTKFRQHRFHPSLNLTKRYYPHTHNMDGFYVAKLKKFSNTIP 643          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Match: CG11109 (gene:FBgn0037200 transcript:FBtr0078553)

HSP 1 Score: 105.916 bits (263), Expect = 1.473e-24
Identity = 77/236 (32.63%), Postives = 120/236 (50.85%), Query Frame = 2
Query:  965 ILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVM------NTVVICNDGRSIHK--------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC---IQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDR-TRRYYPHENNMD--GFFLAKLQKI 1612
            +LQ   S++ V  L P+ GERILD+CAAPG KTSHIA++M + G + A D +  R++++   L     +      +T  +  D  S             ++F+R+L DAPC+G G        + S   + +K+L+    IQ++L   A+   + GG +VYSTC++  +E E ++ +A RK  V++  T      G        F     R  +R+ P   N D  GFF+AK QKI
Sbjct:  129 LLQNLPSIVCVRVLDPQPGERILDMCAAPGNKTSHIAELMGDRGSVVALDNSASRVRSMLPKLGHYKSITAHVFNSTEAVAADAPSAPVGEFTGPPFPCESFDRILLDAPCSGLG-----NRPQLSCSIKQVKVLSSYPHIQRRLFEQAVQLVRPGGILVYSTCTVTEDECECLVAWALRK-FVELRLTDATPRWGGPGLPLPGFEACKSRLLQRFGPSGANADTVGFFIAKFQKI 358          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Match: CG11109 (gene:FBgn0037200 transcript:FBtr0078552)

HSP 1 Score: 106.301 bits (264), Expect = 2.669e-24
Identity = 77/236 (32.63%), Postives = 120/236 (50.85%), Query Frame = 2
Query:  965 ILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVM------NTVVICNDGRSIHK--------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC---IQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDR-TRRYYPHENNMD--GFFLAKLQKI 1612
            +LQ   S++ V  L P+ GERILD+CAAPG KTSHIA++M + G + A D +  R++++   L     +      +T  +  D  S             ++F+R+L DAPC+G G        + S   + +K+L+    IQ++L   A+   + GG +VYSTC++  +E E ++ +A RK  V++  T      G        F     R  +R+ P   N D  GFF+AK QKI
Sbjct:  210 LLQNLPSIVCVRVLDPQPGERILDMCAAPGNKTSHIAELMGDRGSVVALDNSASRVRSMLPKLGHYKSITAHVFNSTEAVAADAPSAPVGEFTGPPFPCESFDRILLDAPCSGLG-----NRPQLSCSIKQVKVLSSYPHIQRRLFEQAVQLVRPGGILVYSTCTVTEDECECLVAWALRK-FVELRLTDATPRWGGPGLPLPGFEACKSRLLQRFGPSGANADTVGFFIAKFQKI 439          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Match: Nsun5 (gene:FBgn0259704 transcript:FBtr0299957)

HSP 1 Score: 82.4185 bits (202), Expect = 2.104e-16
Identity = 54/183 (29.51%), Postives = 92/183 (50.27%), Query Frame = 2
Query:  899 GMVVFSAKCA--IGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSI-HKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVI 1438
            G+++F AK +      P   +  +ILQ  ++ L    LAP  G  +LD+CAAPG KT HI  +M N G I++ + +  R   +       G      I  D  ++  ++  +   +L D  C+G+G+ ++       K+++ L+ L  +Q ++L  A+ A      + Y TCS+  EENEQV+
Sbjct:  186 GVLIFPAKWSNYWVRHPLVHSKRFILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDIVKPILGDALNLTPERFPDVEYILVDPSCSGSGMQNRMTVCDEPKEDKRLQKLQGLQIKILSHAMGAFPNVKRIAYCTCSLWKEENEQVV 368          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Match: Nsun2 (gene:FBgn0026079 transcript:FBtr0070669)

HSP 1 Score: 79.337 bits (194), Expect = 3.306e-15
Identity = 54/186 (29.03%), Postives = 88/186 (47.31%), Query Frame = 2
Query:  944 EYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIM--------ANTGIIFANDINKDRLKAVTSNLSRMG-------------VMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVI 1438
            E  AG    Q + SM+P + L  +  +++LD+CAAPG KT+ + + +           G + AND++ +R   +     R+                N V    DG    K +  F+++LCD PC+G G + K+  I    +      L  IQ +++    +  +VGG +VYSTCS+   ENE V+
Sbjct:  152 ETTAGGISRQEAVSMIPPIVLDVRPTDKVLDMCAAPGSKTAQLIEALHAAPEEHKIPPGFVLANDVDNNRCYMLVHQAKRLNSPCLLVTNHDSSVFPNLVTTKPDG---SKAILKFDKILCDVPCSGDGTLRKNPDIWLKWNLAQAYNLHGIQYRIVRRGAEMLEVGGRLVYSTCSLNPIENEAVL 334          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Match: nop2 (NOP2 nucleolar protein homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-050309-7])

HSP 1 Score: 377.481 bits (968), Expect = 2.969e-122
Identity = 194/362 (53.59%), Postives = 265/362 (73.20%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICN-DGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL +++ RIK N+++L N+     K +  + R  Y++    DLC  +SYN+FLI K  ++F+  +L  FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V++ +   IGATPEYLAGHY+LQG+SS LPVMAL+P++GE +LD+ AAPGGKT+++AQ+M NTG+I AND N DRLK+V  N+ R+GV N  VICN DGR   K +  F+RVL DAPC+GTGVISKD ++K  KDE D+     +QK+L+ SAID+     + GGY+VY TCSI+VEENE V+DYA +KRNVK+  TGL FG +GF  F+ K F+ ++  +RR+YPH +NMDGFF+AKL+K+ +  P
Sbjct:  233 DLKTIHQRIKDNVDVLSNF---NEKREEGKERSEYLSLLRADLCTYYSYNQFLISKLMDLFSLSELIDFLEANEVHRPVTIRTNTLKTRRRDLAQALINRGVNLDPLGKWSKVGLVIYDSSVPIGATPEYLAGHYMLQGASSFLPVMALSPQEGESVLDMSAAPGGKTTYMAQLMRNTGMIVANDANVDRLKSVVGNIHRLGVTN-AVICNYDGRQFPKVMGGFDRVLLDAPCSGTGVISKDPAVKTGKDEADILRSAHLQKELILSAIDSVNADSQTGGYLVYCTCSIMVEENEWVVDYALKKRNVKLVPTGLDFGKEGFTRFKEKRFHPSLKLSRRFYPHSHNMDGFFVAKLKKLSNTIP 590          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Match: nsun5 (NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2476])

HSP 1 Score: 112.079 bits (279), Expect = 8.111e-27
Identity = 76/239 (31.80%), Postives = 122/239 (51.05%), Query Frame = 2
Query:  902 MVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSI---HKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            ++VFS K        Y AGH ILQG +S LP   L P  G  ++D CAAPG KTSH+A IM N G +FA D++  RL  +++ L R GV    +   D   +   + + K    +L D  C+G+G++     +  ++++  L+ L   Q   L  A+   ++   +VYSTCSI  +ENE+V+  AC +RN        F +   +    +  ++ + +  R    +    GFF+A L++
Sbjct:   86 LLVFSGKTDFHDHFLYKAGHIILQGKASCLPAFLLNPPVGSHVIDACAAPGNKTSHLAAIMKNKGKLFAFDLDAKRLSTMSTLLLRAGVTCHKLANQDFLKVDPQNSEYKEVKYILLDPSCSGSGMVCLRDELPETQEDGRLQALAAFQLHCLNHALQFPQL-ERIVYSTCSIHSQENEEVVT-ACLQRNPG------FRLVHLLPDWPERGHEPLTQCLRASTAKTRTHGFFVAMLER 316          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Match: nsun5 (NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2476])

HSP 1 Score: 110.923 bits (276), Expect = 1.080e-25
Identity = 76/239 (31.80%), Postives = 122/239 (51.05%), Query Frame = 2
Query:  902 MVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSI---HKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            ++VFS K        Y AGH ILQG +S LP   L P  G  ++D CAAPG KTSH+A IM N G +FA D++  RL  +++ L R GV    +   D   +   + + K    +L D  C+G+G++     +  ++++  L+ L   Q   L  A+   ++   +VYSTCSI  +ENE+V+  AC +RN        F +   +    +  ++ + +  R    +    GFF+A L++
Sbjct:  186 LLVFSGKTDFHDHFLYKAGHIILQGKASCLPAFLLNPPVGSHVIDACAAPGNKTSHLAAIMKNKGKLFAFDLDAKRLSTMSTLLLRAGVTCHKLANQDFLKVDPQNSEYKEVKYILLDPSCSGSGMVCLRDELPETQEDGRLQALAAFQLHCLNHALQFPQL-ERIVYSTCSIHSQENEEVVT-ACLQRNPG------FRLVHLLPDWPERGHEPLTQCLRASTAKTRTHGFFVAMLER 416          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:ZDB-GENE-080808-8])

HSP 1 Score: 102.449 bits (254), Expect = 8.557e-23
Identity = 70/253 (27.67%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  965 ILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHK---------------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYA-----CRKRNVKISETGLFGIKGF----------------MNFRAKHFNQNMDRTRRYYPHENNMD--GFFLAKLQK 1609
             LQ   S++    L P+ GER+LD+CAAPGGKT+HIA +M N G++ A +  + +++ +  N   + +      C +  SIH                  ++F+R+L DAPC+G G         + K+    + L   Q++L  +A+   K GG +VYSTC++ + ENE+ + +A     C     ++   G  G+ G                 + +  + F  ++++     P + N D  GFF+AK  K
Sbjct:  215 FLQNLPSVVVGYVLGPRPGERVLDMCAAPGGKTTHIASLMGNQGVVVALEKVRSKMEKILRNAQMLKLDCIKAYCCN--SIHAVSSDPAQEYTEGPPFPEESFDRILLDAPCSGLGQRPNMSYSWSLKEVCSYQPL---QRKLFTTAVRLLKSGGVLVYSTCTVTLAENEEQVSWALKTFPCLTLQPQVPHVGSEGMLGAGLSCEQRRLLQRFRPELGWTGERFTFSLEK----LPQDANQDTIGFFIAKFSK 458          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:ZDB-GENE-080808-8])

HSP 1 Score: 102.449 bits (254), Expect = 8.557e-23
Identity = 70/253 (27.67%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  965 ILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHK---------------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYA-----CRKRNVKISETGLFGIKGF----------------MNFRAKHFNQNMDRTRRYYPHENNMD--GFFLAKLQK 1609
             LQ   S++    L P+ GER+LD+CAAPGGKT+HIA +M N G++ A +  + +++ +  N   + +      C +  SIH                  ++F+R+L DAPC+G G         + K+    + L   Q++L  +A+   K GG +VYSTC++ + ENE+ + +A     C     ++   G  G+ G                 + +  + F  ++++     P + N D  GFF+AK  K
Sbjct:  215 FLQNLPSVVVGYVLGPRPGERVLDMCAAPGGKTTHIASLMGNQGVVVALEKVRSKMEKILRNAQMLKLDCIKAYCCN--SIHAVSSDPAQEYTEGPPFPEESFDRILLDAPCSGLGQRPNMSYSWSLKEVCSYQPL---QRKLFTTAVRLLKSGGVLVYSTCTVTLAENEEQVSWALKTFPCLTLQPQVPHVGSEGMLGAGLSCEQRRLLQRFRPELGWTGERFTFSLEK----LPQDANQDTIGFFIAKFSK 458          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Match: ENSXETT00000026071.1 (NOP2 nucleolar protein [Source:NCBI gene;Acc:100490904])

HSP 1 Score: 363.999 bits (933), Expect = 5.917e-117
Identity = 196/414 (47.34%), Postives = 278/414 (67.15%), Query Frame = 2
Query:  410 ENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDA----CKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            E D + L   ES  Q N D   E + +   EE+ E  L T            DL ++  RIK  + +LQN+    ++    ++R  Y+    +DL   +SY +++I+    +F   +L  FL A E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SK G+V++ +   IGATPEYLAGHY+LQG+SS+LPV+ALAP++ ER+LD+C APGGKTS++AQ+M NTGI+ AND+N DRL++V  NL R+GV N ++   DGR I K +  F+RVL DAPC+GTG+ISKD ++K +K  +D++    IQK+L+ SAIDA     + GG++VY TCSI VEENE V+DYA +KRNVK+  TGL FG +GF+ F+ + F+ ++ + RR+YPH +NMDGFF+AKL+K  +  P+
Sbjct:  200 EKDVKALTGEESTIQLNVDS--EELFQLPTEEELEKELST----------APDLVTVQERIKDIVGVLQNF----AQRGGGRTRQEYLKVLKKDLATYYSYGDYMIETLSELFPVSELVDFLEACEVQRPITIRTNTLKTRRRDLAQALINRSVNLDPLGKWSKTGLVIYDSSVPIGATPEYLAGHYMLQGASSLLPVIALAPQENERVLDMCCAPGGKTSYMAQLMKNTGIVVANDMNADRLRSVVGNLHRLGVTNCIISNYDGRQISKVLGGFDRVLLDAPCSGTGIISKDPAVKTNKSVQDVQRCAHIQKELILSAIDALDAQSQTGGFMVYCTCSITVEENECVVDYALKKRNVKLVPTGLDFGKEGFVRFKERRFHPSLRQARRFYPHTHNMDGFFIAKLRKFSNTIPK 597          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Match: ENSXETT00000038204.1 (NOP2 nucleolar protein [Source:NCBI gene;Acc:100490904])

HSP 1 Score: 358.607 bits (919), Expect = 6.684e-117
Identity = 195/410 (47.56%), Postives = 276/410 (67.32%), Query Frame = 2
Query:  422 ENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDA----CKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            E L   ES  Q N D   E + +   EE+ E  L T            DL ++  RIK  + +LQN+    ++    ++R  Y+    +DL   +SY +++I+    +F   +L  FL A E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SK G+V++ +   IGATPEYLAGHY+LQG+SS+LPV+ALAP++ ER+LD+C APGGKTS++AQ+M NTGI+ AND+N DRL++V  NL R+GV N ++   DGR I K +  F+RVL DAPC+GTG+ISKD ++K +K  +D++    IQK+L+ SAIDA     + GG++VY TCSI VEENE V+DYA +KRNVK+  TGL FG +GF+ F+ + F+ ++ + RR+YPH +NMDGFF+AKL+K  +  P+
Sbjct:  162 EALTGEESTIQLNVDS--EELFQLPTEEELEKELST----------APDLVTVQERIKDIVGVLQNF----AQRGGGRTRQEYLKVLKKDLATYYSYGDYMIETLSELFPVSELVDFLEACEVQRPITIRTNTLKTRRRDLAQALINRSVNLDPLGKWSKTGLVIYDSSVPIGATPEYLAGHYMLQGASSLLPVIALAPQENERVLDMCCAPGGKTSYMAQLMKNTGIVVANDMNADRLRSVVGNLHRLGVTNCIISNYDGRQISKVLGGFDRVLLDAPCSGTGIISKDPAVKTNKSVQDVQRCAHIQKELILSAIDALDAQSQTGGFMVYCTCSITVEENECVVDYALKKRNVKLVPTGLDFGKEGFVRFKERRFHPSLRQARRFYPHTHNMDGFFIAKLRKFSNTIPK 555          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Match: ENSXETT00000026058.1 (NOP2 nucleolar protein [Source:NCBI gene;Acc:100490904])

HSP 1 Score: 359.377 bits (921), Expect = 5.761e-116
Identity = 189/394 (47.97%), Postives = 270/394 (68.53%), Query Frame = 2
Query:  470 DMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDA----CKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            D E + +   EE+ E  L T            DL ++  RIK  + +LQN+    ++    ++R  Y+    +DL   +SY +++I+    +F   +L  FL A E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SK G+V++ +   IGATPEYLAGHY+LQG+SS+LPV+ALAP++ ER+LD+C APGGKTS++AQ+M NTGI+ AND+N DRL++V  NL R+GV N ++   DGR I K +  F+RVL DAPC+GTG+ISKD ++K +K  +D++    IQK+L+ SAIDA     + GG++VY TCSI VEENE V+DYA +KRNVK+  TGL FG +GF+ F+ + F+ ++ + RR+YPH +NMDGFF+AKL+K  +  P+
Sbjct:  153 DSEELFQLPTEEELEKELST----------APDLVTVQERIKDIVGVLQNF----AQRGGGRTRQEYLKVLKKDLATYYSYGDYMIETLSELFPVSELVDFLEACEVQRPITIRTNTLKTRRRDLAQALINRSVNLDPLGKWSKTGLVIYDSSVPIGATPEYLAGHYMLQGASSLLPVIALAPQENERVLDMCCAPGGKTSYMAQLMKNTGIVVANDMNADRLRSVVGNLHRLGVTNCIISNYDGRQISKVLGGFDRVLLDAPCSGTGIISKDPAVKTNKSVQDVQRCAHIQKELILSAIDALDAQSQTGGFMVYCTCSITVEENECVVDYALKKRNVKLVPTGLDFGKEGFVRFKERRFHPSLRQARRFYPHTHNMDGFFIAKLRKFSNTIPK 532          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Match: ENSXETT00000026014.1 (NOP2 nucleolar protein [Source:NCBI gene;Acc:100490904])

HSP 1 Score: 354.755 bits (909), Expect = 1.575e-115
Identity = 183/367 (49.86%), Postives = 261/367 (71.12%), Query Frame = 2
Query:  551 VIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDA----CKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            V    DL ++  RIK  + +LQN+    ++    ++R  Y+    +DL   +SY +++I+    +F   +L  FL A E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SK G+V++ +   IGATPEYLAGHY+LQG+SS+LPV+ALAP++ ER+LD+C APGGKTS++AQ+M NTGI+ AND+N DRL++V  NL R+GV N ++   DGR I K +  F+RVL DAPC+GTG+ISKD ++K +K  +D++    IQK+L+ SAIDA     + GG++VY TCSI VEENE V+DYA +KRNVK+  TGL FG +GF+ F+ + F+ ++ + RR+YPH +NMDGFF+AKL+K  +  P+
Sbjct:  190 VSTAPDLVTVQERIKDIVGVLQNF----AQRGGGRTRQEYLKVLKKDLATYYSYGDYMIETLSELFPVSELVDFLEACEVQRPITIRTNTLKTRRRDLAQALINRSVNLDPLGKWSKTGLVIYDSSVPIGATPEYLAGHYMLQGASSLLPVIALAPQENERVLDMCCAPGGKTSYMAQLMKNTGIVVANDMNADRLRSVVGNLHRLGVTNCIISNYDGRQISKVLGGFDRVLLDAPCSGTGIISKDPAVKTNKSVQDVQRCAHIQKELILSAIDALDAQSQTGGFMVYCTCSITVEENECVVDYALKKRNVKLVPTGLDFGKEGFVRFKERRFHPSLRQARRFYPHTHNMDGFFIAKLRKFSNTIPK 552          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Match: sdsl (serine dehydratase like [Source:Xenbase;Acc:XB-GENE-922203])

HSP 1 Score: 100.908 bits (250), Expect = 3.687e-22
Identity = 60/185 (32.43%), Postives = 99/185 (53.51%), Query Frame = 2
Query:  950 LAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVIC-NDGRSIHKK-------------VKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC---IQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR 1453
            L+G+  LQ   S +    L P+ GERILD+CAAPGGKT+HIA +M + G + A D   ++++ +  N S + +      C N  +++  +              K+F+R+L DAPC+G G                LK LT    +Q++L  +A++  + GG +VYSTC++ + ENE+ + +A +
Sbjct:  212 LSGYIFLQNLPSAVVSHVLNPQPGERILDMCAAPGGKTTHIATLMKDQGEVIAMDKIANKVEKIKHNASVLKLKCIKAFCFNSTKAVRDQNSPSEQGDGPPFLPKSFDRILLDAPCSGMG------QRPNMVCPFSLKELTSYQPLQRKLFTAAVELLRPGGTLVYSTCTVTLSENEEQVAWALK 390          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Match: Nop2 (NOP2 nucleolar protein [Source:MGI Symbol;Acc:MGI:107891])

HSP 1 Score: 379.022 bits (972), Expect = 3.790e-122
Identity = 201/406 (49.51%), Postives = 281/406 (69.21%), Query Frame = 2
Query:  434 ESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAID----ACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            ++E D Q N +D+ E+ +     E D++             +  DL  ++ RI+  + +L+++    ++ +  +SR  Y+++  +DL   +SY +FL+ K   +F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS+IAQ+M NTG+I AND N DRLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D++    +QK+LL SAID    A K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  F+A+ F+  +  TRR+YPH +NMDGFF+AK +K  +  P+
Sbjct:  189 KAEGDLQINVEDE-EAFVLPPAGETDQDG------------QAPDLQRVHKRIQDIVGVLRDFG---AQREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQ 578          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Match: Nsun5 (NOL1/NOP2/Sun domain family, member 5 [Source:MGI Symbol;Acc:MGI:2140844])

HSP 1 Score: 108.612 bits (270), Expect = 7.073e-25
Identity = 90/299 (30.10%), Postives = 144/299 (48.16%), Query Frame = 2
Query:  794 PMTIRTNTLKTRRRALKEALIK-------RDCNVETLQFSK----------VGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRV---LCDAPCTGTGVXXXX--XXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRK-----RNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            P  +R NTLKTR     +   +       R  ++E L+  K            ++VF A+  +   P Y AGH ILQ  +S LP M L+P  G  ++D CAAPG KTS+IA ++ N G IFA D +  RL A+ + ++R GV    +   D  ++    + +++V   L D  C+G+G++S+   +  + +  +E L+ L   Q++ LC A+    +   +VYSTCS+  EENE V+  A +      R   +  T  +  +G   F         +   R  P      GFF+A  ++
Sbjct:  135 PRFVRVNTLKTRPEDAIDYFKRQGFSYQGRASSLEDLRALKGQHFLLDPLLPELLVFPAQTDLHEHPLYRAGHLILQDKASCLPAMLLSPPPGSHVIDACAAPGNKTSYIAALLKNQGKIFAFDQDAKRLAAMATLVARAGVSCCELAEKDFLTVSPSDQRYSQVQYILLDPSCSGSGMLSRQLEEHGEGTPSKERLQALAGFQQRALCHALRFPSL-QRLVYSTCSLCQEENEDVVQEALQHNSGTFRLAPVLPT--WPHRGLSTF------PGSEHCLRASPETTLTGGFFIAVFER 424          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Match: Nsun6 (NOL1/NOP2/Sun domain family member 6 [Source:MGI Symbol;Acc:MGI:1921705])

HSP 1 Score: 98.2117 bits (243), Expect = 2.178e-21
Identity = 75/257 (29.18%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  950 LAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHK-------------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR--------KRNVKISETGLFG-------IKGFMNFRAKHFN-QNMD--------RTRRYYPHENNMDGFFLAKLQK 1609
            L  +  LQ   S +    L P+ GE+ILD+CAAPGGKT+H A +M + G + A D    ++  +  N S +G+ +    C D     K               ++F+R++ DAPC+G G           K+    + L   Q++LL  A+   K GG +VYSTC+I + ENE+ + +A R         +  +I   G+ G       +K    F       QNMD        R    +    +  GFF+AK  K
Sbjct:  212 LPSYIFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVIALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDTTDGIEGGPPFLPESFDRIILDAPCSGMGQRPNMACTWTLKEVTSYQPL---QRKLLHVAVQLLKPGGVLVYSTCTITLAENEEQVAWALRTFPCLQLQPQEPQIGGEGMVGAGLTLEQLKQLQRFDPSVVPLQNMDTDSLGEARREDMIWLANKDCIGFFIAKFLK 465          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Match: Nsun6 (NOL1/NOP2/Sun domain family member 6 [Source:MGI Symbol;Acc:MGI:1921705])

HSP 1 Score: 98.2117 bits (243), Expect = 2.178e-21
Identity = 75/257 (29.18%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  950 LAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHK-------------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR--------KRNVKISETGLFG-------IKGFMNFRAKHFN-QNMD--------RTRRYYPHENNMDGFFLAKLQK 1609
            L  +  LQ   S +    L P+ GE+ILD+CAAPGGKT+H A +M + G + A D    ++  +  N S +G+ +    C D     K               ++F+R++ DAPC+G G           K+    + L   Q++LL  A+   K GG +VYSTC+I + ENE+ + +A R         +  +I   G+ G       +K    F       QNMD        R    +    +  GFF+AK  K
Sbjct:  212 LPSYIFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVIALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDTTDGIEGGPPFLPESFDRIILDAPCSGMGQRPNMACTWTLKEVTSYQPL---QRKLLHVAVQLLKPGGVLVYSTCTITLAENEEQVAWALRTFPCLQLQPQEPQIGGEGMVGAGLTLEQLKQLQRFDPSVVPLQNMDTDSLGEARREDMIWLANKDCIGFFIAKFLK 465          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Match: Nsun6 (NOL1/NOP2/Sun domain family member 6 [Source:MGI Symbol;Acc:MGI:1921705])

HSP 1 Score: 98.2117 bits (243), Expect = 2.178e-21
Identity = 75/257 (29.18%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  950 LAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHK-------------KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR--------KRNVKISETGLFG-------IKGFMNFRAKHFN-QNMD--------RTRRYYPHENNMDGFFLAKLQK 1609
            L  +  LQ   S +    L P+ GE+ILD+CAAPGGKT+H A +M + G + A D    ++  +  N S +G+ +    C D     K               ++F+R++ DAPC+G G           K+    + L   Q++LL  A+   K GG +VYSTC+I + ENE+ + +A R         +  +I   G+ G       +K    F       QNMD        R    +    +  GFF+AK  K
Sbjct:  212 LPSYIFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVIALDKILTKVNKLKQNASLLGLHSIRAFCFDATKALKLDTTDGIEGGPPFLPESFDRIILDAPCSGMGQRPNMACTWTLKEVTSYQPL---QRKLLHVAVQLLKPGGVLVYSTCTITLAENEEQVAWALRTFPCLQLQPQEPQIGGEGMVGAGLTLEQLKQLQRFDPSVVPLQNMDTDSLGEARREDMIWLANKDCIGFFIAKFLK 465          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Match: sp|P46087|NOP2_HUMAN (Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2)

HSP 1 Score: 378.637 bits (971), Expect = 5.350e-121
Identity = 196/368 (53.26%), Postives = 269/368 (73.10%), Query Frame = 2
Query:  557 KVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            +  DL  ++ RI+  + IL+++    ++ +  +SR  Y+N+  +DL I +SY +FL+ K  ++F   +L +FL A+E  RP+T+RTNTLKTRRR L +ALI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS++AQ+M NTG+I AND N +RLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D  IL C  +QK+LL SAID+     K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  FR + F+ ++  TRR+YPH +NMDGFF+AK +K  +  P++
Sbjct:  232 QAPDLQRVHKRIQDIVGILRDFG---AQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKD--ILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQS 594          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Match: sp|Q922K7|NOP2_MOUSE (Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 3.135e-120
Identity = 200/406 (49.26%), Postives = 280/406 (68.97%), Query Frame = 2
Query:  434 ESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAID----ACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPE 1630
            ++E D Q N +D+ E+ +     E D++             +  DL  ++ RI+  + +L+++    ++ +  +SR  Y+++  +DL   +SY +FL+ K   +F   +L +FL A+E  RP+T+RTNTLKTRRR L + LI R  N++ L ++SK G+VV+ +   IGATPEYLAGHY+LQG+SSMLPVMALAP++ ERILD+C APGGKTS+IAQ+M NTG+I AND N DRLK+V  NL R+GV NT++   DGR   K V  F+RVL DAPC+GTGVISKD ++K +KDE+D++    +QK+LL SAID    A K GGY+VY TCSI VEENE V+DYA +KRNV++  TGL FG +GF  F+A+ F+  +  TRR+YPH +NMDGFF+AK +K  +  P+
Sbjct:  189 KAEGDLQINVEDE-EAFVLPPAGETDQDG------------QAPDLQRVHKRIQDIVGVLRDFG---AQREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQLLINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQ 578          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Match: sp|O94268|NOP2_SCHPO (25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop2 PE=1 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 4.078e-115
Identity = 188/363 (51.79%), Postives = 256/363 (70.52%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKV-KNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKR-NVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL  +  RI+  + +L ++K +    ++   R  YV+Q L D+C  + Y+ FL +K + +F+  +  +F  A+E  RP+TIRTNTLKT+RR L +ALI R  N+E + ++SKVG+ VF ++  IGATPEYLAGHYILQ +SS LPVMALAP+  ERILD+ +APGGK +++A +  NTGIIFAND NK R KA+++N+ R+GV N +V   DGR    +V   F+RVL DAPC+GTGVI KD+S+K +K E D   L+ +Q+QLL SAID+     K GG++VYSTCSI V+E+E VI YA +KR NVK+  TGL FG +GF  FR K F+ ++  TRRYYPH +N+DGFF+AKL+KI D  P
Sbjct:  190 DLSQIQLRIQEIVRVLNDFKNLCEPGRN---RSEYVDQLLNDICAYYGYSRFLAEKLFELFSVSEAVEFFEANEMPRPVTIRTNTLKTQRRELAQALINRGVNLEPIGKWSKVGLQVFESQVPIGATPEYLAGHYILQAASSFLPVMALAPQPNERILDMSSAPGGKVTYVAALQKNTGIIFANDSNKARTKALSANIHRLGVRNAIVCNYDGRKFPNEVIGGFDRVLLDAPCSGTGVIYKDQSVKTNKSERDFDTLSHLQRQLLLSAIDSVNADSKTGGFIVYSTCSITVDEDEAVIQYALKKRPNVKLVSTGLEFGREGFTRFREKRFHPSLKLTRRYYPHVHNIDGFFVAKLKKISDKIP 549          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Match: sp|Q9FG73|NOP2A_ARATH (25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.144e-114
Identity = 191/389 (49.10%), Postives = 265/389 (68.12%), Query Frame = 2
Query:  485 IEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNK-DLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKV--KNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHK 1624
            + DE  E D   L T   + ++     DL  L  RI+  +  L+N+K  + K+    +R   V Q   DL   + YN FLI     +F   +L + + A E+ RP +IRTNTLKTRRR L + L+ R  N++ L ++SKVG+V++ ++  IGATPEYLAG+Y+LQG+SS LPVMALAP++ ERI+D+ AAPGGKT++IA +M NTG+I+AN++   RLK++T+NL RMGV NT+V   DGR + K +     +RVL DAPC+GTG+ISKD+S+K +K  +++K    +QKQLL +AID      K GGY+VYSTCSI+V ENE VIDYA +KR+VK+   GL FG KGF  FR   F  ++D+TRR+YPH +NMDGFF+AKL+K+ + K
Sbjct:  183 VHDEEPEHDAFRLPTEEELEEEARGPPDLPLLKTRIEEIVRALKNFKAFRPKD---TTRKACVEQLKADLGSYYGYNSFLIGTLVEMFPPGELMELIEAFEKQRPTSIRTNTLKTRRRDLADVLLNRGVNLDPLSKWSKVGLVIYDSQVPIGATPEYLAGYYMLQGASSFLPVMALAPRENERIVDVAAAPGGKTTYIAALMKNTGLIYANEMKVPRLKSLTANLHRMGVTNTIVCNYDGRELPKVLGQNTVDRVLLDAPCSGTGIISKDESVKITKTMDEIKKFAHLQKQLLLAAIDMVDANSKTGGYIVYSTCSIMVTENEAVIDYALKKRDVKLVTCGLDFGRKGFTRFREHRFQPSLDKTRRFYPHVHNMDGFFVAKLKKMSNVK 568          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Match: sp|Q8VYM6|NOP2B_ARATH (26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 3.465e-114
Identity = 187/380 (49.21%), Postives = 264/380 (69.47%), Query Frame = 2
Query:  500 EEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNK-DLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKV--KNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            E+ DE  L T   + ++  +  DL SL  RI+  + IL N+K ++ K    +  D YV Q   DL   + YNEFLI     +F   +L + + A E+ RP +IRTNTLKTRRR L + L+ R  N++ L ++SKVG++V+ ++  IGATPEYLAG Y+LQ +SS LPVMALAP++ ER++D+ AAPGGKT+++A +M NTGII+AN++   RLK++++NL RMGV NT+V   DGR + K +   + +RVL DAPC+GTGVISKD+S+K SK  +D+K    +QKQL+  AID      K GGY+VYSTCS+++ ENE VIDYA + R+VK+   GL FG  GF +FR   F+ ++++TRR+YPH +NMDGFF+AKL+K+
Sbjct:  169 EKPDEFQLPTQKELEEEARRPPDLPSLQMRIREIVRILSNFKDLKPKGDKHERND-YVGQLKADLSSYYGYNEFLIGTLIEMFPVVELMELIEAFEKKRPTSIRTNTLKTRRRDLADILLNRGVNLDPLSKWSKVGLIVYDSQVPIGATPEYLAGFYMLQSASSFLPVMALAPREKERVVDMAAAPGGKTTYVAALMKNTGIIYANEMKVPRLKSLSANLHRMGVTNTIVCNYDGRELTKVLGQSSVDRVLLDAPCSGTGVISKDESVKTSKSADDIKKFAHLQKQLILGAIDLVDANSKTGGYIVYSTCSVMIPENEAVIDYALKNRDVKLVPCGLDFGRPGFSSFREHRFHPSLEKTRRFYPHVHNMDGFFVAKLKKM 547          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Match: A0A5J4NJC0 (25S rRNA (Cytosine2870-C5)-methyltransferase OS=Paragonimus westermani OX=34504 GN=DEA37_0004692 PE=3 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 2.882e-147
Identity = 249/513 (48.54%), Postives = 334/513 (65.11%), Query Frame = 2
Query:   77 KKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQ-FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            +K   Q DP+LK ++ +   KL S QKKR++KR++      + + D+  K    S ELN EN      S K+   L   +IS                 N+  P +       D E+LV     D+   +  M+S    EH                D  K  DL+ L+ RI+  M +L N+KT    N    +R   VN  LED+C K+SYN+FL  K +++F K+L +F+ A+E DRP+T+RTNTLKTRRR L +ALI R  N++ L+ +S+VG+VV+S++  +GATPEYLAGHYILQG+SSMLPVMALAP+ GERILD+CAAPGGK ++IAQ+M NTG +FAN+IN +R KA+  N  RMG++NT+V   DGR   K + NF+RVL DAPC+GTG+I+KD S+KA++  ED++  T +QK+LL +AIDACK GGYVVYSTCSILVEENE V+ YA RKR V I ET LFG KGF+NF+   FN  + RTRRYYPH++N+DGFF+AKL+K+
Sbjct:   10 RKVPHQGDPLLKTSQVRK-DKLSSRQKKRIKKRLE------KPVVDRKTKGVTVSNELNEENKLA---SKKELFTLEDEDIS-----------------NDGFPAD----DFGDLEDLVSKSDSDEHPEETPMDSS-PVEHTP--------------DTNKAHDLNYLDQRIRDWMLLLANFKTQAPPN---VTRSICVNSLLEDVCKKYSYNKFLAHKLFDLFPKELLEFIEANEIDRPVTLRTNTLKTRRRELAQALINRGVNLDPLEPWSRVGLVVYSSQVPLGATPEYLAGHYILQGASSMLPVMALAPRPGERILDMCAAPGGKATYIAQLMKNTGTLFANEINPNRAKALIGNCHRMGIVNTIVCVEDGRKFPKLMSNFDRVLLDAPCSGTGIIAKDPSVKANRTNEDIQRCTTLQKELLLAAIDACKAGGYVVYSTCSILVEENEAVVHYAMRKRKVSIVETKLFGEKGFVNFKGFRFNPKLQRTRRYYPHKHNVDGFFVAKLKKL 473          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Match: A0A0R3TVI1 (SAM_MT_RSMB_NOP domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11818 PE=3 SV=2)

HSP 1 Score: 435.647 bits (1119), Expect = 9.817e-145
Identity = 252/520 (48.46%), Postives = 346/520 (66.54%), Query Frame = 2
Query:   71 QTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRI-KSRFSNKQNLKDKPL--KKCEESKELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVT-DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQ-FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIG 1615
            + KK K QPDP     +K +   LGS QKKRL+KR+   + S K+  K+  +  +K  E+K+L  E+     I   D  N+N       ++ EL +S+E+A S+N         L  +D E+L  +  + ++  D+++   IE            TNI   D     T DL+ L+ RIK  + +L ++KT   +      R   V+  L +LC +++YN F++  FY++F K++ + L A+E DRP+TIRTNTLKTRRR L +ALI R  NV+ L  +SKVG+VVF ++  +GATPEYLAGHYILQG+ SMLPVMALAPK  ERILDLCAAPGGKT++IAQ+M NTG I AND++ DR KA+  N  RMGV+NT++   DGR+  K +  F+RVL DAPC+GTGVI+KD S+KA K +ED+K    +QKQL+ SAID CK GGY+VYSTCSI ++ENE VIDYA RKR VK+ +T LFG++GF +F+ +HF+ NM RTRR+YPH++N+DGFF+AKL+KI 
Sbjct:    8 RAKKLKHQPDPEFSFLEKSTKATLGSRQKKRLKKRLLNDKESVKKLAKESKVSEEKPSENKQLFDEDELMEEID--DFANINE------DLKEL-LSDEDAESINS--------LASDDEEDLPVNGKEPRAEGDEEVGGEIE------------TNIATSDFPTGPTYDLNELDQRIKDALLVLGDFKT---RAPPGMKRKEIVDSLLSNLCQRYNYNRFMMNLFYDLFPKEILEALKANETDRPITIRTNTLKTRRRDLAQALINRGVNVDPLSSWSKVGLVVFKSQVPLGATPEYLAGHYILQGACSMLPVMALAPKPNERILDLCAAPGGKTTYIAQLMKNTGTIVANDVSSDRAKALLGNCHRMGVVNTMICVEDGRNFQKTMAGFDRVLVDAPCSGTGVIAKDPSVKAHKGDEDIKQCAMLQKQLILSAIDCCKPGGYIVYSTCSITIQENEGVIDYALRKRKVKLEDTNLFGLEGFTSFKGQHFSPNMSRTRRFYPHKHNVDGFFVAKLKKIA 495          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Match: A0A068WQQ2 (Nucleolar protein nol1:nop2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000218300 PE=3 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 2.178e-142
Identity = 246/518 (47.49%), Postives = 334/518 (64.48%), Query Frame = 2
Query:   71 QTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNIS--YKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVT-DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQ-FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            ++KK K Q DP     ++K+   LGS QKKRL+KR+ S        KD  LK  E  K    E N  GN S  + D L    ++  D+        ++E +   +  P     + E+ FE +VE  S+   +  +D                + TNI V D     T D+  LN RI+ ++ IL ++KT   +     +R   V+  L DLC ++SY+  +I   Y++F K++ + + A+E DRP+TIRTNTLKTRRR L +ALI R  N++ L+ +SKVG+VV+S++  +GATPEYLAGHYILQG+ SMLPVMALAPK GERILD+CAAPGGKT++IAQ+M NTG IFAND+N +R KA+  N  RMGV+NTVV   DGR  H  +  F+RVL DAPC+GTGVI+KD S+K  + +ED+K    +QKQL+ +AID CK GGY+VYSTCSI V ENE VIDYA RKR V++ ET LFG KGF +F+  HF+  M+R RR+YPH++N+DGFF+AKL+++
Sbjct:    8 RSKKPKHQSDPQFNFLERKTKATLGSRQKKRLKKRLLSS-------KDSVLKPPENHKS---EKNLGGNKSLFHPDELLEEIDDFVDSSGKVKGFLSDEEVDKEDPTP-----MGEDGFE-IVEKPSNGNYSEPED----------------VATNIGVSDLPSAPTYDMTLLNQRIRDSLLILGDFKT---RAPPGLTRKACVDSLLNDLCQRYSYSRLMINILYDLFPKEILEVVEANETDRPVTIRTNTLKTRRRDLAQALINRGVNLDPLEPWSKVGLVVYSSQVPLGATPEYLAGHYILQGACSMLPVMALAPKPGERILDMCAAPGGKTTYIAQLMKNTGSIFANDVNAERAKALLGNCHRMGVVNTVVCVEDGRKFHNVMSGFDRVLLDAPCSGTGVIAKDPSVKTHRSDEDIKQCVMLQKQLIIAAIDCCKTGGYIVYSTCSITVNENEGVIDYALRKRKVQLEETNLFGEKGFTSFKGLHFSPKMNRARRFYPHKHNVDGFFVAKLKRL 490          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Match: W6U814 (Putative ribosomal RNA methyltransferase NOP2 OS=Echinococcus granulosus OX=6210 GN=EGR_08658 PE=3 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 2.274e-142
Identity = 246/518 (47.49%), Postives = 334/518 (64.48%), Query Frame = 2
Query:   71 QTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNIS--YKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVT-DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQ-FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            ++KK K Q DP     ++K+   LGS QKKRL+KR+ S        KD  LK  E  K    E N  GN S  + D L    ++  D+        ++E +   +  P     + E+ FE +VE  S+   +  +D                + TNI V D     T D+  LN RI+ ++ IL ++KT   +     +R   V+  L DLC ++SY+  +I   Y++F K++ + + A+E DRP+TIRTNTLKTRRR L +ALI R  N++ L+ +SKVG+VV+S++  +GATPEYLAGHYILQG+ SMLPVMALAPK GERILD+CAAPGGKT++IAQ+M NTG IFAND+N +R KA+  N  RMGV+NTVV   DGR  H  +  F+RVL DAPC+GTGVI+KD S+K  + +ED+K    +QKQL+ +AID CK GGY+VYSTCSI V ENE VIDYA RKR V++ ET LFG KGF +F+  HF+  M+R RR+YPH++N+DGFF+AKL+++
Sbjct:    7 RSKKPKHQSDPQFNFLERKTKATLGSRQKKRLKKRLLSS-------KDSVLKPPENHKS---EKNLGGNKSLFHPDELLEEIDDFVDSSGKVKGFLSDEEVDKEDPTP-----MGEDGFE-IVEKPSNGNYSEPED----------------VATNIGVSDLPSAPTYDMTLLNQRIRDSLLILGDFKT---RAPPGLTRKACVDSLLNDLCQRYSYSRLMINILYDLFPKEILEVVEANETDRPVTIRTNTLKTRRRDLAQALINRGVNLDPLEPWSKVGLVVYSSQVPLGATPEYLAGHYILQGACSMLPVMALAPKPGERILDMCAAPGGKTTYIAQLMKNTGSIFANDVNAERAKALLGNCHRMGVVNTVVCVEDGRKFHNVMSGFDRVLLDAPCSGTGVIAKDPSVKTHRSDEDIKQCVMLQKQLIIAAIDCCKTGGYIVYSTCSITVNENEGVIDYALRKRKVQLEETNLFGEKGFTSFKGLHFSPKMNRARRFYPHKHNVDGFFVAKLKRL 489          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Match: A0A087W144 (Nucleolar protein nol1:nop2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000218300 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 4.812e-142
Identity = 247/529 (46.69%), Postives = 339/529 (64.08%), Query Frame = 2
Query:   38 MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNIS--YKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVT-DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQ-FSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            M++   S+   ++KK K Q DP     ++K+   LGS QKKRL+KR+ S        KD  L   E SK    E N  GN S  + D L    ++ +D+        ++E +   +  P     + E+ FE +VE  S+   +  +D                + TNI V D     T D+  LN RI+ ++ IL ++KT   +     +R   ++  L DLC ++SY+  +I   Y++F K++ + + A+E DRP+TIRTNTLKTRRR L +ALI R  N++ L+ +SKVG+VV+S++  +GATPEYLAGHYILQG+ SMLPVMALAPK GERILD+CAAPGGKT++IAQ+M NTG IFAND+N +R KA+  N  RMGV+NTVV   DGR  H  +  F+RVL DAPC+GTGVI+KD S+K  + +ED+K    +QKQL+ +AID CK GGY+VYSTCSI V ENE VIDYA RKR V++ ET LFG KGF +F+  HF+  M+R RR+YPH +N+DGFF+AKL+++
Sbjct:    1 MRYGMMSAAKKRSKKPKHQSDPEFNFLERKTKATLGSRQKKRLKKRLLSS-------KDSVL---ELSKNCKSEKNLGGNKSLFHPDELLEEIDDFADSSGKVKGFLSDEEVDKKDPTP-----MGEDGFE-IVEKPSNGNYSEPED----------------VATNIGVSDLPSAPTYDMTLLNQRIRDSLLILGDFKT---RAPPGLTRKACIDSLLNDLCQRYSYSRLMINILYDLFPKEILEVVEANETDRPVTIRTNTLKTRRRDLAQALINRGVNLDPLEPWSKVGLVVYSSQVPLGATPEYLAGHYILQGACSMLPVMALAPKPGERILDMCAAPGGKTTYIAQLMKNTGSIFANDVNAERAKALLGNCHRMGVVNTVVCVEDGRKFHNVMSGFDRVLLDAPCSGTGVIAKDPSVKTHRSDEDIKQCVMLQKQLIIAAIDCCKTGGYIVYSTCSITVNENEGVIDYALRKRKVQLEETNLFGEKGFTSFKGLHFSPKMNRARRFYPHRHNVDGFFVAKLKRL 494          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Match: nop2 (NOP2 nucleolar protein [Source:NCBI gene;Acc:103028554])

HSP 1 Score: 375.17 bits (962), Expect = 1.349e-121
Identity = 187/361 (51.80%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIF-NKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL S++ RIK N+++L ++     K +  + R  Y++    D+C  +SYN FL+ K  ++F + +L  FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V+F +   IGATPEYLAGHY+LQG+SS+LPVMAL+P++GE +LD+ +APGGKT+++AQ+M NTG+I AND + DRLK+V  N+ R+GV N+++   DGR   K +  F+RVL DAPC+GTGVISKD ++K SKD+ D++    +QK+L+ +AID+     + GGY+VY TCSI+VEENE V+DYA +KRNVK+  TGL FG +GF  F+ K F+ ++  TRR+YPH +NMDGFF+AKL+K  +  P
Sbjct:  205 DLQSIHQRIKDNVDVLSHF---SEKREEGKERTEYLSLLKSDMCTYYSYNPFLMGKLMDLFPHSELVDFLEANEIQRPVTIRTNTLKTRRRDLAQALINRGVNLDPLGKWSKVGLVIFDSSVPIGATPEYLAGHYMLQGASSLLPVMALSPQEGETVLDMSSAPGGKTTYMAQLMRNTGVIIANDASADRLKSVVGNIHRLGVTNSIICNYDGRQFPKVMGGFDRVLLDAPCSGTGVISKDPAVKTSKDDSDIQRSAHLQKELILAAIDSVNAESQTGGYLVYCTCSIMVEENEWVVDYALKKRNVKLVPTGLDFGKEGFTRFKEKRFHPSLKLTRRFYPHSHNMDGFFVAKLKKFSNTIP 562          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Match: nop2 (NOP2 nucleolar protein [Source:NCBI gene;Acc:103028554])

HSP 1 Score: 375.555 bits (963), Expect = 2.653e-121
Identity = 187/361 (51.80%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIF-NKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL S++ RIK N+++L ++     K +  + R  Y++    D+C  +SYN FL+ K  ++F + +L  FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V+F +   IGATPEYLAGHY+LQG+SS+LPVMAL+P++GE +LD+ +APGGKT+++AQ+M NTG+I AND + DRLK+V  N+ R+GV N+++   DGR   K +  F+RVL DAPC+GTGVISKD ++K SKD+ D++    +QK+L+ +AID+     + GGY+VY TCSI+VEENE V+DYA +KRNVK+  TGL FG +GF  F+ K F+ ++  TRR+YPH +NMDGFF+AKL+K  +  P
Sbjct:  237 DLQSIHQRIKDNVDVLSHF---SEKREEGKERTEYLSLLKSDMCTYYSYNPFLMGKLMDLFPHSELVDFLEANEIQRPVTIRTNTLKTRRRDLAQALINRGVNLDPLGKWSKVGLVIFDSSVPIGATPEYLAGHYMLQGASSLLPVMALSPQEGETVLDMSSAPGGKTTYMAQLMRNTGVIIANDASADRLKSVVGNIHRLGVTNSIICNYDGRQFPKVMGGFDRVLLDAPCSGTGVISKDPAVKTSKDDSDIQRSAHLQKELILAAIDSVNAESQTGGYLVYCTCSIMVEENEWVVDYALKKRNVKLVPTGLDFGKEGFTRFKEKRFHPSLKLTRRFYPHSHNMDGFFVAKLKKFSNTIP 594          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Match: nop2 (NOP2 nucleolar protein [Source:NCBI gene;Acc:103028554])

HSP 1 Score: 375.17 bits (962), Expect = 3.299e-121
Identity = 187/361 (51.80%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIF-NKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL S++ RIK N+++L ++     K +  + R  Y++    D+C  +SYN FL+ K  ++F + +L  FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V+F +   IGATPEYLAGHY+LQG+SS+LPVMAL+P++GE +LD+ +APGGKT+++AQ+M NTG+I AND + DRLK+V  N+ R+GV N+++   DGR   K +  F+RVL DAPC+GTGVISKD ++K SKD+ D++    +QK+L+ +AID+     + GGY+VY TCSI+VEENE V+DYA +KRNVK+  TGL FG +GF  F+ K F+ ++  TRR+YPH +NMDGFF+AKL+K  +  P
Sbjct:  237 DLQSIHQRIKDNVDVLSHF---SEKREEGKERTEYLSLLKSDMCTYYSYNPFLMGKLMDLFPHSELVDFLEANEIQRPVTIRTNTLKTRRRDLAQALINRGVNLDPLGKWSKVGLVIFDSSVPIGATPEYLAGHYMLQGASSLLPVMALSPQEGETVLDMSSAPGGKTTYMAQLMRNTGVIIANDASADRLKSVVGNIHRLGVTNSIICNYDGRQFPKVMGGFDRVLLDAPCSGTGVISKDPAVKTSKDDSDIQRSAHLQKELILAAIDSVNAESQTGGYLVYCTCSIMVEENEWVVDYALKKRNVKLVPTGLDFGKEGFTRFKEKRFHPSLKLTRRFYPHSHNMDGFFVAKLKKFSNTIP 594          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Match: nsun5 (NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2476])

HSP 1 Score: 105.916 bits (263), Expect = 4.121e-24
Identity = 80/239 (33.47%), Postives = 116/239 (48.54%), Query Frame = 2
Query:  902 MVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSI---HKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            ++VF AK        Y AGH ILQ  +S LP   L P  G  ++D CAAPG KTSH+A IM N G +FA D++  RL  +++ L R GV    +   D   +     + K    VL D  C+G+G++         +D E L+ L   Q + L  A+   ++   VVYSTCSI   ENE+V+  AC ++N       LF          +  +  + +  R    E    GFF+A L++
Sbjct:  173 LLVFPAKMDFHDHYLYKAGHIILQDKASCLPAYLLDPPVGGNVIDACAAPGNKTSHLAAIMKNKGKLFAFDLDVKRLSTMSTLLLRAGVTCHKLANQDFLKVDPLSPEYKEVKHVLLDPSCSGSGMVCLPDGSSEEQDSERLQALAAFQLRCLDHALQFPQL-QRVVYSTCSIHSTENEEVVS-ACLQKNPGFRLVHLF------PEWPERGHAPLTQCLRASTKETLTHGFFVAMLER 403          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Match: nsun3 (NOP2/Sun RNA methyltransferase 3 [Source:NCBI gene;Acc:103035728])

HSP 1 Score: 101.679 bits (252), Expect = 5.186e-23
Identity = 60/173 (34.68%), Postives = 99/173 (57.23%), Query Frame = 2
Query:  941 PEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSR---MGVMNTVVICN-DGRSI-HKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKI-LTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVID 1441
            P +L  +Y+L  ++S+LPV+AL  + GE++LDLC+APGGK   + Q  A+ G++  N++ + R + +   L     + V +TV + N DGR+I   +   +++VL DAPC+           +        +  L  +QK+LLCSA+   + GG VVYSTC+    EN+ V++
Sbjct:  146 PGWLKQYYLLN-AASLLPVLALGLRDGEKVLDLCSAPGGKALALLQT-ASPGLLHCNEVEESRFEWLLKTLESYIPLSVRDTVTVTNVDGRTIGSSQPDKYDKVLVDAPCSNDRSWLYTPGDQQGALWLKERAQLPHLQKELLCSALSTVRPGGLVVYSTCTFSRAENQSVVE 316          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Match: nop2 (NOP2 nucleolar protein homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-050309-7])

HSP 1 Score: 365.925 bits (938), Expect = 6.291e-123
Identity = 197/400 (49.25%), Postives = 283/400 (70.75%), Query Frame = 2
Query:  464 DDDMES-IIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTC--IQKQLLCSAID----ACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPEN 1633
            DDD+++ I+E EH        +      +  ++  DL  ++ R++ N+ +L ++ T + +  S ++R+ Y+     DL + +SYN+FL+     +F   +L +FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V+F +   +GATPEYLAGHY+LQG+SS+LPVMALAP++ E++LD+CAAPGGKTS+ AQ+M NTG I AND+N +RLK+V  NL R+GV N++V   DGR++ K +  F+RVL DAPC+GTG+ISKD S+K SKDE+   IL C  +QKQLL +AID    A   GG++VY TCS+ VEENE V+DYA RKRNVK+  TGL FG +GF  F+ + F+ ++  TRR+YPH +NMDGFF++K +K+ +  P++
Sbjct:    5 DDDLQTNIVESEHFVLPSGQEI------EKPVQPPDLQIIHQRMQDNLAVLGDF-TNRREPGSGRTREEYLELLKRDLAMYYSYNDFLMSLLSGLFPLSELIEFLEANEVHRPVTIRTNTLKTRRRELAQALINRGVNLDPLGKWSKVGLVIFDSSVPVGATPEYLAGHYMLQGASSLLPVMALAPQENEKLLDMCAAPGGKTSYAAQLMRNTGAIVANDVNSERLKSVVGNLHRLGVTNSIVCNYDGRALAKVMSGFDRVLLDAPCSGTGIISKDPSVKTSKDEK--DILRCAHLQKQLLLTAIDCLDAASTTGGFLVYCTCSVTVEENEWVVDYALRKRNVKLVPTGLDFGKEGFTRFKERRFHPSLKLTRRFYPHTHNMDGFFVSKFKKLSNDIPKS 395          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Match: nop2 (NOP2 nucleolar protein homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-050309-7])

HSP 1 Score: 365.155 bits (936), Expect = 1.271e-122
Identity = 195/391 (49.87%), Postives = 276/391 (70.59%), Query Frame = 2
Query:  464 DDDMES-IIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAID----ACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKI 1612
            DDD+++ I+E EH        +          K  DL  ++ R++ N+ +L ++ T + +  S ++R+ Y+     DL + +SYN+FL+     +F   +L +FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ L ++SKVG+V+F +   +GATPEYLAGHY+LQG+SS+LPVMALAP++ E++LD+CAAPGGKTS+ AQ+M NTG I AND+N +RLK+V  NL R+GV N++V   DGR++ K +  F+RVL DAPC+GTG+ISKD S+K SKDE+D+     +QKQLL +AID    A   GG++VY TCS+ VEENE V+DYA RKRNVK+  TGL FG +GF  F+ + F+ ++  TRR+YPH +NMDGFF++K +K+
Sbjct:    8 DDDLQTNIVESEHFVLPSGQEIEKHTHPPLARKPPDLQIIHQRMQDNLAVLGDF-TNRREPGSGRTREEYLELLKRDLAMYYSYNDFLMSLLSGLFPLSELIEFLEANEVHRPVTIRTNTLKTRRRELAQALINRGVNLDPLGKWSKVGLVIFDSSVPVGATPEYLAGHYMLQGASSLLPVMALAPQENEKLLDMCAAPGGKTSYAAQLMRNTGAIVANDVNSERLKSVVGNLHRLGVTNSIVCNYDGRALAKVMSGFDRVLLDAPCSGTGIISKDPSVKTSKDEKDILRCAHLQKQLLLTAIDCLDAASTTGGFLVYCTCSVTVEENEWVVDYALRKRNVKLVPTGLDFGKEGFTRFKERRFHPSLKLTRRFYPHTHNMDGFFVSKFKKL 397          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:ZDB-GENE-080808-8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.174e-17
Identity = 62/211 (29.38%), Postives = 105/211 (49.76%), Query Frame = 2
Query: 1013 KKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICND-----------GRSIHKKVKN-------FNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR--KRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDG 1585
            + G R+LD+CAAPGGKT+HIA +M +TG I A D    +++ + +N SR+ + +    C D           G+ +   V +       F+RVL DAPC+  G   K   +        L+    +Q++LL +A+   + GG ++Y+TCS+   ENE+ + +A R   +   +++    G +G     A    Q++   +R+ P     DG
Sbjct:  238 RPGLRVLDMCAAPGGKTTHIATLMGDTGEIIALDKTAAKVQKIQNNASRLNLKSIQTFCCDSTQAIASGPHTGKGLLWWVGHPPFPEEYFDRVLLDAPCSALG---KRPCLGFPASLRQLQSYAPLQRKLLAAAVALLRPGGVLLYTTCSVASAENERQVAWALRTFPQLHLVAQEPHLGGQGLPG--AGLDPQHLRLLQRFDPGSETEDG 443          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Match: nsun4 (NOP2/Sun RNA methyltransferase 4 [Source:ZFIN;Acc:ZDB-GENE-041212-77])

HSP 1 Score: 72.0182 bits (175), Expect = 7.204e-14
Identity = 78/273 (28.57%), Postives = 119/273 (43.59%), Query Frame = 2
Query:  869 NVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVV--------ICNDGRSIHKK-----VKN------FNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEEN----EQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDR-TRRYYPH-ENNMDGFFLAKLQKI 1612
            N+    F +  +  F      GA    L  HY+L  ++S+LPV+AL  + G R+LDLCAAPGGKT  + Q  A    + +ND++  R    T  L R  V+ T V        +   G S+  +     +K+      ++RVL DAPCT     S  +          +K    +        + AC+ GG VVYSTCS+   +N    E  +  A    NV      L G++   +  A  F +  DR      PH   N    +++K+ ++
Sbjct:  127 NIRCFTFPRGDISRFPQPWPAGAL--RLLSHYLLD-AASLLPVLALDVQLGHRVLDLCAAPGGKTLALLQT-ACCDQLTSNDVSASR----TGRLQR--VLRTYVPRDAEEAGVPAGGVSVRTRDGIFWLKSAEERGVYDRVLVDAPCT-NDRHSLHEEENNIFSRSRMKERQQLPALQTQLLLLACRPGGVVVYSTCSLSQLQNSCVVEAALSLATTNHNVDAQACDLSGMRALFSH-AFTFQEEEDRFGETVIPHVAANFGPIYVSKIVRL 387          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000605.1 (pep scaffold:Pmarinus_7.0:GL476894:286566:292548:1 gene:ENSPMAG00000000548.1 transcript:ENSPMAT00000000605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.521e-8
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  941 PEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINK 1123
            P  L   Y+L  ++S+LPV+AL  + GER+LD+CAAPGGKT  I Q  A   ++ AN+ ++
Sbjct:  109 PGRLKAFYVLN-AASLLPVLALGVRSGERVLDMCAAPGGKTLGILQC-AQPSLLCANEPDE 167          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Yeast
Match: NOP2 (rRNA m5C methyltransferase; methylates cytosine at position 2870 of 25S rRNA; has an essential function independent of rRNA methylation; contains seven beta-strand methyltransferase motif; essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; localized to the nucleolus; constituent of 66S pre-ribosomal particles; rRNA methylation defect and lethality are functionally complemented by human NOP2, a gene upregulated in cancer [Source:SGD;Acc:S000005005])

HSP 1 Score: 344.739 bits (883), Expect = 6.056e-112
Identity = 180/358 (50.28%), Postives = 253/358 (70.67%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNK-DLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKR-NVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIG 1615
            +L S   R+   +++L+N+KT+ ++ +S   R  YV++ L+D+C  F Y  FL +K +N+F+  +  +F  A+E  RP+TIRTNTLKTRRR L + L+ R  N++ +  ++KVG+ +F ++  IGATPEYLAGHYILQ +SS LPV+AL P + ERILD+ AAPGGKT++I+ +M NTG +FAND NK R K++ +N+ R+G  NT+V   D R   K +  F+R+L DAPC+GTGVI KD+S+K S+ E+D   +  +QKQLL SAID+     K GG +VYSTCS+ VEE+E VIDYA RKR NVK+ +TGL  G + F ++R K F+ ++   RRYYPH  N+DGFF+AK QKIG
Sbjct:  196 NLTSTRTRMIEIVKVLENFKTLGAEGRS---RGEYVDRLLKDICEYFGYTPFLAEKLFNLFSPAEAMEFFEANEIARPITIRTNTLKTRRRDLAQTLVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCVFANDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEEDEAVIDYALRKRPNVKLVDTGLAIGKEAFTSYRGKKFHPSVKLARRYYPHTYNVDGFFVAKFQKIG 550          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Yeast
Match: NCL1 (S-adenosyl-L-methionine-dependent tRNA: m5C-methyltransferase; methylates cytosine to m5C at several positions in tRNAs and intron-containing pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C at wobble position in response to hydrogen peroxide, causing selective translation of mRNA from genes enriched in TTG codon; loss of NCL1 confers hypersensitivity to oxidative stress; similar to Nop2p and human proliferation associated nucleolar protein p120 [Source:SGD;Acc:S000000120])

HSP 1 Score: 97.8265 bits (242), Expect = 5.930e-22
Identity = 75/273 (27.47%), Postives = 116/273 (42.49%), Query Frame = 2
Query:  944 EYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMAN-----TGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGR-----SIHKKVKN------FNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKI-------SETGLFGIKGFMNFRAKHFNQ-------------------------NMDRTRRYYPHENNMDGFFLAKLQKIGD 1618
            E   G+   Q + SM+P + L  K    +LD+CAAPG KT+ + + +       +G + AND +  R   +   L R+   N +V+ +D +      +H    N      F+R+LCD PC+G G + K+ ++    + +    L  +Q  +L   +   K  G +VYSTCS+   ENE V+  A RK   KI          GL   KG   +     N                          N+    R YPH+ N  GFF+   +K+ D
Sbjct:  141 ENAVGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDGTMRKNVNVWKDWNTQAGLGLHAVQLNILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEKVED 413          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Yeast
Match: RCM1 (rRNA m5C methyltransferase; methylates cytosine at position 2278 of 25S rRNA while Nop2p methylates cytosine at position 2870; contains seven beta-strand methyltransferase motif; localized to the nucleolus; interacts with Trm112p; homolog of NSUN5A, a human gene which is deleted in Williams-Beuren Syndrome [Source:SGD;Acc:S000004967])

HSP 1 Score: 53.1434 bits (126), Expect = 5.918e-8
Identity = 52/216 (24.07%), Postives = 92/216 (42.59%), Query Frame = 2
Query:  947 YLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMA------NTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGR----SIHKKVKNFNRVLCDAPCTGTGVX-------------------------XXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVI-----DYACRKRNVKIS 1474
            Y  G  I+Q  +S  P   L P   + ++D C+APG KT+H A  +       N   I+A + + +R K +   +   G    + + N G     +  +K K+    + D  C+G+G+                           +++ I   + +  L  L+  Q Q++  A+ +      +VYSTCSI  EENE+V+     D + R+   K++
Sbjct:  219 YKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISV-NVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAM-SFPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA 432          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Match: EDO40895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z9])

HSP 1 Score: 370.933 bits (951), Expect = 2.122e-124
Identity = 190/361 (52.63%), Postives = 265/361 (73.41%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDAC----KVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            +L  +N RI+ N++ L N+   +   +S   R  Y++  L+DLC  +SY EFL++KF  +F   +L +FL A+E  RP+TIRTN+LKTRRR L +ALI R  N++ + ++SKVG+VV+ +   IGATPEYLAGHY++QGSSSMLPVMALAP++ ER+LD+CAAPGGKT+++A +M NTGI+ AND  K+R KA+ +N+ R+GV NTVV   DGR+  K +  F+R L DAPC+GTGVISKD S+K +K E+D+   + +QK+L+ +AID+       GGY+VYSTCSI+VEE+E V+DYA  KR+VK+  TGL FG +GF  FR +HF+ ++  TRR+Y H +NMDGFF+AKL+K  +  P
Sbjct:   53 ELALINQRIRENIQALSNFSKAREPGRS---RKEYLSLLLKDLCTYYSYGEFLMEKFLEMFQLNELIEFLEANEVHRPVTIRTNSLKTRRRDLAQALINRGVNLDPVGKWSKVGLVVYDSSVPIGATPEYLAGHYMIQGSSSMLPVMALAPQEKERVLDMCAAPGGKTTYLAALMKNTGIVVANDAKKERTKALVANIHRLGVTNTVVCNYDGRAFPKVMGGFDRTLLDAPCSGTGVISKDPSVKTNKTEKDILRCSHVQKELILAAIDSVDAKSPTGGYIVYSTCSIMVEEDEWVVDYALSKRHVKLVPTGLDFGREGFSKFRGRHFHPSLKLTRRFYAHAHNMDGFFVAKLKKFSNKIP 410          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Match: EDO37813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEM2])

HSP 1 Score: 100.523 bits (249), Expect = 1.492e-22
Identity = 68/228 (29.82%), Postives = 118/228 (51.75%), Query Frame = 2
Query: 1004 LAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSN--LSRMGVMNTVVICNDGRSIHKKV----------------KNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRK-RNVK-ISETGLFGIKGF----MNFRAKHFNQNMDRTRRYYPHENNMD--GFFLAKLQK 1609
            L P+ GE +LD+CAAPGGKT HIA +M N G+I A D ++ +++ + +N  + ++ ++ T VI +  +++  K                 + F+R+L DAPC+  G   +          ++L+    +Q+++  SA+   + GG +VYSTC+I  EENE+ + +A R    ++ + +    G  GF    ++   +   Q  D TR       ++D  GFF+AK  K
Sbjct:  267 LGPQSGESVLDMCAAPGGKTCHIAALMKNKGLIVAFDKSQPKIQKIIANCEMQKVSIVKTHVI-DASKALDTKAAPSSRDVSTTSPPYPPEAFDRILLDAPCSALG---QRPQSVVHMKLKELQSFPKLQRKIFSSAVGLLRPGGTLVYSTCTITPEENEKQVAWALRSFPGLRLVPQVPHLGGPGFPDCGLSDHDRGLVQRFDPTRSSVEPCCDVDTIGFFIAKFVK 490          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Match: EDO39248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAM8])

HSP 1 Score: 92.0485 bits (227), Expect = 1.117e-19
Identity = 74/274 (27.01%), Postives = 119/274 (43.43%), Query Frame = 2
Query:  956 GHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMAN-------TGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGR---SIHKKVKN-------FNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACR------------------KRNVKISETGLF------------GIKGFM-NFRAKHFNQNMDRTR--------RYYPHENNMDGFFLAKLQK 1609
            G+   Q + SM+P + +  K G++ILD CAAPG KTS I +++          G++ AN++   R   +     R+   + V+  +D     ++H K +N       F+R+LCD PC+G G + K+  I      +    L   Q ++L  A++  +VGG +VYSTC++   ENE V+    R                  KR+  +    L             G   F+  FR        +  +        R YPH+ +  GFF+A L K
Sbjct:  117 GNISRQEAVSMIPPLLMDIKPGQKILDTCAAPGSKTSQIIEMLHGDKETGIAEGLVIANELQNKRCYMLIHQSKRLRSPSCVITNHDASTYPTLHVKKENGDRTPLLFDRILCDVPCSGDGTMRKNPLIWNKWTPQLGVSLHRTQLRILARAMEMLEVGGRIVYSTCTMSPIENESVVAEMLRNSDGALELVDLSNELPNLKRSPGLHSWKLMMKDGSEVTGCDPGSPAFLGGFRPSMLPPPDNEAKAMHLECCIRVYPHQQDTGGFFIAALVK 390          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Match: EDO45380 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT21])

HSP 1 Score: 89.7373 bits (221), Expect = 3.694e-19
Identity = 69/233 (29.61%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  947 YLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVV-----ICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXX----XXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMN---FRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            Y+ GH +LQ  +S LP   ++   G  ++D CAAPG K+SH+A  + N G +F+ DI+  RL  +   + + G    V      +  D RS   + +N   ++ D  C+G+G+IS+   + + +     ++ L+ L   Q  +L  A     V   V YSTCSI  +ENE V+  A     +K+S+ G F +   +     R     Q  ++  R  P  ++ +GFF+A  Q+
Sbjct:  199 YINGHILLQDKASCLPAHVISLPPGAHVIDACAAPGNKSSHLAAKLNNNGRVFSFDISASRLAVMQKQMKKAGATCVVTEHKSFLDVDPRS--SQYRNVEYIVVDPSCSGSGIISRLDGLVSDEQEDDLQQRLESLADFQLSVLTHAFSFPAVKK-VAYSTCSIHSQENEDVVHKA-----LKVSQ-GQFELAHALESWPSRGLPVFQGAEKCLRASPESDHTNGFFVALFQR 422          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Match: EDO42070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N2])

HSP 1 Score: 76.2554 bits (186), Expect = 8.862e-16
Identity = 53/170 (31.18%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  941 PEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDR---LKAVTSNLSRMGVMNTVVICNDGRSIHK-KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVI 1438
            P  L G+Y+L  ++S+LPV+ L       +LD+CA+PGGKT  + Q+++  G + AN+  + R   L+ V       G  N  +   DG      +  +++R+L DAPC+      +      S  E+  +  + +Q +L+ SA+ +    G VVYSTC++   EN+ VI
Sbjct:    2 PNGLLGYYLLD-AASLLPVICLDVGPDSTVLDMCASPGGKTVAMMQLLSERGGLVANEPTQSRRRKLRKVIQEYIPKGQTNITIRGMDGTKFGGLEPCSYDRILVDAPCSTDRHCLRSGFQTDSWSEKKSQKFSQLQNKLVMSALGSLTSDGRVVYSTCTMSPYENDGVI 170          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Match: ENSORLT00000015205.3 (NOP2 nucleolar protein [Source:NCBI gene;Acc:101172522])

HSP 1 Score: 373.629 bits (958), Expect = 1.063e-120
Identity = 193/361 (53.46%), Postives = 262/361 (72.58%), Query Frame = 2
Query:  566 DLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFN-KDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETL-QFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKV----GGYVVYSTCSILVEENEQVIDYACRKRNVKISETGL-FGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKP 1627
            DL +++ RIK N+++L N+    +K +  ++R  YV+   +DLC  +SYN FLI K   +F   +L  FL A+E  RP+TIRTNTLKTRRR L +ALI R  N++ + ++SKVG+V++ +   +GATPEYLAGHY+LQG+SS LPVMAL+P++GE +LD+ +APGGKT++IAQ+M NTG+I AND N +RLK+V  N+ R+GV NTVV   DGR   K +  F+RVL DAPC+GTGVI+KD ++K SKDE D+     +QK+L+ SAID+       GGYVVY TCSI VEENE V+DYA +KRNVK+  TGL FG +GF NF+   F+ ++  TRR+YPH +NMDGFF+AKL+K  +  P
Sbjct:  257 DLKTIHQRIKDNVDVLCNF---SAKREEGKARGDYVSLLKKDLCTYYSYNSFLIDKLMELFPLSELVDFLEANEIQRPVTIRTNTLKTRRRDLAQALINRGVNLDPIGKWSKVGLVIYDSSVPVGATPEYLAGHYMLQGASSFLPVMALSPQEGEMVLDMSSAPGGKTTYIAQLMRNTGVIVANDANSERLKSVVGNIHRLGVTNTVVCNYDGRQFPKVMGGFDRVLLDAPCSGTGVIAKDPAVKTSKDEADILRSAHLQKELILSAIDSVNAESPSGGYVVYCTCSITVEENEWVVDYALKKRNVKLVPTGLDFGKEGFTNFKQFRFHPSLKLTRRFYPHSHNMDGFFVAKLKKFSNVVP 614          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Match: nsun5 (NOP2/Sun RNA methyltransferase 5 [Source:NCBI gene;Acc:101162047])

HSP 1 Score: 107.071 bits (266), Expect = 2.446e-24
Identity = 91/299 (30.43%), Postives = 138/299 (46.15%), Query Frame = 2
Query:  773 VASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVG-----------------MVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIH---KKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQK 1609
            + S E  P  +R NTLKT    + + L KRD      Q S++                  ++VFS+K        Y AGH ILQ  +S LP   L P  G  ++D CAAPG KTSH+A IM N G +FA D++  RL  +++ L R GV    +   D   ++    + K+   VL D  C+G+G+       ++S D+  L  L   Q + L  A+   ++   +VYSTCSI  +ENE+VI          + +   F +   +    +     + +  R    +    GFF+A L+K
Sbjct:  126 LPSGEQLPRYVRVNTLKTTVEDVVDYL-KRDGYTYQGQASRLDDLTLKEKSFVKDLLLPELLVFSSKTDFHDHFLYKAGHIILQDKASCLPAYLLKPPSGSHVIDACAAPGNKTSHLAAIMKNKGKLFAFDLDAKRLATMSTLLLRAGVTCQQLAHQDFLKVNPDSPQYKDVEYVLLDPSCSGSGM--VCLQDRSSADQTRLASLAAFQLRCLNHAVRFPRL-KRLVYSTCSIHSQENEEVI-------TAFLQQNSSFRLVPLLPQWPERGLAPLSQCLRASTSKTRTHGFFVALLEK 413          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene;Acc:101156691])

HSP 1 Score: 100.523 bits (249), Expect = 2.834e-22
Identity = 71/237 (29.96%), Postives = 119/237 (50.21%), Query Frame = 2
Query:  968 LQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDG-RSIHK---KVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYA--------CRKRNVKISETGLFG-------IKGFMNFRAKHFNQNMDRTRRYYPHENNMD----GFFLAKLQK 1609
            LQ   S++    L P+ GERILD+CAAPGGKT HIA +M + G + A D  ++++  +  N   + + +    C +G +++ +     ++F+RVL DAPC+G G      S  + K+      L   Q++L  +A+   K GG +VYSTC++ + ENE+ + +A         +++   I   G+ G       ++    F  +    + D+T    P +   D    GFF+AK  K
Sbjct:  207 LQNFPSVVVGHVLGPRPGERILDMCAAPGGKTCHIAALMGDQGEVVALDRIRNKIARIRQNAETLQLQSIKAYCFNGIQAVSRPPFPPESFDRVLLDAPCSGLGQRPTMASTWSLKEICSYPPL---QRKLFHAAVRLLKKGGVLVYSTCTVTLAENEEQVAWALSSFPCLTLQQQEPHIGAEGMLGAGLSCEQLRLLQRFSPE---LSWDQTDASVPLQCRADRDTIGFFIAKFLK 437          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene;Acc:101156691])

HSP 1 Score: 97.4413 bits (241), Expect = 3.197e-21
Identity = 71/245 (28.98%), Postives = 116/245 (47.35%), Query Frame = 2
Query:  968 LQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDG------------RSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYA--------CRKRNVKISETGLFG-------IKGFMNFRAKHFNQNMDRTRRYYPHENNMD----GFFLAKLQK 1609
            LQ   S++    L P+ GERILD+CAAPGGKT HIA +M + G + A D  ++++  +  N   + + +    C +G            +      ++F+RVL DAPC+G G      S  + K+      L   Q++L  +A+   K GG +VYSTC++ + ENE+ + +A         +++   I   G+ G       ++    F  +    + D+T    P +   D    GFF+AK  K
Sbjct:  220 LQNFPSVVVGHVLGPRPGERILDMCAAPGGKTCHIAALMGDQGEVVALDRIRNKIARIRQNAETLQLQSIKAYCFNGIQAVSSDLTQQTQGPPFPPESFDRVLLDAPCSGLGQRPTMASTWSLKEICSYPPL---QRKLFHAAVRLLKKGGVLVYSTCTVTLAENEEQVAWALSSFPCLTLQQQEPHIGAEGMLGAGLSCEQLRLLQRFSPE---LSWDQTDASVPLQCRADRDTIGFFIAKFLK 458          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Match: nsun6 (NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene;Acc:101156691])

HSP 1 Score: 97.4413 bits (241), Expect = 3.299e-21
Identity = 71/245 (28.98%), Postives = 116/245 (47.35%), Query Frame = 2
Query:  968 LQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDG------------RSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYA--------CRKRNVKISETGLFG-------IKGFMNFRAKHFNQNMDRTRRYYPHENNMD----GFFLAKLQK 1609
            LQ   S++    L P+ GERILD+CAAPGGKT HIA +M + G + A D  ++++  +  N   + + +    C +G            +      ++F+RVL DAPC+G G      S  + K+      L   Q++L  +A+   K GG +VYSTC++ + ENE+ + +A         +++   I   G+ G       ++    F  +    + D+T    P +   D    GFF+AK  K
Sbjct:  230 LQNFPSVVVGHVLGPRPGERILDMCAAPGGKTCHIAALMGDQGEVVALDRIRNKIARIRQNAETLQLQSIKAYCFNGIQAVSSDLTQQTQGPPFPPESFDRVLLDAPCSGLGQRPTMASTWSLKEICSYPPL---QRKLFHAAVRLLKKGGVLVYSTCTVTLAENEEQVAWALSSFPCLTLQQQEPHIGAEGMLGAGLSCEQLRLLQRFSPE---LSWDQTDASVPLQCRADRDTIGFFIAKFLK 468          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Planmine SMEST
Match: SMESG000042985.1 (SMESG000042985.1)

HSP 1 Score: 1068.14 bits (2761), Expect = 0.000e+0
Identity = 536/537 (99.81%), Postives = 537/537 (100.00%), Query Frame = 2
Query:   38 MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL 1648
            MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEE+KELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVISKDKSIKASKDEEDLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL
Sbjct:    1 MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEENKELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVISKDKSIKASKDEEDLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL 537          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Planmine SMEST
Match: SMESG000007627.1 (SMESG000007627.1)

HSP 1 Score: 1062.37 bits (2746), Expect = 0.000e+0
Identity = 534/537 (99.44%), Postives = 534/537 (99.44%), Query Frame = 2
Query:   38 MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNLNTNEISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL 1648
            MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNL TN ISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDEN LVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVISKDKSIKASKDEEDLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL
Sbjct:    1 MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSRFSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNLYTNAISDAEMSELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESIIEDEHEEQDENKLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQSKNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEEDRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGATPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRVLCDAPCTGTGVISKDKSIKASKDEEDLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQNMDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL 537          
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Planmine SMEST
Match: SMESG000076098.1 (SMESG000076098.1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.557e-18
Identity = 82/301 (27.24%), Postives = 127/301 (42.19%), Query Frame = 2
Query:  914 SAKCAIGATPEYLAGHYIL-----------QGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIM------ANTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKV-------------KNFNRVLCDAPCTGTGVXXXXXXXXXXXXXXXLKILTCIQKQLLCSAIDACKVGGYVVYSTCSILVEENEQV--------------IDYACRKRNVKISETGLFGIKGFM------------------NFRAKHFNQ------NMDRTRRYYPHENNMDGFFLAKLQKI 1612
            ++K  I  TPE    H  L           Q + SMLP + L  +   ++LDLCAAPG KT+ + +++        TG++ ANDI   R   +   L R+     VV+  D  SI  ++               F+R+L D PC+G G + K++ +              +Q ++L  +++    GG +VYSTCS+   E+E V              +D + R   + ISE+GL   K  M                  +FR+  F        N+   RR  P   N  GFF+A L+K+
Sbjct:  113 ASKMEIRKTPELKKLHNFLISETDCGFISRQEAVSMLPPLLLDIESHHKVLDLCAAPGSKTAQLVEMLHAGTDKIPTGVVIANDIESKRCYMMVHQLQRLQSPCIVVVRQDA-SIFPRIFLPDSQSKFGKSPMLFDRILADVPCSGDGTLRKNQDLWPRWSPFLGVNEHFLQMKILRRSLEMLTEGGRMVYSTCSLNPIEDEAVLAAILSQAQGTVRLVDISNRLTGL-ISESGLTRWKVMMKDCSWCSSIDEVPIAMRRSFRSSLFPPADVDSLNLQYCRRILPQNQNTGGFFIALLEKV 411          
The following BLAST results are available for this feature:
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOP22.914e-12252.99NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGN... [more]
NOP22.914e-12252.99NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGN... [more]
NOP21.031e-12153.26NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGN... [more]
NOP21.031e-12153.26NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGN... [more]
NOP21.114e-12153.26NOP2 nucleolar protein [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nol-27.578e-10646.58NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:A0... [more]
nol-21.119e-8151.38NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:A0... [more]
nsun-53.346e-2131.70Nop2 (NOP2)/SUN domain family member [Source:UniP... [more]
nsun-51.692e-2031.70Nop2 (NOP2)/SUN domain family member [Source:UniP... [more]
nsun-52.429e-2031.70Nop2 (NOP2)/SUN domain family member [Source:UniP... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG85452.248e-12348.40gene:FBgn0033741 transcript:FBtr0087934[more]
CG111091.473e-2432.63gene:FBgn0037200 transcript:FBtr0078553[more]
CG111092.669e-2432.63gene:FBgn0037200 transcript:FBtr0078552[more]
Nsun52.104e-1629.51gene:FBgn0259704 transcript:FBtr0299957[more]
Nsun23.306e-1529.03gene:FBgn0026079 transcript:FBtr0070669[more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop22.969e-12253.59NOP2 nucleolar protein homolog (yeast) [Source:ZFI... [more]
nsun58.111e-2731.80NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:... [more]
nsun51.080e-2531.80NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:... [more]
nsun68.557e-2327.67NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:... [more]
nsun68.557e-2327.67NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000026071.15.917e-11747.34NOP2 nucleolar protein [Source:NCBI gene;Acc:10049... [more]
ENSXETT00000038204.16.684e-11747.56NOP2 nucleolar protein [Source:NCBI gene;Acc:10049... [more]
ENSXETT00000026058.15.761e-11647.97NOP2 nucleolar protein [Source:NCBI gene;Acc:10049... [more]
ENSXETT00000026014.11.575e-11549.86NOP2 nucleolar protein [Source:NCBI gene;Acc:10049... [more]
sdsl3.687e-2232.43serine dehydratase like [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nop23.790e-12249.51NOP2 nucleolar protein [Source:MGI Symbol;Acc:MGI:... [more]
Nsun57.073e-2530.10NOL1/NOP2/Sun domain family, member 5 [Source:MGI ... [more]
Nsun62.178e-2129.18NOL1/NOP2/Sun domain family member 6 [Source:MGI S... [more]
Nsun62.178e-2129.18NOL1/NOP2/Sun domain family member 6 [Source:MGI S... [more]
Nsun62.178e-2129.18NOL1/NOP2/Sun domain family member 6 [Source:MGI S... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46087|NOP2_HUMAN5.350e-12153.26Probable 28S rRNA (cytosine(4447)-C(5))-methyltran... [more]
sp|Q922K7|NOP2_MOUSE3.135e-12049.26Probable 28S rRNA (cytosine-C(5))-methyltransferas... [more]
sp|O94268|NOP2_SCHPO4.078e-11551.7925S rRNA (cytosine-C(5))-methyltransferase nop2 OS... [more]
sp|Q9FG73|NOP2A_ARATH1.144e-11449.1025S rRNA (cytosine-C(5))-methyltransferase NOP2A O... [more]
sp|Q8VYM6|NOP2B_ARATH3.465e-11449.2126S rRNA (cytosine-C(5))-methyltransferase NOP2B O... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NJC02.882e-14748.5425S rRNA (Cytosine2870-C5)-methyltransferase OS=Pa... [more]
A0A0R3TVI19.817e-14548.46SAM_MT_RSMB_NOP domain-containing protein OS=Roden... [more]
A0A068WQQ22.178e-14247.49Nucleolar protein nol1:nop2 OS=Echinococcus granul... [more]
W6U8142.274e-14247.49Putative ribosomal RNA methyltransferase NOP2 OS=E... [more]
A0A087W1444.812e-14246.69Nucleolar protein nol1:nop2 OS=Echinococcus multil... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop21.349e-12151.80NOP2 nucleolar protein [Source:NCBI gene;Acc:10302... [more]
nop22.653e-12151.80NOP2 nucleolar protein [Source:NCBI gene;Acc:10302... [more]
nop23.299e-12151.80NOP2 nucleolar protein [Source:NCBI gene;Acc:10302... [more]
nsun54.121e-2433.47NOP2/Sun RNA methyltransferase 5 [Source:ZFIN;Acc:... [more]
nsun35.186e-2334.68NOP2/Sun RNA methyltransferase 3 [Source:NCBI gene... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop26.291e-12349.25NOP2 nucleolar protein homolog (yeast) [Source:ZFI... [more]
nop21.271e-12249.87NOP2 nucleolar protein homolog (yeast) [Source:ZFI... [more]
nsun61.174e-1729.38NOP2/Sun RNA methyltransferase 6 [Source:ZFIN;Acc:... [more]
nsun47.204e-1428.57NOP2/Sun RNA methyltransferase 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000605.11.521e-845.90pep scaffold:Pmarinus_7.0:GL476894:286566:292548:1... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NOP26.056e-11250.28rRNA m5C methyltransferase; methylates cytosine at... [more]
NCL15.930e-2227.47S-adenosyl-L-methionine-dependent tRNA: m5C-methyl... [more]
RCM15.918e-824.07rRNA m5C methyltransferase; methylates cytosine at... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408952.122e-12452.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378131.492e-2229.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392481.117e-1927.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453803.694e-1929.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420708.862e-1631.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015205.31.063e-12053.46NOP2 nucleolar protein [Source:NCBI gene;Acc:10117... [more]
nsun52.446e-2430.43NOP2/Sun RNA methyltransferase 5 [Source:NCBI gene... [more]
nsun62.834e-2229.96NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene... [more]
nsun63.197e-2128.98NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene... [more]
nsun63.299e-2128.98NOP2/Sun RNA methyltransferase 6 [Source:NCBI gene... [more]
back to top
BLAST of Ribosomal RNA methyltransferase Nop2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042985.10.000e+099.81SMESG000042985.1[more]
SMESG000007627.10.000e+099.44SMESG000007627.1[more]
SMESG000076098.12.557e-1827.24SMESG000076098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030466 ID=SMED30030466|Name=Ribosomal RNA methyltransferase Nop2|organism=Schmidtea mediterranea sexual|type=transcript|length=1653bp
TTTGTTTTAATATATATATTTTTTAAAATTTTTAAACATGAAGTTTTTTG
ATAGAAGTAGTAAGTTATTACAAACTAAAAAATCTAAATGTCAACCCGAT
CCAATTTTAAAAGAAAATAAAAAGAAAAGCATTCAAAAATTGGGAAGTGC
TCAGAAGAAAAGATTACAAAAAAGAATTAAATCTAGGTTTAGTAATAAAC
AAAATCTCAAAGATAAGCCTTTAAAAAAATGTGAAGAAAGCAAAGAATTG
AATCGTGAAAATAATTTTACTGGAAATATTTCGTATAAAGACACCCTTAA
TTTAAACACAAATGAAATTTCGGATGCAGAAATGAGTGAACTAAGCATTT
CAAATGAAGAAGCATTGAGTTTAAATGAAGACGAACCACATAATATGGAA
AAATTGCAAGAAAATGACTTTGAAAATTTAGTAGAAAGTGAAAGCGATGA
TCAATCGAACCATGATGATGATATGGAGTCAATAATTGAAGATGAACATG
AAGAACAAGATGAAAATAATTTAGTAACAAATATTATTGTCGGCGATGAT
GTTATTAAAGTTACTGATCTGGATAGTCTCAACTGTCGGATTAAGACAAA
TATGGAAATACTTCAAAATTATAAAACAATCCAAAGCAAAAATAAAAGCT
GTCAGTCGAGAGACTTTTATGTTAATCAATTCTTAGAAGATTTATGTATT
AAATTTTCTTATAACGAATTTTTAATTAAAAAATTTTATAATATTTTCAA
TAAAGATTTATTCAAGTTCCTTGTCGCAAGCGAAGAAGACAGACCTATGA
CTATTAGAACTAATACATTAAAAACTAGACGTCGAGCATTGAAAGAAGCT
TTAATAAAACGGGATTGTAACGTAGAAACTTTACAATTCAGTAAAGTTGG
TATGGTGGTTTTTTCTGCTAAATGTGCTATTGGTGCCACTCCTGAGTATT
TAGCTGGACATTATATTTTACAGGGAAGTAGTTCAATGCTTCCTGTAATG
GCTTTAGCTCCAAAGAAGGGTGAAAGAATCCTTGATCTGTGTGCAGCCCC
TGGTGGGAAAACGAGTCATATAGCTCAAATAATGGCAAACACGGGAATTA
TTTTTGCAAATGATATTAATAAAGACCGTTTGAAAGCGGTAACTAGTAAT
CTATCAAGAATGGGTGTAATGAATACTGTTGTAATTTGTAACGATGGTAG
ATCAATTCATAAAAAAGTAAAAAATTTTAATAGAGTTTTATGCGATGCTC
CTTGTACTGGGACAGGAGTTATTTCTAAGGATAAGTCTATCAAGGCGTCA
AAAGATGAAGAAGATTTAAAAATTTTGACATGTATTCAGAAACAATTGCT
TTGTTCCGCGATAGATGCTTGTAAAGTCGGTGGTTATGTTGTTTATTCGA
CTTGTTCTATTTTAGTTGAAGAAAATGAACAAGTTATTGATTATGCGTGT
AGAAAACGAAATGTTAAAATTTCTGAAACCGGGCTATTTGGGATCAAGGG
TTTTATGAACTTTCGTGCTAAGCATTTTAATCAAAACATGGATAGAACTA
GAAGATATTATCCACATGAAAACAATATGGATGGATTCTTTTTAGCCAAG
CTTCAAAAGATTGGTGACCATAAACCTGAAAATCTCCCTGTGAAATTGTA
ATT
back to top

protein sequence of SMED30030466-orf-1

>SMED30030466-orf-1 ID=SMED30030466-orf-1|Name=SMED30030466-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=538bp
MKFFDRSSKLLQTKKSKCQPDPILKENKKKSIQKLGSAQKKRLQKRIKSR
FSNKQNLKDKPLKKCEESKELNRENNFTGNISYKDTLNLNTNEISDAEMS
ELSISNEEALSLNEDEPHNMEKLQENDFENLVESESDDQSNHDDDMESII
EDEHEEQDENNLVTNIIVGDDVIKVTDLDSLNCRIKTNMEILQNYKTIQS
KNKSCQSRDFYVNQFLEDLCIKFSYNEFLIKKFYNIFNKDLFKFLVASEE
DRPMTIRTNTLKTRRRALKEALIKRDCNVETLQFSKVGMVVFSAKCAIGA
TPEYLAGHYILQGSSSMLPVMALAPKKGERILDLCAAPGGKTSHIAQIMA
NTGIIFANDINKDRLKAVTSNLSRMGVMNTVVICNDGRSIHKKVKNFNRV
LCDAPCTGTGVISKDKSIKASKDEEDLKILTCIQKQLLCSAIDACKVGGY
VVYSTCSILVEENEQVIDYACRKRNVKISETGLFGIKGFMNFRAKHFNQN
MDRTRRYYPHENNMDGFFLAKLQKIGDHKPENLPVKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011023Nop2p
IPR023273RCMT_NOP2
IPR023267RCMT
IPR001678MeTrfase_RsmB/NOP2
IPR031341Methyltr_RsmF_N
IPR029063SAM-dependent_MTases
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0003723RNA binding
GO:0008649rRNA methyltransferase activity
GO:0008757S-adenosylmethionine-dependent methyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0031167rRNA methylation
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023267RNA (C5-cytosine) methyltransferasePRINTSPR02008RCMTFAMILYcoord: 398..410
score: 59.7
coord: 303..317
score: 29.92
coord: 507..524
score: 42.75
coord: 332..342
score: 81.71
coord: 448..464
score: 60.13
IPR023273RNA (C5-cytosine) methyltransferase, NOP2PRINTSPR02012RCMTNOP2coord: 240..252
score: 36.27
coord: 263..276
score: 55.22
coord: 208..228
score: 38.21
IPR001678SAM-dependent methyltransferase RsmB/NOP2-typePFAMPF01189Methyltr_RsmB-Fcoord: 320..523
e-value: 5.9E-70
score: 235.0
IPR001678SAM-dependent methyltransferase RsmB/NOP2-typePROSITEPS51686SAM_MT_RSMB_NOPcoord: 244..525
score: 69.856
IPR011023Nop2pTIGRFAMTIGR00446TIGR00446coord: 256..524
e-value: 2.8E-92
score: 306.6
IPR031341Ribosomal RNA small subunit methyltransferase F, N-terminalPFAMPF17125Methyltr_RsmF_Ncoord: 230..317
e-value: 3.8E-8
score: 33.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 320..534
e-value: 3.4E-73
score: 248.4
NoneNo IPR availableGENE3DG3DSA:3.30.70.3130coord: 212..316
e-value: 6.3E-29
score: 102.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 34..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..60
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 19..33
NoneNo IPR availablePANTHERPTHR22807:SF3028S RRNA (CYTOSINE(4447)-C(5))-METHYLTRANSFERASE-RELATEDcoord: 26..527
NoneNo IPR availablePANTHERPTHR22807NOP2 YEAST -RELATED NOL1/NOP2/FMU SUN DOMAIN-CONTAININGcoord: 26..527
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 330..406
e-value: 1.20381E-4
score: 39.3355
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 216..525