SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D

Overview
NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Smed IDSMED30030460
Length (bp)1980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D (SMED30030460) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D (SMED30030460) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D (SMED30030460) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D (SMED30030460) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030460

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030460SMESG000051399.1 SmedASXL_010370SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030460SMESG000051399.1 SmedASXL_010370SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30030460SMESG000051399.1 dd_Smed_v4_3916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030460SMESG000051399.1 dd_Smed_v4_3916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030460SMESG000051399.1 dd_Smed_v4_3916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Match: SMARCD1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:HGNC Symbol;Acc:HGNC:11106])

HSP 1 Score: 466.848 bits (1200), Expect = 3.058e-158
Identity = 248/467 (53.10%), Postives = 322/467 (68.95%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSNIPSA--NLSQSG----------------------NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PG    SRM    P++       N PS    L+QSG                      NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL +++   +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER+++ CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:   59 PRPGMLPGSRMTPQGPSMGPPGYGGN-PSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Match: SMARCD2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:HGNC Symbol;Acc:HGNC:11107])

HSP 1 Score: 440.654 bits (1132), Expect = 3.403e-148
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      +        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S DPQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   61 GAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 491          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Match: SMARCD2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:HGNC Symbol;Acc:HGNC:11107])

HSP 1 Score: 438.728 bits (1127), Expect = 4.609e-148
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      +        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S DPQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   23 GAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 453          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Match: SMARCD2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:HGNC Symbol;Acc:HGNC:11107])

HSP 1 Score: 439.113 bits (1128), Expect = 8.569e-148
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      +        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S DPQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   50 GAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 480          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Match: SMARCD2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:HGNC Symbol;Acc:HGNC:11107])

HSP 1 Score: 440.269 bits (1131), Expect = 1.512e-147
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      +        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S DPQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   98 GAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 528          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Match: ham-3 (pep chromosome:WBcel235:III:10120781:10122928:1 gene:WBGene00044072.1 transcript:ZK1128.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ham-3)

HSP 1 Score: 376.326 bits (965), Expect = 2.436e-124
Identity = 215/443 (48.53%), Postives = 286/443 (64.56%), Query Frame = 3
Query:  645 RMPHPNPTLNNNRRVSN--IPSANLSQSGNRNS--IKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKA------KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQV--DGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            R  HP  T    RR  N  +P       GNR     K+K++  D+L+   VR+L+PES+AYM +L  E+ LD  + R+++ +QE +KRP KIKK+LR+ +S TF  G    P  + ++A+         P WELRVEGRL D+     + A      KRKFSS+FKSLVIELDKD+YGPDNHLVEWHR   T ETDGFQVKRPG+  VKC + L+L+ +P ++KL P LA+VLGI  +TR +II ALW YIKT +LQDP +RD IN D +LEQ F   +++F EIP RL  LL  PDP+++NH+IQ   DG++ K  +CYDIDVE++D  K  + N+  N +   +I  LD KI DLVDQIN+ KLRR+FFL +SN+P  FI +W+ SQ  DLK + + S G  E +R +  +    T E V RY Y KI Q+R ELE +L +
Sbjct:   14 RFNHPA-TPQQVRRPINAPLPGQTAQIQGNRGPQPPKKKKRYADKLIQPKVRELVPESQAYMDLLAFEQKLDSTITRKKIDVQEALKRPQKIKKRLRIYISHTFIAGKE--PEKEGDDAS--------VPMWELRVEGRLLDDMQHPTVGANPRPAPKRKFSSFFKSLVIELDKDIYGPDNHLVEWHRTPQTNETDGFQVKRPGDRPVKCTILLLLDYQPMKFKLHPRLAKVLGIAAETRPRIIEALWQYIKTHKLQDPQDRDTINNDLFLEQCFGVSKMRFMEIPQRLHQLLQQPDPLVLNHIIQRPDDGQD-KTSACYDIDVELEDPVKQQMANFVHNQTNANDIQLLDQKIFDLVDQINEMKLRRDFFLRFSNEPSGFIKKWVVSQNSDLKTLTESS-GDGESDRYATTYSTTDTDEGVSRYMYQKIQQKRAELEQSLGI 443          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Match: swsn-2.2 (SWI/SNF nucleosome remodeling complex component [Source:UniProtKB/TrEMBL;Acc:O02101])

HSP 1 Score: 357.451 bits (916), Expect = 5.564e-117
Identity = 195/407 (47.91%), Postives = 265/407 (65.11%), Query Frame = 3
Query:  738 IKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDE-TNAGEIKA-----KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQIS-CYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            + +K+K  D+ +   +R+L P++E YM +L  E+ LD  L R++L IQE +KRP K+KK+LR+ +S TF      I   Q    T  +SL    P WELRVEGRL DE   A  I       KRKFSS+FKSLVIELDK++YGPD HLVEWHR   T ETDGFQVKR G+  VKC++ L+L++ P ++KL P LA+VLGI T+TR +II ALW YIKT  LQDP ERD INCD +L Q F   R++F E+PN+L  LL   DP+  NH+IQ   E  +Q+S CYDIDVE++D  K  +  +  +     +I  LD K +D+++QIN+ K RR+F+  +  +P +FI  W+ SQ  DLK M ++S G  E ER ++ +  P T+E V RY + K+NQ+R ELE +L +
Sbjct:   51 LPKKKKYADKCIHPKIRELEPDAENYMALLASEQKLDSTLSRKKLDIQEALKRPSKVKKRLRIYISHTF------IEEKQPEKDTDEASL----PMWELRVEGRLLDEQPPAPAIPGQRPVPKRKFSSFFKSLVIELDKEMYGPDQHLVEWHRTPQTNETDGFQVKRAGDRPVKCRILLLLDNHPAKFKLHPRLAKVLGIATETRPKIIEALWQYIKTHGLQDPQERDIINCDTFLSQCFGVNRMRFMEVPNKLHQLLQQTDPLEFNHIIQRPKEGQEQVSTCYDIDVEMEDPVKQFMHTFVHSPGLANDIQTLDQKCYDIIEQINELKTRRDFYARFYTEPAEFIKSWVMSQNSDLKTMNELS-GDLEAERFAESYVRPETEEGVQRYMFQKVNQKRHELEQSLGV 446          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Match: swsn-2.2 (SWI/SNF nucleosome remodeling complex component [Source:UniProtKB/TrEMBL;Acc:O02101])

HSP 1 Score: 357.451 bits (916), Expect = 5.564e-117
Identity = 195/407 (47.91%), Postives = 265/407 (65.11%), Query Frame = 3
Query:  738 IKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDE-TNAGEIKA-----KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQIS-CYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            + +K+K  D+ +   +R+L P++E YM +L  E+ LD  L R++L IQE +KRP K+KK+LR+ +S TF      I   Q    T  +SL    P WELRVEGRL DE   A  I       KRKFSS+FKSLVIELDK++YGPD HLVEWHR   T ETDGFQVKR G+  VKC++ L+L++ P ++KL P LA+VLGI T+TR +II ALW YIKT  LQDP ERD INCD +L Q F   R++F E+PN+L  LL   DP+  NH+IQ   E  +Q+S CYDIDVE++D  K  +  +  +     +I  LD K +D+++QIN+ K RR+F+  +  +P +FI  W+ SQ  DLK M ++S G  E ER ++ +  P T+E V RY + K+NQ+R ELE +L +
Sbjct:   51 LPKKKKYADKCIHPKIRELEPDAENYMALLASEQKLDSTLSRKKLDIQEALKRPSKVKKRLRIYISHTF------IEEKQPEKDTDEASL----PMWELRVEGRLLDEQPPAPAIPGQRPVPKRKFSSFFKSLVIELDKEMYGPDQHLVEWHRTPQTNETDGFQVKRAGDRPVKCRILLLLDNHPAKFKLHPRLAKVLGIATETRPKIIEALWQYIKTHGLQDPQERDIINCDTFLSQCFGVNRMRFMEVPNKLHQLLQQTDPLEFNHIIQRPKEGQEQVSTCYDIDVEMEDPVKQFMHTFVHSPGLANDIQTLDQKCYDIIEQINELKTRRDFYARFYTEPAEFIKSWVMSQNSDLKTMNELS-GDLEAERFAESYVRPETEEGVQRYMFQKVNQKRHELEQSLGV 446          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Match: K03B8.4 (pep chromosome:WBcel235:V:11394786:11395124:-1 gene:WBGene00010523.1 transcript:K03B8.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K03B8.4)

HSP 1 Score: 45.8246 bits (107), Expect = 5.432e-6
Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 1770 SQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENAL 1931
            SQ  DLK M ++S G  E ER ++ +  P T+E V RY + K+NQ+R ELE  L
Sbjct:    2 SQNSDLKTMNELS-GDLEAERFAESYVRPETEEGVQRYMFQKVNQKRHELEQIL 54          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Match: T24G10.2 (pep chromosome:WBcel235:III:5440862:5442761:-1 gene:WBGene00020779.1 transcript:T24G10.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T24G10.2)

HSP 1 Score: 48.9062 bits (115), Expect = 8.364e-6
Identity = 20/42 (47.62%), Postives = 26/42 (61.90%), Query Frame = 3
Query: 1332 RAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIK 1457
            R  ++ ALW+YIK   L+DP    YI CD  LE IF+  R+K
Sbjct:  217 RCDVVKALWDYIKENNLKDPKNGQYIICDSTLESIFKKNRLK 258          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Fly
Match: Bap60 (gene:FBgn0025463 transcript:FBtr0073741)

HSP 1 Score: 439.884 bits (1130), Expect = 6.285e-148
Identity = 227/395 (57.47%), Postives = 289/395 (73.16%), Query Frame = 3
Query:  756 MGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAG-EIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            + +++LP+ VR L+PES+AYM +L  E+ LD  ++R+RL IQE +KRP K K+KLR+ +S TF P       +  N+   G+        WELRVEGRL ++       K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + L+L+ +P Q+KL+P LAR+LG+HT TR  II ALW YIKT +LQD HER+YINCD+YLEQIF  +R+KFAEIP RL PLL PPDPI+INH I+  G E KQ +CYDIDVEVDD  K  + ++  + +  QEI  LD KIH+ VD INQ K  REFFL ++ DPQ FI RW+ S+ RDLK+M DV+ G+PEEER+++F+  PWT EAV RYF+ K+NQ+R ELE AL +
Sbjct:  130 LAEKILPQKVRDLVPESQAYMDLLTFERKLDATIMRKRLDIQEALKRPMKQKRKLRIFISNTFYPS-----KEPTNDGEEGAVA-----SWELRVEGRLLEDGKGDPNTKIKRKFSSFFKSLVIELDKELYGPDNHLVEWHRTHTTQETDGFQVKRPGDRNVRCTILLLLDYQPLQFKLDPRLARLLGVHTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQRMKFAEIPQRLNPLLHPPDPIVINHFIE-SGAENKQTACYDIDVEVDDTLKNQMNSFLMSTASQQEIQGLDTKIHETVDTINQMKTNREFFLSFAKDPQMFIHRWIISETRDLKLMTDVA-GNPEEERRAEFYYQPWTHEAVSRYFFTKVNQKRAELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1835])

HSP 1 Score: 469.544 bits (1207), Expect = 1.846e-159
Identity = 235/401 (58.60%), Postives = 302/401 (75.31%), Query Frame = 3
Query:  744 RKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKA---KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP     P+ +    T  S        WELRVEGRL ++T   + +A   KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+  V+C + LML+ +P QYKL+P LAR+LGIHT TR  II ALW Y+KT +LQDPHER++INCD+YL+QIF+ +R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:  119 KKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAK---PDAEDGEGTVAS--------WELRVEGRLLEDTAVSKYEATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVGVRCTVLLMLDYQPPQYKLDPRLARLLGIHTQTRPVIIQALWQYVKTHKLQDPHEREFINCDKYLQQIFETQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAGLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYYQPWAQEAVCRYFYSKVQQRRQELEQALGI 507          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Match: smarcd3a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3a [Source:ZFIN;Acc:ZDB-GENE-070912-491])

HSP 1 Score: 451.825 bits (1161), Expect = 1.995e-153
Identity = 243/461 (52.71%), Postives = 316/461 (68.55%), Query Frame = 3
Query:  624 PGRNIPSRMPH----------------------PNPTLNNNR-RVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            PG    +RMPH                      PNP L+ NR R +           NR+   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP     P+ + +  +  S        WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD HE++YINCD+Y +QIF   R+KF EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEVDD  K  +  +  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  W+ SQ RDLK+M D   G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE AL +
Sbjct:    6 PGMTSGARMPHQGAPMGPPGPPYGGTPQIRPGMPNPALDPNRKRPAPTQPVQPPSVQNRSRNAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAK---PDTEDSEGSIAS--------WELRVEGKLLDDPG----KQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHEKEYINCDKYFQQIFDCPRLKFCEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVDDPLKGQMNGFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWICSQNRDLKLMTDTV-GNPEEERRAEFYNQPWSQEAVSRYFYCKIQQRRQELEQALAM 450          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Match: smarcd3a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3a [Source:ZFIN;Acc:ZDB-GENE-070912-491])

HSP 1 Score: 452.21 bits (1162), Expect = 2.519e-153
Identity = 243/461 (52.71%), Postives = 316/461 (68.55%), Query Frame = 3
Query:  624 PGRNIPSRMPH----------------------PNPTLNNNR-RVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            PG    +RMPH                      PNP L+ NR R +           NR+   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP     P+ + +  +  S        WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD HE++YINCD+Y +QIF   R+KF EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEVDD  K  +  +  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  W+ SQ RDLK+M D   G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE AL +
Sbjct:   28 PGMTSGARMPHQGAPMGPPGPPYGGTPQIRPGMPNPALDPNRKRPAPTQPVQPPSVQNRSRNAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAK---PDTEDSEGSIAS--------WELRVEGKLLDDPG----KQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHEKEYINCDKYFQQIFDCPRLKFCEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVDDPLKGQMNGFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWICSQNRDLKLMTDTV-GNPEEERRAEFYNQPWSQEAVSRYFYCKIQQRRQELEQALAM 472          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3b [Source:ZFIN;Acc:ZDB-GENE-080509-2])

HSP 1 Score: 450.284 bits (1157), Expect = 1.506e-152
Identity = 231/404 (57.18%), Postives = 303/404 (75.00%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            NRN   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFN      P+ + +  +  S        WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEV+D  K  + ++  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV+ G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE AL L
Sbjct:   86 NRNRNAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNAAK---PDAEDSEGSIAS--------WELRVEGKLLDDPG----KMKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTGTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSSIIQALWQYVKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVEDPLKAQMSSFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVA-GNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQALAL 473          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3b [Source:ZFIN;Acc:ZDB-GENE-080509-2])

HSP 1 Score: 450.669 bits (1158), Expect = 3.229e-152
Identity = 243/453 (53.64%), Postives = 320/453 (70.64%), Query Frame = 3
Query:  597 GFQNRNIPTPGRNIPSRMPHPNPTLNNNRR-----VSNIPSANLSQSGNRNS-IKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            GF   N   PGR +  R    +PTL +         ++I     S    RNS   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFN      P+ + +  +  S        WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEV+D  K  + ++  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV+ G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE AL L
Sbjct:   72 GFPGPN-EMPGRQMDLRETQSDPTLGSKFSDECWGKTSILRKKWSTQTERNSNSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNAAK---PDAEDSEGSIAS--------WELRVEGKLLDDPG----KMKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTGTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSSIIQALWQYVKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVEDPLKAQMSSFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVA-GNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQALAL 507          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:448163])

HSP 1 Score: 468.003 bits (1203), Expect = 7.271e-159
Identity = 235/407 (57.74%), Postives = 304/407 (74.69%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL ++    +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER++I CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K++REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:  111 NRNHSAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDAALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDMNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFIICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAALDNKIHETIETINQLKIQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 505          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:448163])

HSP 1 Score: 450.284 bits (1157), Expect = 7.999e-152
Identity = 226/394 (57.36%), Postives = 294/394 (74.62%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKI 1898
            NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL ++    +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER++I CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K++REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+
Sbjct:  111 NRNHSAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDAALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDMNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFIICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAALDNKIHETIETINQLKIQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKV 492          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:448163])

HSP 1 Score: 451.055 bits (1159), Expect = 8.501e-152
Identity = 226/394 (57.36%), Postives = 294/394 (74.62%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKI 1898
            NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL ++    +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER++I CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K++REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+
Sbjct:  132 NRNHSAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDAALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDMNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFIICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAALDNKIHETIETINQLKIQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKV 513          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:448163])

HSP 1 Score: 444.121 bits (1141), Expect = 1.929e-150
Identity = 226/390 (57.95%), Postives = 290/390 (74.36%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNK 1895
            NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +        +A  G         WELRVEGRL ++        KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER++I CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K++REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K
Sbjct:   63 NRNHSAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKS--------DAEDGEG---TVASWELRVEGRLLED--------KRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDMNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFIICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAALDNKIHETIETINQLKIQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSK 432          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:448163])

HSP 1 Score: 444.121 bits (1141), Expect = 3.460e-150
Identity = 226/390 (57.95%), Postives = 290/390 (74.36%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNK 1895
            NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +        +A  G         WELRVEGRL ++        KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER++I CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K++REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K
Sbjct:   79 NRNHSAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKS--------DAEDGEG---TVASWELRVEGRLLED--------KRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDMNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFIICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAALDNKIHETIETINQLKIQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSK 448          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Match: Smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:MGI Symbol;Acc:MGI:1933623])

HSP 1 Score: 466.077 bits (1198), Expect = 4.482e-158
Identity = 248/467 (53.10%), Postives = 321/467 (68.74%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSNIPSA--NLSQSG----------------------NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PG    SRM    P++       N PS    L+QSG                      NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL ++    +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER+++ CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:   59 PRPGMLPGSRMTPQGPSMGPPGYGGN-PSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDAALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Match: Smarcd2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:MGI Symbol;Acc:MGI:1933621])

HSP 1 Score: 439.499 bits (1129), Expect = 4.540e-148
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      N        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S +PQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   51 GTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 481          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Match: Smarcd2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:MGI Symbol;Acc:MGI:1933621])

HSP 1 Score: 441.039 bits (1133), Expect = 5.197e-148
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      N        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S +PQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   98 GTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 528          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Match: Smarcd3 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:MGI Symbol;Acc:MGI:1914243])

HSP 1 Score: 434.876 bits (1117), Expect = 9.053e-147
Identity = 222/401 (55.36%), Postives = 302/401 (75.31%), Query Frame = 3
Query:  729 RNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENAL 1931
            R+   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP     P+ + ++ +  S        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ +V+C L LML+ +P Q+KL+P LAR+LG+HT +R+ I+ ALW Y+KT RLQD H+++YIN D+Y +QIF   R+KF+EIP RLT LLLPPDPI+INHVI VD  + K+ +CYDIDVEV++  K  + ++  + +  QEI+ LD+KIH+ ++ INQ K++R+F L +S DP+ ++   L SQ RDLKVM DV+ G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE +L
Sbjct:   65 RSRSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAK---PDAEDSDGSIAS--------WELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVA-GNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSL 449          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Match: Smarcd3 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:MGI Symbol;Acc:MGI:1914243])

HSP 1 Score: 435.261 bits (1118), Expect = 1.647e-146
Identity = 222/401 (55.36%), Postives = 302/401 (75.31%), Query Frame = 3
Query:  729 RNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENAL 1931
            R+   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP     P+ + ++ +  S        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ +V+C L LML+ +P Q+KL+P LAR+LG+HT +R+ I+ ALW Y+KT RLQD H+++YIN D+Y +QIF   R+KF+EIP RLT LLLPPDPI+INHVI VD  + K+ +CYDIDVEV++  K  + ++  + +  QEI+ LD+KIH+ ++ INQ K++R+F L +S DP+ ++   L SQ RDLKVM DV+ G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE +L
Sbjct:   94 RSRSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAK---PDAEDSDGSIAS--------WELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVA-GNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSL 478          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Match: sp|Q96GM5|SMRD1_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2)

HSP 1 Score: 466.848 bits (1200), Expect = 1.469e-157
Identity = 248/467 (53.10%), Postives = 322/467 (68.95%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSNIPSA--NLSQSG----------------------NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PG    SRM    P++       N PS    L+QSG                      NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL +++   +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER+++ CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:   59 PRPGMLPGSRMTPQGPSMGPPGYGGN-PSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Match: sp|Q61466|SMRD1_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Mus musculus OX=10090 GN=Smarcd1 PE=1 SV=3)

HSP 1 Score: 466.077 bits (1198), Expect = 3.135e-157
Identity = 248/467 (53.10%), Postives = 321/467 (68.74%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSNIPSA--NLSQSG----------------------NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PG    SRM    P++       N PS    L+QSG                      NRN   +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL ++    +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER+++ CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:   59 PRPGMLPGSRMTPQGPSMGPPGYGGN-PSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDAALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVLCDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Match: sp|Q2TBN1|SMRD1_BOVIN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Bos taurus OX=9913 GN=SMARCD1 PE=2 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.425e-154
Identity = 246/467 (52.68%), Postives = 320/467 (68.52%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSNIPSA--NLSQSG----------------------NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGE---IKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PG    SRM    P++       N PS    L+QSG                      NRN   +K+KM D++LP+ +R+L+PES+ YM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP  +   + +   A+           WELRVEGRL +++   +    K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ NV+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW YIKT +LQDPHER+++ CD+YL+QIF+++R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDID EVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLKVM DV  G+ EEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:   59 PRPGMLPGSRMTPQGPSMGPPGYGGN-PSVRPGLAQSGMDQSLKRPAPQQIKQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQDYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVAS-----------WELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDEEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKVMTDVV-GNSEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Match: sp|O54772|SMRD2_RAT (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Rattus norvegicus OX=10116 GN=Smarcd2 PE=1 SV=3)

HSP 1 Score: 441.039 bits (1133), Expect = 3.596e-147
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      N        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S +PQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   98 GTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNSGTAGTPGGTPAADKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 528          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Match: sp|Q99JR8|SMRD2_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Mus musculus OX=10090 GN=Smarcd2 PE=1 SV=2)

HSP 1 Score: 441.039 bits (1133), Expect = 3.635e-147
Identity = 228/437 (52.17%), Postives = 298/437 (68.19%), Query Frame = 3
Query:  627 GRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G   P R   P   ++  R+   +P A       R  +KR RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF+P      N        G+        WELRVEG+L D+ +    K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HER+YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +CYDIDVEVDD  K  + N+  + +  QEI +LD KIH+ ++ INQ K +R+F L +S +PQ FI  WL SQ RDLK++ DV  G+PEEER++ F+  PW QEAV R+ + K+ QRRQELE  L +
Sbjct:   98 GTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKR-RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWELRVEGKLLDDPS----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVI-GNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGI 528          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Match: A0A4Z2CLV6 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin D1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009566 PE=4 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 4.628e-174
Identity = 262/457 (57.33%), Postives = 346/457 (75.71%), Query Frame = 3
Query:  618 PTPGRNIPS--RMPHPN--PTL--NNNRRVSNIPSANLSQS--------GNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTD---ETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P PGR I S  R   P   P++   ++ ++S + S  +  +        G   + KRKR++ DRLL K VR++IPESE+YM++LE+EK LD VL+R+RL++QE MK+P K+K+KLRV+LS+TF PGS ++        T G       PGWEL+VEG+L D   + +  + K +RKFSS+FKSLVIELD++LYGPDNHLVEWHR + T ETDGFQVKR G++NV+C + LML+ +P QYKL+P LAR+L +HT TR+QI YALWNYIKT RLQDP+E+D+INCD YLEQ+F   R++FA+IP+RL PL  PPDPI+INH+I V+G+ PK  +CYDI+VEVDD YK M+ +Y  N   +QE++++DNKIH+LV+QINQ K+ REF+LE+S DPQ FI+RWLASQCRD  VM D +PGHPEEER ++F+ A WTQEAVMRYFYN+I+QRRQ+LE+AL L
Sbjct:   13 PVPGRAIISGPRASGPGILPSMVGQDSNQISQLASRRMLTADPRLHQIIGRAATAKRKRRLADRLLTKTVREIIPESESYMELLEVEKKLDFVLMRKRLTLQEAMKKPFKVKRKLRVMLSSTFKPGSTVMSVGSDGQPTPGD----CAPGWELKVEGQLLDKPGQPSNNDPKCRRKFSSFFKSLVIELDRELYGPDNHLVEWHRTATTAETDGFQVKRRGDSNVRCTVLLMLDHQPPQYKLDPRLARILALHTGTRSQIFYALWNYIKTHRLQDPNEKDFINCDSYLEQVFGCPRMRFADIPSRLAPLQQPPDPIVINHIITVEGDGPK-TACYDIEVEVDDVYKSMVHSYLTNMHTSQELSSIDNKIHELVEQINQMKVHREFYLEFSRDPQTFISRWLASQCRDFWVMTDATPGHPEEERHAEFYNAHWTQEAVMRYFYNRISQRRQDLEHALGL 464          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Match: A0A5K4F244 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 9.319e-174
Identity = 262/458 (57.21%), Postives = 343/458 (74.89%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPN-----PTL--NNNRRVSNIPSANLSQS--------GNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTD---ETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            PTPGR I S  P P+     P++   +  +VS + S  +  +        G   + KRKR++ DRLL K VR++IPESE+YM++LE+EK LD VL+R+RL++QE MK+P K+K+KLRV+LS+TF PGS ++P       T G       PGWEL+VEG+L D   + +  + K +RKFSS+FKSLVIELD++LYGPDNHLVEWHR + T ETDGFQVKR G++NV+C + LML+ +P QYKL+  LAR+L +HT TR+QI YALWNYIKT RLQDP+E+D+INCD YLEQ+F   R++FA+IP+RL PL  PPDPI+INH+I V+G+   + +CYDI+VEVDD YK M+  Y  N    QE++ +DNKIH+LV+QINQ K+ REF+LE+S DPQ FI+RWLASQCRD  VM D +PGHPEEER ++F+ A WTQEAVMRYFYN+I+QRRQ+LE+AL L
Sbjct:   14 PTPGRAIISG-PRPSGPGILPSIVSQDGNQVSQLVSRRMLPADPRLHQVIGRAATAKRKRRLADRLLTKTVREIIPESESYMELLEVEKKLDFVLMRKRLTLQEAMKKPFKVKRKLRVMLSSTFKPGSTVMPVGSDAQTTPGD----CAPGWELKVEGQLLDKPGQPSNNDPKCRRKFSSFFKSLVIELDRELYGPDNHLVEWHRTATTAETDGFQVKRRGDSNVRCTVLLMLDHQPPQYKLDSRLARILALHTGTRSQIFYALWNYIKTHRLQDPNEKDFINCDSYLEQVFGCPRMRFADIPSRLAPLQQPPDPIVINHIITVEGDGSPKTACYDIEVEVDDVYKSMVHTYLTNMHTGQELSAIDNKIHELVEQINQMKVHREFYLEFSRDPQTFISRWLASQCRDFWVMTDATPGHPEEERHAEFYNAHWTQEAVMRYFYNRISQRRQDLEHALGL 466          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Match: A0A0X3P664 (SWIB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR151956 PE=4 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 3.021e-173
Identity = 263/452 (58.19%), Postives = 338/452 (74.78%), Query Frame = 3
Query:  618 PTPGRNIPSRMPHPNPTLNNNRRVSN---IP-SANLSQSGNRNSI-KRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSL-QQVGPGWELRVEGRLTDET-----NAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNLG 1940
            P  G   P   P   PT  N+ ++S    +P  + L Q  +RN + K+KR++ DRLL K VRQ+IPESE+YM++LE+EK LD VL R+RL++QE +K+P K K+ LRV+LS+TF PG+        +    G  L + + PGWEL+VEG+L ++T     +A +++ +RKFS++FKSLVIELD+DLYGPDNHLVEWHR  +T ETDGFQVKR G  NV+C + LML+ +P QYKL+  LAR+LG+HT TR+QI YALWNYIK  RLQD HE+D+INCDQYLEQ+F  +R++FAEIPNRL  L   PDPI+INHVI  +GE+P + SCYDI+VEVDD YK M+QNY QN   NQE+ ++DNKI++LV+QINQ K+ REF+LE+S DPQ FITRWLASQ  DL+VM D  PGHPEEER++DF+ A W QEAV RYFYN++ QRR ELE A NLG
Sbjct:   13 PARGPTAPGAQPMNVPTNQNSPQMSGRRLLPIDSRLHQIASRNPLTKKKRRLADRLLTKTVRQIIPESESYMELLEVEKKLDLVLSRKRLTLQESLKQPAKTKRTLRVVLSSTFRPGT------VGSIGVDGQPLTESMPPGWELKVEGQLLEKTGQSGNSALDLRYRRKFSTFFKSLVIELDRDLYGPDNHLVEWHRTPSTAETDGFQVKRTGMNNVRCTILLMLDYQPPQYKLDARLARLLGLHTGTRSQIFYALWNYIKVHRLQDSHEKDFINCDQYLEQVFGCQRMRFAEIPNRLAQLQHAPDPIVINHVIINEGEDPNKTSCYDIEVEVDDVYKCMVQNYLQNTQSNQELASIDNKIYELVEQINQMKVHREFYLEFSQDPQGFITRWLASQSHDLQVMTDAVPGHPEEERRADFYHASWMQEAVKRYFYNRVIQRRHELEQAFNLG 458          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Match: A0A564Y6I5 (SWIB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3388 PE=4 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 5.647e-169
Identity = 256/448 (57.14%), Postives = 333/448 (74.33%), Query Frame = 3
Query:  624 PGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGS--NLIPNDQMNNATHGSSLQQVGPGWELRVEGRL-------TDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNLG 1940
            P  N+P+R P P   +   R + N P  +   + N+ + K+KR+M DRLL K VRQ+IPESE+YM++LE+EK LD VL+R+RL++QE +K+P K K+ LRV+LS+ F PG+  ++ P+ Q NN           PGWEL+VEG+L       +      + K +RKFS++FKSLVIELD +LYGPDNHLVEWHR ++TQETDGFQVKR G++NV+C + LML+ +P QYKL+P LAR+LG+HT TR+QI YALWNYIK  RLQD HE+D+INCD YLEQ+F   R++FAEIP+RL  L L PDPIIINHVI  D E+P +  CYDI+VEVDD YK M+QNY QN   NQE+T +DNKI++LVDQINQ K+ REF+LE+S DP  FITRWLASQ  DL+ M D +PGHPE+ER ++F++ PW  EA+ RY Y ++ QRRQELE+ALN+G
Sbjct:    9 PPFNMPTRGP-PAQNIQQRRLLPNDPRMHHVVAKNQFN-KKKRRMADRLLTKTVRQIIPESESYMELLEVEKKLDLVLMRKRLTLQESLKQPLKTKRTLRVMLSSAFKPGTPDSIGPDGQSNNDG-------CPPGWELKVEGQLFEKPPGQSSSPPVVDTKFRRKFSTFFKSLVIELDHELYGPDNHLVEWHRTASTQETDGFQVKRSGDSNVRCTIILMLDYQPPQYKLDPRLARILGLHTGTRSQIFYALWNYIKVHRLQDAHEKDFINCDIYLEQVFGCSRMRFAEIPSRLIQLQLAPDPIIINHVIVNDSEDPNKTLCYDIEVEVDDAYKSMVQNYLQNTQSNQELTAIDNKIYELVDQINQMKVHREFYLEFSQDPHTFITRWLASQSHDLQQMTDATPGHPEQERHAEFYEEPWVHEAIKRYLYQRVVQRRQELEHALNIG 447          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Match: A0A4S2L1N5 (SWIB domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010164 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 6.133e-169
Identity = 246/398 (61.81%), Postives = 318/398 (79.90%), Query Frame = 3
Query:  756 MGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQ-QVGPGWELRVEGRLTD---ETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            + DRLLPK +R++IPESE+YM++LE+EK LD VL+R+RL++QE MKRP K+K+KLRV+LS+TF PG   IP   +     G  L     PGWELRVEG+L D   + +  + K +RKFSS+FKSLVIELD+DLYGPDNHLVEWHR   T ETDGFQVKR G++NV+C + LML+ +P +YKL+P LAR+L +H+ TR+QI YALW+YIKT +LQDP+E+D+INCD YLEQ+F   R++FAEIP+RL PL  PPDP++INHVI V+G+ PK  +CYDIDVEVDD YK M+ +Y  +   NQE++ +D+KIH+ V+QINQ K+ REF+LE+S DPQ FI+RWLASQ RD  VM D +PGHPEEER+++F+ APWTQEAVMRYFYN+I+QRRQ+LE+AL L
Sbjct:   75 LADRLLPKTIREIIPESESYMELLEVEKKLDFVLMRKRLTLQEAMKRPFKVKRKLRVMLSSTFKPG---IPAGAV--GPDGQRLTGDAAPGWELRVEGQLLDKPGQPSNNDAKYRRKFSSFFKSLVIELDRDLYGPDNHLVEWHRTPTTAETDGFQVKRRGDSNVRCTVLLMLDHQPPEYKLDPRLARILALHSGTRSQIFYALWSYIKTHKLQDPNEKDFINCDPYLEQVFNCPRMRFAEIPSRLVPLQQPPDPVVINHVITVEGDSPK-TACYDIDVEVDDVYKTMVHSYLSSVQSNQELSAIDSKIHEFVEQINQMKVHREFYLEFSRDPQAFISRWLASQARDYWVMTDATPGHPEEERRAEFYHAPWTQEAVMRYFYNRISQRRQDLEHALGL 466          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:103047592])

HSP 1 Score: 466.077 bits (1198), Expect = 5.416e-158
Identity = 234/401 (58.35%), Postives = 301/401 (75.06%), Query Frame = 3
Query:  744 RKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKA---KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP     P+ +    T  S        WELRVEGRL ++T   + +A   KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+  V+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW Y+KT +LQDPHER++INCD+YL+QIF+ +R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:  138 KKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAK---PDAEDGEGTVAS--------WELRVEGRLLEDTAVSKYEATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVGVRCTVLLMLDYQPPQFKLDPRLARMLGIHTQTRPVIIQALWQYVKTHKLQDPHEREFINCDKYLQQIFETQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAGLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGI 526          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3b [Source:ZFIN;Acc:ZDB-GENE-080509-2])

HSP 1 Score: 452.981 bits (1164), Expect = 5.667e-154
Identity = 238/428 (55.61%), Postives = 308/428 (71.96%), Query Frame = 3
Query:  660 NPTLNNNRR--VSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            NPT+  NR+    +          NRN   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP            A    S   +   WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW YIKT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEV+D  K  + N+  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV  G+PEEER+++F+  PW+QEAV RYFY KI QRRQELE AL +
Sbjct:   40 NPTMEANRKRPAPSQQQMQQQAVQNRNRNTKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPA----------KADADDSDGSIA-SWELRVEGKLLDDP----AKVKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYIKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVEDPLKAQMSNFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVV-GNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQALAI 451          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3b [Source:ZFIN;Acc:ZDB-GENE-080509-2])

HSP 1 Score: 436.032 bits (1120), Expect = 1.625e-146
Identity = 229/420 (54.52%), Postives = 300/420 (71.43%), Query Frame = 3
Query:  660 NPTLNNNRR--VSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQ 1913
            NPT+  NR+    +          NRN   ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP            A    S   +   WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW YIKT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INH+I VD  + K+ +CYDIDVEV+D  K  + N+  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV  G+PEEER+++F+  PW+QEAV RYFY K+ +  Q
Sbjct:   40 NPTMEANRKRPAPSQQQMQQQAVQNRNRNTKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPA----------KADADDSDGSIA-SWELRVEGKLLDDP----AKVKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYIKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHIISVDPNDQKKTACYDIDVEVEDPLKAQMSNFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVV-GNPEEERRAEFYHQPWSQEAVSRYFYCKVREEIQ 443          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Match: smarcd3a (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3-like [Source:NCBI gene;Acc:103039772])

HSP 1 Score: 434.491 bits (1116), Expect = 7.228e-146
Identity = 229/406 (56.40%), Postives = 294/406 (72.41%), Query Frame = 3
Query:  744 RKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQ----------VDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENAL 1931
            ++RKM D++LP+ +R+L+PES+AYM +L  E  LDQ ++R+R+ IQE +KRP K K+KLR+ +S TFNP     P+   +  +  S        WELRVEG+L D+      K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ NV+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD HE++YINCD+Y +QIF   R+KF EIP RLT LLLPPDPI+INHVI+          VD  + K+ +CYDIDVEVDD  K  +  +  + +  QEI  LDNKIH+ ++ INQ K++R+F L +S DP+ +I  W+ SQ RDLK+M DV  G+PEEER+++F+   W+QEAV RYFY KI QRRQELE AL
Sbjct:  121 KRRKMADKILPQRIRELVPESQAYMDLLAFEHKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAK---PDSDDSEGSIAS--------WELRVEGKLLDDPG----KQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHEKEYINCDKYFQQIFDCPRLKFCEIPQRLTNLLLPPDPIVINHVIRSRPSVPTSNSVDPNDHKKTACYDIDVEVDDPLKTQMSGFLLSTANQQEIATLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWICSQNRDLKLMTDVV-GNPEEERRAEFYNQSWSQEAVSRYFYCKIQQRRQELEQAL 510          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Match: smarcd2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 [Source:ZFIN;Acc:ZDB-GENE-080215-1])

HSP 1 Score: 427.943 bits (1099), Expect = 3.702e-144
Identity = 220/405 (54.32%), Postives = 289/405 (71.36%), Query Frame = 3
Query:  723 GNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G R  IKR RKM D++LP+ +R L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S T  P               G   ++V   WELRVEG+L D+      K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ +VKC L LML+ +P QYKL+P LAR+LG+HT TR+ I+ ALW YIK  +LQD HE++YINC++Y  QIF   R++F+EIP +L  LL  PDPI+INHVI VD  + K+ +C+DIDVEVDD  K  + ++  + +  QEI  L+ KIH+ ++ INQ K +R+F L +SN PQ FI  WL SQ RDLK+M D + G+PEEER+S+F++APW QEAV RY ++K++QRRQELE  L +
Sbjct:   65 GPRRGIKR-RKMADKVLPQRIRDLVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPITQKRKLRIYISNTCTPAK-----------PEGEEAEKVA-SWELRVEGKLLDDPG----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDVSVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRSSIMQALWLYIKNNKLQDSHEKEYINCNRYFRQIFACHRMRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACFDIDVEVDDPLKSQMTSFLSSTTNQQEIAALEMKIHETIESINQLKTQRDFMLSFSNSPQDFIQDWLKSQSRDLKLMTDTA-GNPEEERRSEFYQAPWVQEAVGRYVFSKVHQRRQELEQVLGI 451          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Sea Lamprey
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1835])

HSP 1 Score: 460.299 bits (1183), Expect = 2.629e-157
Identity = 241/427 (56.44%), Postives = 309/427 (72.37%), Query Frame = 3
Query:  675 NNRRVSNIPSANLSQSGNR--NSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKA---KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVI-QVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            + +R +  P   LS+S  +  N   +K+KM D++LP+ VR+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLRV +S TFNP      +++ + A+           WELRVEGRL D+  + +  A   KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR S+TQETDGFQVKRPG+ NV+CK+ LML+ +P Q+KL  HLAR+LGIHT TR  II ALW YIKT RLQD HER+YINCD Y +QIF   R+KF+EIP RL  LL+PPDPI+INH I  VD  + K+ +CYD+DVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K+ REF L ++ DPQ FI  WL SQ RDLK M DV  G+PEEER+++F+  PW+QEAV RYFY+K+ QRRQELE AL +
Sbjct:   45 SRKRPATQPLMGLSKSAQQVENYCTKKKKMADKILPQRVRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPMKQKRKLRVFISNTFNPAKPDADDEEGSVAS-----------WELRVEGRLLDDPASSKFDANKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTSSTQETDGFQVKRPGDVNVRCKVLLMLDYQPPQFKLNSHLARLLGIHTQTRPAIIQALWQYIKTHRLQDSHEREYINCDSYFQQIFDCPRMKFSEIPQRLHGLLMPPDPIVINHTISSVDPNDQKKTACYDVDVEVDDMLKAQMNSFLLSTASQQEIAALDNKIHETIETINQLKIHREFMLGFAQDPQGFINDWLQSQSRDLKTMTDVV-GNPEEERRAEFYFQPWSQEAVCRYFYSKVQQRRQELEQALGI 459          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Yeast
Match: UAF30 (Subunit of UAF (upstream activation factor) complex; UAF is an RNA polymerase I specific transcription stimulatory factor composed of Uaf30p, Rrn5p, Rrn9p, Rrn10p, histones H3 and H4; targeting factor for the UAF that facilitates activation of many rDNA genes; deletion decreases cellular growth rate; UAF30 has a paralog, TRI1, that arose from the whole genome duplication [Source:SGD;Acc:S000005821])

HSP 1 Score: 51.9878 bits (123), Expect = 6.963e-8
Identity = 35/109 (32.11%), Postives = 50/109 (45.87%), Query Frame = 3
Query: 1113 SLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIF 1439
            +L IEL K++        E     N  ET G  V++   T  K  +         +  L   LA +LG H  TR +++  LW YIK   LQ+P+ +  I CD+ LE I 
Sbjct:   77 TLAIELTKEITVSKRSSGE---EKNDSETKGTHVEKKKGTVSKSPI------STRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELIL 176          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Yeast
Match: SNF12 (73 kDa subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; relocates to the cytosol under hypoxic conditions; deletion mutants are temperature-sensitive; SNF12 has a paralog, RSC6, that arose from the whole genome duplication [Source:SGD;Acc:S000005306])

HSP 1 Score: 48.1358 bits (113), Expect = 3.142e-6
Identity = 36/125 (28.80%), Postives = 58/125 (46.40%), Query Frame = 3
Query: 1053 TDETNA--GEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQ--YKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINC 1415
            TD+ NA  GE  AK+  SS    L  E  K  Y P+N +          + DG  +KR G+ NV+C + ++ +S P +      P L  ++G+ + T    I++++ YI    L    E  + N 
Sbjct:  240 TDQNNATMGEETAKKDMSSTTPKL--ESVKWQYDPNNPV----------DFDGLDIKRVGSENVECTISILRKSSPEEPFMSYSPQLTAIIGLKSGTSHDAIFSIYKYIHLNELLTNDESAFENL 352          

HSP 2 Score: 47.7506 bits (112), Expect = 4.750e-6
Identity = 37/141 (26.24%), Postives = 66/141 (46.81%), Query Frame = 3
Query:  759 GDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIK---------------KKLRVILSTTFNPGSNLIPND--QMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIEL 1130
             D ++P  + +LIPE  ++ Q+++ EK LD  +  R L ++  + +  + K               K LR+ +S       N+  N   QM+       +      W +R+EGRL D   A +  A+ KFSS+ +S+V++ 
Sbjct:   57 SDMVIPDHLAELIPELYSFQQLVDSEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNVKFLRIFIS-------NVSENQPWQMDTNNEADLMALENATWTMRIEGRLLDNVQAND-PAREKFSSFIESIVVDF 189          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Yeast
Match: TRI1 (Non-essential sumoylated protein of unknown function; similar to components of human SWI/SNF complex including SMRD3; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm, nucleus and nucleolus; TRI1 has a paralog, UAF30, that arose from the whole genome duplication [Source:SGD;Acc:S000004846])

HSP 1 Score: 46.9802 bits (110), Expect = 3.269e-6
Identity = 22/59 (37.29%), Postives = 31/59 (52.54%), Query Frame = 3
Query: 1287 LEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFA 1463
            L   L + LG     R Q++  +W YIK   LQ+P +R  I CD+ +E IF  K   F+
Sbjct:  126 LSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFS 184          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Nematostella
Match: EDO46175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW4])

HSP 1 Score: 432.565 bits (1111), Expect = 1.837e-147
Identity = 225/395 (56.96%), Postives = 290/395 (73.42%), Query Frame = 3
Query:  756 MGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGR-LTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            M D++LP+ VR L+PES+AYM +L  E+ LD  ++R+R+ IQE +KRP K KKKLRV L+T+F             +A  G +L    P WELRVEGR L D +N  E + KRKFS+YFKSLVIELD++LYGPDNHLVEWHR SNTQETDGFQVKRPG  NVKC +  +L+ +P QYKLEP LAR+LGIHT TR  I+ A+W YIK+  LQD HER+YIN D+Y +QIF+  R+KF+EIP RL  LL+PPDPI+I+H+I  D  E K+++CYDIDVEVDD  K  + ++  + +   EI   DNKI++ V+ IN  K+ REFFL ++ DPQ FIT+W+ SQ +DLKVM DV  G+PEEER++DF+  PW+QEAV RYFY+K+ Q+R ELE AL +
Sbjct:    1 MADKVLPQRVRDLVPESQAYMDLLAFERKLDATIMRKRMDIQEALKRPIKTKKKLRVHLTTSFQTPKP--------DAEDGEAL---VPSWELRVEGRILEDPSNKSEPQRKRKFSTYFKSLVIELDRELYGPDNHLVEWHRTSNTQETDGFQVKRPGEENVKCTIMFLLDYQPPQYKLEPRLARLLGIHTQTRPVIVNAIWQYIKSHNLQDSHEREYINNDRYFQQIFECPRMKFSEIPQRLNQLLVPPDPIVIHHLISKDTPENKRVTCYDIDVEVDDTLKAQMHSFLLSTASQNEIATYDNKIYETVETINSLKINREFFLGFARDPQDFITQWIQSQSQDLKVMTDVV-GNPEEERRADFYYLPWSQEAVCRYFYSKVQQKRAELEQALGI 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Nematostella
Match: EDO27997 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7Q2])

HSP 1 Score: 293.508 bits (750), Expect = 2.284e-94
Identity = 165/323 (51.08%), Postives = 221/323 (68.42%), Query Frame = 3
Query:  744 RKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEV---DDNYKLMLQNYAQNASYNQEITNLDNKI---HDLVDQIN 1694
            RK+KM D++LP+ VR L+PES+AYM +L  E+ LD  ++R+R+ IQE +KRP K KKKLRV L+T+F             +A  G +L    P WELRVEGR+ ++  +     K +FS+YFKSLVIELD++LYGPDNHLVEWHR SNTQETDGFQVKRPG  NVKC +  +L+ +P QYKLEP LAR+LGIHT TR  I+ A+W YIK+  LQD HER+YIN D+Y +QIF+  R+KF+EIP RL  LL+PPDPI+I+H+I++  ++    S Y +  E+   DD  K  + ++  + +   EI   DNK+   H  V  I+
Sbjct:    2 RKKKMADKVLPQRVRDLVPESQAYMDLLAFERKLDATIMRKRMDIQEALKRPIKTKKKLRVHLTTSFQTPKP--------DAEDGEAL---VPSWELRVEGRILEDVTS----EKEEFSTYFKSLVIELDRELYGPDNHLVEWHRTSNTQETDGFQVKRPGEENVKCTIMFLLDYQPPQYKLEPRLARLLGIHTQTRPVIVNAIWQYIKSHNLQDSHEREYINNDRYFQQIFECPRMKFSEIPQRLNQLLVPPDPIVIHHLIRIFLQD----SQYKLSCEIALLDDTLKAQMHSFLLSTASQNEIATYDNKVSPNHQCVKSIH 305          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Nematostella
Match: EDO25954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD99])

HSP 1 Score: 84.3445 bits (207), Expect = 2.836e-20
Identity = 37/62 (59.68%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1719 FLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQ 1904
            FL ++ DPQ FIT+W+ SQ +DLKVM DV  G+PEEER++DF+  PW+QEAV RYFY+K+++
Sbjct:    1 FLGFARDPQDFITQWIQSQSQDLKVMTDVV-GNPEEERRADFYYLPWSQEAVCRYFYSKVSK 61          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:101155187])

HSP 1 Score: 467.233 bits (1201), Expect = 1.073e-158
Identity = 234/401 (58.35%), Postives = 302/401 (75.31%), Query Frame = 3
Query:  744 RKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKA---KRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            +K+KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K K+KLR+ +S TFNP     P+ +    T  S        WELRVEGRL ++T   + +A   KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ +V+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW Y+KT +LQDPHER++INCD+YL QIF+ +R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:  123 KKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAK---PDAEDGEGTVAS--------WELRVEGRLLEDTAVSKYEATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVSVRCTVLLMLDYQPPQFKLDPRLARMLGIHTQTRPVIIQALWQYVKTHKLQDPHEREFINCDKYLHQIFETQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAGLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYYQPWAQEAVCRYFYSKVQQRRQELEQALGI 511          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Match: smarcd2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 [Source:NCBI gene;Acc:101159227])

HSP 1 Score: 435.261 bits (1118), Expect = 2.104e-146
Identity = 230/451 (51.00%), Postives = 307/451 (68.07%), Query Frame = 3
Query:  597 GFQNRNIPTP---GRNIPSRMPHPNPTLNNNR-RVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            G     +P P   G N+P R     P ++ +R R  +         G+     ++RKM D++LP+ +R L+PES+AYM +L  E+ LDQ + R+R+ IQE +K+P   K+KLR+ +S TF P           +   G   ++V   WELRVEG+L +E      K KRKFSS+FKSLVIELDK+LYGPDNHLVEWHR   TQETDGFQVKRPG+ NVKC L LML+ +P QYKL+P LAR+LG+HT TRA I+ ALW YIK  +LQD HE+++INC++Y  QIF   R++F+EIP +L  LL  PDPI+INH+I VD  + K+ +CYDIDVEVDD  K  + ++  +A+  QEI  L+ KIH+ ++ INQ K  R+F L +SN PQ+FI  WL SQCRDLK+M DV+ G+PEEER+++F++APW  EAV RY Y+K+ QRRQELE  L +
Sbjct:   63 GVMGSQMPGPSYGGGNLPMR-----PGMDASRKRFLHHQQQQQEALGSLRRGAKRRKMADKVLPQRIRDLVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPIMQKRKLRIYISNTFTP-----------SKPEGEESEKVS-SWELRVEGKLLEEPG----KQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDVNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRASIMQALWLYIKNNKLQDCHEKEFINCNRYFRQIFNCPRMRFSEIPMKLAGLLQHPDPIVINHIISVDPTDQKKTACYDIDVEVDDPLKTQMNSFLSSANSQQEIATLEMKIHETIEYINQLKTERDFMLSFSNSPQEFIQDWLKSQCRDLKLMTDVT-GNPEEERRAEFYEAPWMPEAVGRYVYSKVQQRRQELEQVLGI 491          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:NCBI gene;Acc:101162326])

HSP 1 Score: 421.394 bits (1082), Expect = 9.958e-141
Identity = 235/439 (53.53%), Postives = 310/439 (70.62%), Query Frame = 3
Query:  624 PGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKI-KKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            P R +  R P  +PTL +N                     ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K  K+KLR+ +S TFNP     P+   ++ +  S        WELRVEG+L D+      K K+KFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ +V+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INHVI VD  + K+ +CYDIDVEV+D  K  + ++  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV  G+PEEER++ F+  PW+QEAV RYFY KI QRRQELE AL +
Sbjct:  110 PARQMDMREPQSDPTLGSN--------------------AKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQQKRKLRLYISNTFNPAR---PDADDSDGSIAS--------WELRVEGKLLDDPG----KQKKKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVSVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHVISVDPNDQKKTACYDIDVEVEDPLKSQMSSFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVV-GNPEEERRAAFYHEPWSQEAVSRYFYCKIQQRRQELEQALAV 512          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Match: smarcd3b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:NCBI gene;Acc:101162326])

HSP 1 Score: 417.927 bits (1073), Expect = 8.083e-140
Identity = 229/405 (56.54%), Postives = 301/405 (74.32%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKI-KKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            NR    ++RKM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+R+ IQE +KRP K  K+KLR+ +S TFNP     P+   ++ +  S        WELRVEG+L D+      K K+KFSS+FKSLVIELDKDLYGPDNHLVEWHR   TQETDGFQVKRPG+ +V+C L LML+ +P Q+KL+P LAR+LGIHT TR+ II ALW Y+KT +LQD H+++YINCD+Y +QIF   R+KF+EIP RLT LLLPPDPI+INHVI VD  + K+ +CYDIDVEV+D  K  + ++  + +  QEI +LDNKIH+ ++ INQ K++R+F L +S DP+ +I  WL SQ RDLK+M DV  G+PEEER++ F+  PW+QEAV RYFY KI QRRQELE AL +
Sbjct:   94 NRARNAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQQKRKLRLYISNTFNPAR---PDADDSDGSIAS--------WELRVEGKLLDDPG----KQKKKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDVSVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHDKEYINCDKYFQQIFDCPRLKFSEIPQRLTNLLLPPDPIVINHVISVDPNDQKKTACYDIDVEVEDPLKSQMSSFLLSTANQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVV-GNPEEERRAAFYHEPWSQEAVSRYFYCKIQQRRQELEQALAV 482          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Match: smarcd1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 [Source:NCBI gene;Acc:101155187])

HSP 1 Score: 416.772 bits (1070), Expect = 1.351e-139
Identity = 217/404 (53.71%), Postives = 276/404 (68.32%), Query Frame = 3
Query:  726 NRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL 1937
            NRN  K+K KM D++LP+ +R+L+PES+AYM +L  E+ LDQ ++R+RL IQE +KRP K                                                 T  +     K KRKFSS+FKSLVIELDKDLYGPDNHLVEWHR + TQETDGFQVKRPG+ +V+C + LML+ +P Q+KL+P LAR+LGIHT TR  II ALW Y+KT +LQDPHER++INCD+YL QIF+ +R+KF+EIP RL  LL+PP+PIIINHVI VD  + K+ +CYDIDVEVDD  K  + ++  + +  QEI  LDNKIH+ ++ INQ K +REF L ++ DPQ FI  WL SQCRDLK M DV  G+PEEER+++F+  PW QEAV RYFY+K+ QRRQELE AL +
Sbjct:  117 NRNHTKKK-KMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIK-------------------------------------------------TAVSKYEATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVSVRCTVLLMLDYQPPQFKLDPRLARMLGIHTQTRPVIIQALWQYVKTHKLQDPHEREFINCDKYLHQIFETQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAGLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVV-GNPEEERRAEFYYQPWAQEAVCRYFYSKVQQRRQELEQALGI 469          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Planmine SMEST
Match: SMESG000051399.1 (SMESG000051399.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 451/451 (100.00%), Postives = 451/451 (100.00%), Query Frame = 3
Query:  588 MYGGFQNRNIPTPGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEXXXXXXXXXXXXXXXXXNHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNLG 1940
            MYGGFQNRNIPTPGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEIPNRLTPLLLPPDPIIINHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNLG
Sbjct:    1 MYGGFQNRNIPTPGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNSIKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEEMKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELRVEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSNTQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRAQIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEIPNRLTPLLLPPDPIIINHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASYNQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDLKVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNLG 451          
The following BLAST results are available for this feature:
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCD13.058e-15853.10SWI/SNF related, matrix associated, actin dependen... [more]
SMARCD23.403e-14852.17SWI/SNF related, matrix associated, actin dependen... [more]
SMARCD24.609e-14852.17SWI/SNF related, matrix associated, actin dependen... [more]
SMARCD28.569e-14852.17SWI/SNF related, matrix associated, actin dependen... [more]
SMARCD21.512e-14752.17SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ham-32.436e-12448.53pep chromosome:WBcel235:III:10120781:10122928:1 ge... [more]
swsn-2.25.564e-11747.91SWI/SNF nucleosome remodeling complex component [... [more]
swsn-2.25.564e-11747.91SWI/SNF nucleosome remodeling complex component [... [more]
K03B8.45.432e-646.30pep chromosome:WBcel235:V:11394786:11395124:-1 gen... [more]
T24G10.28.364e-647.62pep chromosome:WBcel235:III:5440862:5442761:-1 gen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Bap606.285e-14857.47gene:FBgn0025463 transcript:FBtr0073741[more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcd11.846e-15958.60SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3a1.995e-15352.71SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3a2.519e-15352.71SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3b1.506e-15257.18SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3b3.229e-15253.64SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcd17.271e-15957.74SWI/SNF related, matrix associated, actin dependen... [more]
smarcd17.999e-15257.36SWI/SNF related, matrix associated, actin dependen... [more]
smarcd18.501e-15257.36SWI/SNF related, matrix associated, actin dependen... [more]
smarcd11.929e-15057.95SWI/SNF related, matrix associated, actin dependen... [more]
smarcd13.460e-15057.95SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarcd14.482e-15853.10SWI/SNF related, matrix associated, actin dependen... [more]
Smarcd24.540e-14852.17SWI/SNF related, matrix associated, actin dependen... [more]
Smarcd25.197e-14852.17SWI/SNF related, matrix associated, actin dependen... [more]
Smarcd39.053e-14755.36SWI/SNF related, matrix associated, actin dependen... [more]
Smarcd31.647e-14655.36SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96GM5|SMRD1_HUMAN1.469e-15753.10SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q61466|SMRD1_MOUSE3.135e-15753.10SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q2TBN1|SMRD1_BOVIN1.425e-15452.68SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|O54772|SMRD2_RAT3.596e-14752.17SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q99JR8|SMRD2_MOUSE3.635e-14752.17SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CLV64.628e-17457.33SWI/SNF-related matrix-associated actin-dependent ... [more]
A0A5K4F2449.319e-17457.21Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0X3P6643.021e-17358.19SWIB domain-containing protein OS=Schistocephalus ... [more]
A0A564Y6I55.647e-16957.14SWIB domain-containing protein OS=Hymenolepis dimi... [more]
A0A4S2L1N56.133e-16961.81SWIB domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcd15.416e-15858.35SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3b5.667e-15455.61SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3b1.625e-14654.52SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3a7.228e-14656.40SWI/SNF-related matrix-associated actin-dependent ... [more]
smarcd23.702e-14454.32SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smarcd12.629e-15756.44SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
UAF306.963e-832.11Subunit of UAF (upstream activation factor) comple... [more]
SNF123.142e-628.8073 kDa subunit of the SWI/SNF chromatin remodeling... [more]
TRI13.269e-637.29Non-essential sumoylated protein of unknown functi... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO461751.837e-14756.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279972.284e-9451.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259542.836e-2059.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcd11.073e-15858.35SWI/SNF related, matrix associated, actin dependen... [more]
smarcd22.104e-14651.00SWI/SNF-related matrix-associated actin-dependent ... [more]
smarcd3b9.958e-14153.53SWI/SNF related, matrix associated, actin dependen... [more]
smarcd3b8.083e-14056.54SWI/SNF related, matrix associated, actin dependen... [more]
smarcd11.351e-13953.71SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051399.10.000e+0100.00SMESG000051399.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030460 ID=SMED30030460|Name=SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D|organism=Schmidtea mediterranea sexual|type=transcript|length=1980bp
ATCAGGTGAACCAATTATAGACAACTATTTGGATATCAACGATTTATCGA
TAGGAATTAGATTGCGATCTGGCTCCTCGTGTTCTCTCAATTGATAATAT
CGAATCTTAACAAAATAACTTTTATTTCTAATACAATAAAGTCTATTGAA
TAGACTACTTTATTTCCCACAATTTAGTAAACAATGGCACACGTCCAAAG
GATATCACCCTAGATCACTTCTTTATAATCACAACACTATCTGTTGAGAC
ATTTTGCAATTTTTATCATTTCCCCCCATTAATTGTCATCTCTAGATTTT
CCAAGTTTGACGAACTATTTATTTCCCATAATGTTAATTCCCGGTAATCC
ATTAAAATGACATTCAGCTGGATTCGCCCTAATTTATGGGCTTGCTAAAA
AATAATTTGATTAATTAAAAAAACTTTGATATAATACAGTTTAATTAAAA
AATATCTAAATCTTAGTTAATTTGTTTAAATGCTTCTTTTAATTTATTTC
ATTTTGAAAATCGTTGGTTTTAATTTAAATTTTATAAATCTTATTTTATA
AATAATTTTGCGTTTCTATTGAAGTTTGTTATTTAAAATGTATGGTGGTT
TTCAGAATAGAAATATTCCAACACCGGGTCGAAATATACCTTCTAGAATG
CCTCACCCAAATCCAACTTTGAATAATAACAGAAGAGTTTCAAATATTCC
ATCAGCAAATTTGAGCCAGTCAGGAAATAGGAATTCTATAAAAAGAAAAC
GAAAAATGGGTGATCGTCTGCTTCCGAAAGTCGTTCGTCAGTTAATTCCC
GAGTCTGAAGCTTATATGCAGATGTTAGAGTTAGAAAAGGATTTAGATCA
AGTTTTAATAAGACGAAGATTGAGTATTCAAGAAGAAATGAAAAGACCAT
GCAAAATAAAAAAGAAGCTGAGAGTAATTCTCAGTACGACTTTCAATCCT
GGCAGCAACTTAATTCCAAATGATCAAATGAATAATGCCACTCATGGAAG
TTCACTGCAGCAAGTTGGCCCAGGGTGGGAATTGCGTGTTGAAGGTCGTT
TGACAGACGAGACCAATGCAGGTGAAATCAAAGCTAAACGGAAATTTTCG
TCCTATTTCAAGTCTCTCGTCATTGAGTTGGATAAAGATCTCTATGGTCC
TGATAATCATTTAGTCGAATGGCATAGAAACAGTAACACCCAGGAAACCG
ATGGATTCCAAGTAAAACGGCCTGGGAACACCAATGTCAAATGCAAACTG
TTTCTCATGCTCGAATCTCGACCAACTCAATATAAGCTGGAACCACATTT
AGCAAGAGTTTTGGGTATTCACACAGATACACGGGCTCAGATTATCTATG
CGCTTTGGAATTATATCAAAACTCAAAGGTTGCAAGATCCTCACGAACGG
GATTACATTAATTGTGATCAATATTTGGAGCAGATCTTCCAGGCTAAACG
AATCAAGTTTGCCGAAATTCCCAACCGATTGACTCCATTGCTGTTGCCGC
CCGATCCGATCATAATCAATCACGTGATACAGGTCGATGGCGAGGAGCCA
AAGCAAATCTCCTGCTATGATATCGATGTGGAAGTTGATGACAATTACAA
ATTGATGCTGCAGAATTATGCTCAGAACGCCTCTTACAATCAGGAAATTA
CCAATCTCGATAATAAGATTCATGATTTGGTTGATCAAATAAATCAAACA
AAATTGAGACGGGAATTTTTCCTCGAATACAGCAATGATCCGCAGAAGTT
CATCACTCGGTGGCTGGCGTCCCAATGTCGCGATCTGAAAGTGATGCTTG
ATGTTTCCCCCGGCCATCCTGAAGAGGAGAGAAAATCCGATTTCTTCAAA
GCCCCCTGGACACAGGAGGCGGTTATGCGCTACTTTTACAACAAAATCAA
TCAGCGGCGTCAAGAACTGGAAAACGCACTCAATCTTGGAAGTATTTGAA
TAGCTGCATTTTCTATTGTATAAATAAATG
back to top

protein sequence of SMED30030460-orf-1

>SMED30030460-orf-1 ID=SMED30030460-orf-1|Name=SMED30030460-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MYGGFQNRNIPTPGRNIPSRMPHPNPTLNNNRRVSNIPSANLSQSGNRNS
IKRKRKMGDRLLPKVVRQLIPESEAYMQMLELEKDLDQVLIRRRLSIQEE
MKRPCKIKKKLRVILSTTFNPGSNLIPNDQMNNATHGSSLQQVGPGWELR
VEGRLTDETNAGEIKAKRKFSSYFKSLVIELDKDLYGPDNHLVEWHRNSN
TQETDGFQVKRPGNTNVKCKLFLMLESRPTQYKLEPHLARVLGIHTDTRA
QIIYALWNYIKTQRLQDPHERDYINCDQYLEQIFQAKRIKFAEIPNRLTP
LLLPPDPIIINHVIQVDGEEPKQISCYDIDVEVDDNYKLMLQNYAQNASY
NQEITNLDNKIHDLVDQINQTKLRREFFLEYSNDPQKFITRWLASQCRDL
KVMLDVSPGHPEEERKSDFFKAPWTQEAVMRYFYNKINQRRQELENALNL
GSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036885SWIB_MDM2_dom_sf
IPR038041SMARCD1
IPR019835SWIB_domain
IPR003121SWIB_MDM2_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003682chromatin binding
GO:0003713transcription coactivator activity
GO:0005102signaling receptor binding
GO:0032947protein complex scaffold
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0016514SWI/SNF complex
GO:0043231intracellular membrane-bounded organelle
GO:0071564npBAF complex
GO:0071565nBAF complex
GO:0090544BAF-type complex
Vocabulary: biological process
TermDefinition
GO:0006337nucleosome disassembly
GO:0006338chromatin remodeling
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007399nervous system development
GO:0016569covalent chromatin modification
GO:0048096chromatin-mediated maintenance of transcription
GO:0071398cellular response to fatty acid
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 347..374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 37..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR13844BRG-1 ASSOCIATED FACTOR 60 BAF60coord: 50..446
NoneNo IPR availableCDDcd17674SWIB_BAF60Acoord: 231..297
e-value: 4.42735E-34
score: 120.307
IPR019835SWIB domainSMARTSM00151swib_2coord: 228..307
e-value: 2.4E-30
score: 116.8
IPR003121SWIB/MDM2 domainPFAMPF02201SWIBcoord: 231..301
e-value: 3.2E-23
score: 81.4
IPR036885SWIB/MDM2 domain superfamilyGENE3DG3DSA:1.10.245.10coord: 225..309
e-value: 2.8E-26
score: 93.1
IPR036885SWIB/MDM2 domain superfamilySUPERFAMILYSSF47592SWIB/MDM2 domaincoord: 223..312
IPR038041SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1PANTHERPTHR13844:SF1SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY D MEMBER 1coord: 50..446