Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30030455
Length (bp)1295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30030455) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30030455) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30030455) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30030455) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030455

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030455SMESG000056558.1 SmedASXL_010656SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030455SMESG000056558.1 dd_Smed_v4_3175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030455SMESG000056558.1 dd_Smed_v4_3175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30030455SMESG000056558.1 dd_Smed_v4_3175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030455SMESG000056558.1 dd_Smed_v6_3175_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030455SMESG000056558.1 DN310971ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30030455SMESG000056558.1 DN310971ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30030455SMESG000056558.1 OX_Smed_1.0.23369ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030455SMESG000056558.1 dd_Smed_v6_3175_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30030455SMESG000056558.1 dd_Smed_v6_3175_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30030455SMESG000056558.1 dd_Smed_v4_3175_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030455SMESG000056558.1 dd_Smed_v4_3175_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 49.6766 bits (117), Expect = 2.170e-6
Identity = 44/164 (26.83%), Postives = 70/164 (42.68%), Query Frame = 2
Query:  578 GMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCK--FKD-----FQFVNMNGCLQNQTDNNKDSGCTERLFNSIKE 1048
            G C VC +SQCL++ +  +I  V+  QI        N +    ++   +K+ + +  G +     +   + L   + CCGA G  D+ +S  FN     N    + S + NV+   P SCCK   KD      + +   G L N        GC ++L   I E
Sbjct:   73 GCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATS-RFNNVDRTNIVEIAVS-SMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAI---YQQGCVDKLIEIIYE 231          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 48.9062 bits (115), Expect = 3.283e-6
Identity = 44/164 (26.83%), Postives = 70/164 (42.68%), Query Frame = 2
Query:  578 GMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCK--FKD-----FQFVNMNGCLQNQTDNNKDSGCTERLFNSIKE 1048
            G C VC +SQCL++ +  +I  V+  QI        N +    ++   +K+ + +  G +     +   + L   + CCGA G  D+ +S  FN     N    + S + NV+   P SCCK   KD      + +   G L N        GC ++L   I E
Sbjct:   73 GCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATS-RFNNVDRTNIVEIAVS-SMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAI---YQQGCVDKLIEIIYE 231          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0084912)

HSP 1 Score: 48.9062 bits (115), Expect = 3.283e-6
Identity = 44/164 (26.83%), Postives = 70/164 (42.68%), Query Frame = 2
Query:  578 GMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCK--FKD-----FQFVNMNGCLQNQTDNNKDSGCTERLFNSIKE 1048
            G C VC +SQCL++ +  +I  V+  QI        N +    ++   +K+ + +  G +     +   + L   + CCGA G  D+ +S  FN     N    + S + NV+   P SCCK   KD      + +   G L N        GC ++L   I E
Sbjct:   73 GCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATS-RFNNVDRTNIVEIAVS-SMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAI---YQQGCVDKLIEIIYE 231          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8I8H5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013070g1 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.678e-17
Identity = 59/159 (37.11%), Postives = 87/159 (54.72%), Query Frame = 2
Query:  593 CCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDF-NSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMN-GCLQNQTDNNKDSGCTERLFNS-IKEYLTN 1060
            CCK +  ++IY  I+  V   Q+IVVI++ AN E+ K      ++  +AKY+GF +T  ES L N L I + CCG     DF N S +++R      + G ++ T+N  L YP++CCKF   +   +N  C  N TD+N   GC + LF   I +Y  N
Sbjct:  109 CCKIRQCLLIYAIIVGLVFLGQLIVVIIWYANSEILKASAKSAMEQSVAKYKGFRSTNLESLLQNMLQILVGCCGVNNGTDFENLSQDWDRQHF--ISQGGRNFTFN--LTYPVTCCKFDLARMEPLNLYCPYNNTDSNYRIGCYDTLFTGYIDKYFLN 263          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267EHR9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023997g1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.404e-16
Identity = 66/206 (32.04%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  452 LKANGGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDF-NSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMN-GCLQNQTDNNKDSGCTERLFNS-IKEYLTN 1060
            LK++ G  ++   +++ I     S+    I+ G ++  ++ +G    CCK +  ++IY  I+  V   Q+IVVI++ AN E+ K      ++  +AKY+GF +T  ES L N L I + CCG     DF N S +++R      + G ++ T+N  L YP++CCKF   +   +N  C  N TD+N   GC +  F   I +Y  N
Sbjct:   62 LKSHTGQEIEIQQLLSSIGQLTGSVGAAFIVAGVVILAVACLGCIGGCCKIRQCLLIYAIIVGLVFLGQLIVVIIWYANSEILKASAKSAMEQSVAKYKGFRSTNLESLLQNMLQILVGCCGVNNGTDFENLSQDWDRQHF--ISQGGRNFTFN--LTYPVTCCKFDLARMEPLNLYCPYNNTDSNYQIGCYDIFFTGYIDKYFLN 263          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267DIY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023997g3 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.894e-16
Identity = 58/159 (36.48%), Postives = 86/159 (54.09%), Query Frame = 2
Query:  593 CCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDF-NSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMN-GCLQNQTDNNKDSGCTERLFNS-IKEYLTN 1060
            CCK +  ++IY  I+  V   Q+IVVI++ AN E+ K      ++  +AKY+GF +T  ES L N L I + CCG     DF N S +++R      + G ++ T+N  L YP++CCKF   +   +N  C  N TD+N   GC +  F   I +Y  N
Sbjct:  109 CCKIRQCLLIYAIIVGLVFLGQLIVVIIWYANSEILKASAKSAMEQSVAKYKGFRSTNLESLLQNMLQILVGCCGVNNGTDFENLSQDWDRQHF--ISQGGRNFTFN--LTYPVTCCKFDLARMEPLNLYCPYNNTDSNYQIGCYDIFFTGYIDKYFLN 263          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8I7S1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.801e-14
Identity = 63/229 (27.51%), Postives = 120/229 (52.40%), Query Frame = 2
Query:  404 YVISIIVPTLQNSLQSLKAN-------GGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNS-SINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNG-CLQNQT---DNNKDSGCTERLFNSIKEYL 1054
            +V+ ++  TL ++L+S+  +        G+ ++ + ++ G+ +   S+    +++G +L VLS IG C  CC  +  +IIY  ++  +L  Q+IV+ ++ ++  + K+     ++  + K+ G ++   +S L N +++F+ CCG T   DF + S ++NRT+S           Y+  L YP++CCKF    F   +  C  N T    +N   GC E +F  I +YL
Sbjct:  440 FVLGLLSGTLASTLESMMGSFSSSLKEYGVEINLSELLGGMSEITGSVGWGFLVLGVVLIVLSCIGCCGACCTVRGCLIIYAVMVGIMLIGQVIVISIWFSSNNLFKENARSAMEESLKKFTGISSKNIQSLLQNLVHVFVGCCGVTNGTDFQTMSPDWNRTYS--------VSGYSFNLTYPLTCCKFDLSTFKPKDEYCPYNNTTPETSNYKKGCYEAIFTFIDDYL 660          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267DLD0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006782g2 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.103e-12
Identity = 63/229 (27.51%), Postives = 120/229 (52.40%), Query Frame = 2
Query:  404 YVISIIVPTLQNSLQSLKANG-------GMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNS-SINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNG-CLQNQT---DNNKDSGCTERLFNSIKEYL 1054
            +V+ ++  TL ++L+S+  +        G+ ++ + ++ G+ +   S+    +++G +L VLS IG C  CC  +  +IIY  ++  +L  Q+IV+ ++ ++  + K+     ++  + K+ G ++   +S L N +++F+ CCG T   DF + S ++NRT+S           Y+  L YP++CCKF    F   +  C  N T    +N   GC E +F  I +YL
Sbjct:   40 FVLGLLSGTLASTLESMMGSFSSSLKEYGVEINLSELLGGMSEITGSVGWSFLVLGVVLIVLSCIGCCGACCTVRGCLIIYAVMVGIMLIGQVIVISIWFSSNNLFKENARSAMEESLKKFTGISSKNIQSLLQNLVHVFVGCCGVTNGTDFQTMSPDWNRTYS--------VSGYSFNLTYPLTCCKFDLSTFKPKDEYCPYNNTTPETSNYKKGCYEAIFTFIDDYL 260          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000056558.1 (SMESG000056558.1)

HSP 1 Score: 403.29 bits (1035), Expect = 2.284e-140
Identity = 278/289 (96.19%), Postives = 282/289 (97.58%), Query Frame = 2
Query:  290 MGXXXXXXXTILVLVNIIYMXXXXXXXXXXXXXXXXKNYVISIIVPTLQNSLQSLKANGGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTERLFNSIKEYLTNXXXXXXXXXXXXXXXXXAAVVCLVSLKQDLAQ 1156
            MGCCYCCCCTILVLVNIIYMIIGIVLAVAGILLVAAKNYVIS IVPTL+ SL+SLKANGGMNVDTTAMINGILDYLVSISVILII+GSILFVLSIIGMCSVCCKSQCLIIIYLSIISAV AIQIIVVI+YAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTE LFNSIKEYL  VYQVVGGIIGYQ LIIIAAVVCLVSLKQDLAQ
Sbjct:    1 MGCCYCCCCTILVLVNIIYMIIGIVLAVAGILLVAAKNYVISFIVPTLETSLKSLKANGGMNVDTTAMINGILDYLVSISVILIIVGSILFVLSIIGMCSVCCKSQCLIIIYLSIISAVFAIQIIVVIIYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTESLFNSIKEYLIKVYQVVGGIIGYQSLIIIAAVVCLVSLKQDLAQ 289          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000056558.1 (SMESG000056558.1)

HSP 1 Score: 387.111 bits (993), Expect = 2.678e-134
Identity = 242/253 (95.65%), Postives = 246/253 (97.23%), Query Frame = 2
Query:  398 KNYVISIIVPTLQNSLQSLKANGGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTERLFNSIKEYLTNXXXXXXXXXXXXXXXXXAAVVCLVSLKQDLAQ 1156
            KNYVIS IVPTL+ SL+SLKANGGMNVDTTAMINGILDYLVSISVILII+GSILFVLSIIGMCSVCCKSQCLIIIYLSIISAV AIQIIVVI+YAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTE LFNSIKEYL  VYQVVGGIIGYQ LIIIAAVVCLVSLKQDLAQ
Sbjct:   18 KNYVISFIVPTLETSLKSLKANGGMNVDTTAMINGILDYLVSISVILIIVGSILFVLSIIGMCSVCCKSQCLIIIYLSIISAVFAIQIIVVIIYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTESLFNSIKEYLIKVYQVVGGIIGYQSLIIIAAVVCLVSLKQDLAQ 270          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000056555.1 (SMESG000056555.1)

HSP 1 Score: 223.787 bits (569), Expect = 2.207e-70
Identity = 131/250 (52.40%), Postives = 188/250 (75.20%), Query Frame = 2
Query:  398 KNYVISIIVPTLQNSLQSLKANGGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTERLFNSIKEYLTNXXXXXXXXXXXXXXXXXAAVVCLVSLKQD 1147
            K++V+  + P L++   SL +N  +NV+   M   +L+ L S+++ LIIIG+I F++SII MCSVCCK++ L+I+Y++I+S ++  QIIV+I++AA+P  +K ++  +LK+MI KY GF +  PESFL+N +NI +NCCGA  YQDFN+S+ FNRT+SG FTYG K++TYNV L YPISCC+FK+FQFVN   C++N+  NNKD GC   LF+SI+ Y T   Q++ GIIGYQ LI++AA VCLVSL ++
Sbjct:   18 KDFVVDKLSPLLKSFFDSLSSNSNLNVNGAQMFTYLLNSLSSVAIALIIIGAIFFIISIIAMCSVCCKARILLIVYITILSVIVLAQIIVIIIFAADPTKAKSIVEGILKDMIIKYEGFFSANPESFLINVMNIGLNCCGAINYQDFNASVKFNRTYSGTFTYGGKTETYNVQLNYPISCCQFKEFQFVNSRECIENKGSNNKDKGCVTSLFDSIQNYTTMTIQIICGIIGYQLLILLAASVCLVSLIKE 267          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000041117.1 (SMESG000041117.1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.450e-21
Identity = 71/214 (33.18%), Postives = 115/214 (53.74%), Query Frame = 2
Query:  431 LQNSLQSLKANGGMNVDTTAMINGILDYXXXXXXXXXXXXXXXXXXXXXGMCSVCCKSQCLIIIYLSIISAVLAIQII-VVIMYAANP--EMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFK-DF--QFVNMNGCLQNQTDNNKDSGCTERLFNSIKEYL 1054
            LQ  +Q+L    G+  D + +I+ +     SI +I  I G IL  LS+IG+ +VCC +  LI+I + I      + +I VV  Y +NP   +   + N +  ++I+KYR   +TEP+S L+N + I  NCCG   Y D+N++ NF R         + S   N  + +P+SCC +K DF     + + C++ QT +  + GC  RL   +++YL
Sbjct:   47 LQAQIQNLIEKLGIKTDASGVISLVQQNASSIGIIAFIAGCILIALSVIGIVAVCCCTLKLILIVICIFLICFTLALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQ-------ATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLRKYL 253          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000005510.1 (SMESG000005510.1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.722e-15
Identity = 43/157 (27.39%), Postives = 80/157 (50.96%), Query Frame = 2
Query:  593 CCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNM---IAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTERLFNSIKEYL 1054
            CC ++C I + ++II+A+L   +++ I+Y A  + ++K+ N + KN+   I KY G+  T  ES ++N +    +CCG   Y DF+ +               K     +   +P+SCC+ ++ ++VN+  C    T  +   GC   +   +K+YL
Sbjct:  103 CCGAKCFIYVIIAIINALLVSLLVIAIVYGA--QGNQKIFNYVEKNLYKLIEKYEGYNATNVESLIINVIQTQAHCCGLYNYSDFDRA--------------EKWVGRKLGFKFPLSCCESREMRYVNLAECKDTWTSPSLTKGCYSSIKPQLKKYL 243          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tsp96F2.170e-626.83gene:FBgn0027865 transcript:FBtr0330163[more]
Tsp96F3.283e-626.83gene:FBgn0027865 transcript:FBtr0330164[more]
Tsp96F3.283e-626.83gene:FBgn0027865 transcript:FBtr0084912[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I8H57.678e-1737.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EHR93.404e-1632.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DIY53.894e-1636.48Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I7S12.801e-1427.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DLD01.103e-1227.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056558.12.284e-14096.19SMESG000056558.1[more]
SMESG000056558.12.678e-13495.65SMESG000056558.1[more]
SMESG000056555.12.207e-7052.40SMESG000056555.1[more]
SMESG000041117.15.450e-2133.18SMESG000041117.1[more]
SMESG000005510.13.722e-1527.39SMESG000005510.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030455 ID=SMED30030455|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1295bp
CTTCCGATCTTTAAAACAAGAAACAATGCCATTTCTACCCTATCACCAGA
AACGAAAGAAATGTCTTTAAATTTTCAGAAAAAATCAATTAAACTCACCC
AATCATAATCGTTCATAGACAAAAGAATTCATCCGTGAAATAATAGCGAA
TAAAACTGGTGAAGGTTTGCAGAAAGTACTTAGTAACAATTATTTATTTA
AGTGATAAAACTATCAAAATCAATTTTATTTTATAACGTATTTTATTTTA
TTGTTAAACTTATTAGTCAAATATAGAACTTGATTTGAAATGGGGTGCTG
TTATTGCTGCTGTTGTACAATTTTGGTGTTGGTTAATATTATCTACATGA
TTATTGGTATAGTTTTGGCTGTGGCTGGAATACTGTTAGTAGCTGCCAAA
AACTATGTTATTTCGATTATAGTTCCAACTTTACAAAATTCCCTTCAGTC
TCTCAAAGCAAATGGTGGAATGAATGTTGATACTACGGCCATGATTAATG
GAATTCTCGATTATTTGGTCTCCATTTCTGTAATACTCATCATCATTGGC
AGCATTCTGTTTGTGTTATCAATAATTGGAATGTGCTCAGTCTGTTGTAA
ATCACAATGTTTAATAATTATATATTTGTCGATCATCTCGGCTGTCTTGG
CGATACAGATAATTGTTGTTATCATGTATGCTGCAAATCCTGAAATGTCG
AAAAAAATGATAAATGATCTTTTAAAAAACATGATTGCTAAATACAGAGG
ATTCACCAATACTGAACCAGAGAGCTTTTTGGTTAACTTTTTGAATATAT
TTATGAACTGCTGTGGTGCAACTGGTTATCAGGATTTTAACTCTTCAATT
AATTTTAATAGGACTTTTTCTGGAAATTTCACTTATGGATCTAAATCGCA
AACTTACAATGTTTACCTATATTATCCAATTTCTTGTTGTAAATTCAAAG
ATTTTCAATTCGTCAATATGAATGGATGCCTTCAAAATCAGACAGATAAT
AATAAAGATTCTGGATGCACTGAACGTTTATTTAATTCAATTAAGGAATA
TCTGACTAATGTTTATCAAGTTGTTGGTGGAATTATCGGGTATCAAGGCC
TAATAATAATTGCAGCCGTTGTTTGTTTGGTATCACTAAAACAAGATTTA
GCGCAAAATGTGAAACCGGTATAAAAGAGTTGAAAGTCAAATTCATTGTG
GAAAAATATACATCATTGTGATTTCATATGATTTTATTCAGAATTTGCAT
CACTATTATTTTAGATTTCATTTATTTCATTTGTTTTCATTGATC
back to top

protein sequence of SMED30030455-orf-1

>SMED30030455-orf-1 ID=SMED30030455-orf-1|Name=SMED30030455-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
MGCCYCCCCTILVLVNIIYMIIGIVLAVAGILLVAAKNYVISIIVPTLQN
SLQSLKANGGMNVDTTAMINGILDYLVSISVILIIIGSILFVLSIIGMCS
VCCKSQCLIIIYLSIISAVLAIQIIVVIMYAANPEMSKKMINDLLKNMIA
KYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYG
SKSQTYNVYLYYPISCCKFKDFQFVNMNGCLQNQTDNNKDSGCTERLFNS
IKEYLTNVYQVVGGIIGYQGLIIIAAVVCLVSLKQDLAQNVKPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 10..278
e-value: 1.0E-22
score: 81.0
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..294
e-value: 4.8E-27
score: 92.3
NoneNo IPR availablePANTHERPTHR19282:SF286FI23944P1-RELATEDcoord: 10..282
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 10..282
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 139..232