Periodic tryptophan protein 2 homolog

Overview
NamePeriodic tryptophan protein 2 homolog
Smed IDSMED30030438
Length (bp)2671
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Periodic tryptophan protein 2 homolog (SMED30030438) t-SNE clustered cells

Violin plots show distribution of expression levels for Periodic tryptophan protein 2 homolog (SMED30030438) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Periodic tryptophan protein 2 homolog (SMED30030438) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Periodic tryptophan protein 2 homolog (SMED30030438) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030438

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030438SMESG000079759.1 SmedASXL_016423SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030438SMESG000079759.1 SmedASXL_016423SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30030438SMESG000079759.1 Contig49118newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030438SMESG000079759.1 Contig49118uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Match: PWP2 (PWP2 small subunit processome component [Source:HGNC Symbol;Acc:HGNC:9711])

HSP 1 Score: 338.191 bits (866), Expect = 4.601e-143
Identity = 202/524 (38.55%), Postives = 302/524 (57.63%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLS--PESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF TF+ HS  VTGV F       V +SS+DGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE P+  + +  N     L + SWDKT+R+W  F    T E +  TSD LAV FRPDG E+A A LN  + F+D     Q   IEG+HDL   + + + ++    ++ K F A+CYSADG  +LAGG SK++C+Y + +++L+KRF+ISCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA T+EG++++S          +   + F  F+LD S  P  +R  L ++ ++RA+  AL+L +  L+ E +E++P  E   +   L    V   L  +L    + S ++ FY  W   +L+
Sbjct:  323 IHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATG-YVVVTSSMDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDASGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPISGLCF--NPMKSVLASASWDKTVRLWDMFDSWRTKETLALTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYS----------LDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVL-EFLASSFEVSRHLEFYLLWTHKLLM 828          

HSP 2 Score: 192.2 bits (487), Expect = 4.601e-143
Identity = 104/323 (32.20%), Postives = 177/323 (54.80%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEX----------XXXXXXXXXXTYLKSKNL-----------------YYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGNS++SPVGN ++V  LK ++  T+ + + YN++ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DS+ F VGS D ST V+ A + + LI Y+LGG++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +             + +  +  T ++ K                   Y+ N + D      +T A F+   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREEEEEEEEDQEGDRETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFN---NLTAAAFHKKSHLLVTGFASGIFHLHELPEF 320          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Match: FP565260.1 (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:102724159])

HSP 1 Score: 338.191 bits (866), Expect = 2.144e-142
Identity = 202/524 (38.55%), Postives = 302/524 (57.63%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLS--PESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF TF+ HS  VTGV F       V +SS+DGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE P+  + +  N     L + SWDKT+R+W  F    T E +  TSD LAV FRPDG E+A A LN  + F+D     Q   IEG+HDL   + + + ++    ++ K F A+CYSADG  +LAGG SK++C+Y + +++L+KRF+ISCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA T+EG++++S          +   + F  F+LD S  P  +R  L ++ ++RA+  AL+L +  L+ E +E++P  E   +   L    V   L  +L    + S ++ FY  W   +L+
Sbjct:  323 IHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATG-YVVVTSSMDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDASGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPISGLCF--NPMKSVLASASWDKTVRLWDMFDSWRTKETLALTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYS----------LDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVL-EFLASSFEVSRHLEFYLLWTHKLLM 828          

HSP 2 Score: 189.889 bits (481), Expect = 2.144e-142
Identity = 103/323 (31.89%), Postives = 177/323 (54.80%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEX----------XXXXXXXXXXTYLKSKNL-----------------YYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  +GNS++SPVGN ++V  LK ++  T+ + + YN++ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DS+ F VGS D ST V+ A + + LI Y+LGG++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +             + +  +  T ++ K                   Y+ N + D      +T A F+   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRRGNLNFTCNGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREEEEEEEEDQEGDRETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFN---NLTAAAFHKKSHLLVTGFASGIFHLHELPEF 320          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Match: DAW1 (dynein assembly factor with WD repeats 1 [Source:HGNC Symbol;Acc:HGNC:26383])

HSP 1 Score: 76.6406 bits (187), Expect = 6.159e-14
Identity = 62/238 (26.05%), Postives = 106/238 (44.54%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDG 1666
            + FR    EI  ++FN     +A GS  D    ++  ++   ++  +GH   +++ L ++  G +++TG  +  V  W    GR       H   ++   F       + + S+D T   +D T  K   TLT  +     +C   DY G+L+A        +A ++   TRK +  L  HE  +  I +  N  G +L+TGS DKT RIW        +V+  +T ++ + AF   G
Sbjct:  171 HTFRGHTAEIVCLSFNPQSTLVATGSM-DTTAKLWDIQNGEEVYTLRGHSAEIIS-LSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASF-NWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF--DYTGKLIATASADG--TARIFSAATRKCIAKLEGHEGEISKISF--NPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKG 399          

HSP 2 Score: 71.633 bits (174), Expect = 2.501e-12
Identity = 72/313 (23.00%), Postives = 128/313 (40.89%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSK 1882
            Y F+V +  I     +A N  G+    GS  D    ++   S   +   +GH+  +      +P G ++ TG  +   K W +  G+C+ TF  H+  +  + F  Q    V + S+D T   +D+   +   TL     S +   ++ +  G+ +  G      + +VW   T + + +L  H   + S  +  + S   ++TGS DKT ++W  +       +T   D +L   F   G  IA A  +G    + A T   + ++EG        H+GE+              I ++  G  LL G + K
Sbjct:   83 YLFKVLKAHILPLTNVALNKSGSCFITGSY-DRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQST-LVATGSMDTTAKLWDIQNGEEVYTLRG--HSAEIISLSFNTSGDRIITGSFD--HTVVVWDADTGRKVNILIGHCAEISSASFNWDCS--LILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEG--------HEGEI------------SKISFNPQGNHLLTGSSDK 367          

HSP 3 Score: 58.9214 bits (141), Expect = 2.547e-8
Identity = 55/220 (25.00%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLV--NCLDYSP-----DGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
            VY  R    EI +++FN  G+ I  GS +     V  W + +      G K +++  +C + S      D   ++TG  +   K W  +NG+C AT + H   +    F     + + ++S DGT   +     K  C    E    + + ++ + +G  +  G      +A +W  +T + + +L  H   + S   A N  G  ++TGS D T RIW+
Sbjct:  212 VYTLRGHSAEIISLSFNTSGDRIITGSFDHT---VVVWDADT------GRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF-DYTGKLIATASADGTARIFSAATRK--CIAKLEGHEGEISKISFNPQGNHLLTGSSDK--TARIWDAQTGQCLQVLEGHTDEIFSC--AFNYKGNIVITGSKDNTCRIWR 415          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Match: WDR38 (WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:23745])

HSP 1 Score: 74.7146 bits (182), Expect = 1.035e-13
Identity = 70/275 (25.45%), Postives = 113/275 (41.09%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF---------------------------------SGDNTSEVITNTSDVL------------AVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEG----KHDLGFSKHDGELL 1792
            VN   +SPDG  L+TG  +G V  W+  +G+       H+GPV    F         S+S D TV  +D+ R K    L   +RS +    + D +     A GG D    ++W V++ +++ +L  H   + S +++  V+   L TGSWD T+ IW                                   S D T  +   T+  L            ++AF PD L +A A  +  +  +D  TG  ++ ++G     H   F+  DG++L
Sbjct:   24 VNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDG-HLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSR---QLASGGWD-KRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVN--CLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTP-DGKIL 290          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Match: WDR38 (WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:23745])

HSP 1 Score: 73.1738 bits (178), Expect = 3.744e-13
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF 1594
            VN   +SPDG  L+TG  +G V  W+  +G+       H+GPV    F         S+S D TV  +D+ R K    L   +RS +    + D +     A GG D    ++W V++ +++ +L  H   + S +++  V+   L TGSWD T+ IW  
Sbjct:   24 VNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDG-HLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSR---QLASGGWD-KRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVN--CLATGSWDSTVHIWDL 176          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Match: F55F8.3 (Periodic tryptophan protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91341])

HSP 1 Score: 259.61 bits (662), Expect = 4.646e-108
Identity = 172/531 (32.39%), Postives = 285/531 (53.67%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDN--QLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK-----------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLD--LSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQ--LKESVNVGFYSNWLKIVL 2494
            V+  RV E  I+T+A+N  G+W+AIG  + +  QL V+ W+S+SY+ + + H   +    +YSPDG  + TG  +G VK W   +  C  TF  H+  VT V +  Q  + + S+SLDGTV  +DL R +NF TL   E + Q   +A D  G+LV AG   + F+  +W  +T  L+ +L  HE  + SI+    + G ++V+GSWD+T+++W    D+ +E +  + + L V F P G EIA    +G + F++A     +  I+ K D   ++   + ++    ++ K F  I +S DG LLLAGG S   CLYS+ ++++LK++QI+ N SLDG++   +RR  TE+G +  ++D SD++             PG  +    +R+ + +V +  + + PTG +FA  ++EGV V+       S+D I     F  FQLD   + E I+R +    YS A+  +L+L     +TE +ES  I +   +   L +      L +++     +  + +V FY  WL+ +L
Sbjct:  308 VHNLRVSEMRIQTVAWNLTGDWLAIGCGKGSTAQLVVWEWQSESYVMKQQAHSLRITTA-EYSPDGSLMATGAEDGKVKIWNSRSSFCTVTFDEHTSGVTAVKW-TQSGRAILSASLDGTVRAHDLKRYRNFRTLVCPEPT-QLATLAVDKAGDLVIAGA-KEVFNIYIWSFETGHLLDILSGHESAISSID----IHGNHIVSGSWDRTIKMWTIV-DSQAETVEVSHEALDVKFSPAGDEIAVLTSDGVITFFEAKEMINLGSIDTKLDTDPARGSRDTITRQSAAKTKTFTRIRFSPDGNLLLAGGESNNFCLYSVPERMILKKWQITANRSLDGVILDFNRRNFTEFG-NMQLVDTSDEEDELEPNNKMSIKLPGTKNFDLGERRARPEVNIYEVTYCPTGRRFAICSTEGVSVY-------SLDTISM---FDPFQLDSQTNAEVIKRAVWNNDYSTAIMASLRLNNAQYITECLESTSISQIPLVASSLPL-MYAERLLKWMVEGNVMSSTRHVHFYMIWLRAIL 817          

HSP 2 Score: 152.91 bits (385), Expect = 4.646e-108
Identity = 91/312 (29.17%), Postives = 163/312 (52.24%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVY-YAPSLE-KPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCN-KSLEFLSN----DEP--NKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK 927
            M  N++ S+ IG+ Y++GQ+ F  DG S++SP+GN +S+  L+ +  KT++++ +YNI+ +++SP    +L  +E G  + V +++   I      + +  + +SP+    AI R   + ++ +  S+E K      L RTY  SS  +++IDWS D+     G +D   RV  A   + L I+ L  ++G ++ C FMKNS D+ +V K      W CN +  E +      DE   +  E+    + K    + +    Y+ +  +     ++VT A F+   N L T F +G I++HE+P F+  + L+
Sbjct:    1 MDTNFKLSNCIGTVYRDGQVAFSKDGYSVISPIGNKLSIFDLRNNTSKTLDIDCNYNIKRLSISPSGYHLLASDERGVVHFVHLLSEFKIYTFRSNKPIGSLQWSPDATRVAICRENDLQIHEFGKSIENKVYNPFSLSRTYKLSSDSLKTIDWSDDANLLVSGGEDRVVRVVGAKDFKNLFIHPLASHKGYIVNCQFMKNSYDMITVCKRGLANVWTCNLRPGELVEGIWKKDEEGSDDIEMLEDGEQKVEKIFFEKTKKYWLSESSGSGKSVDVTAARFHKETNILATAFNNGVIVLHEIPSFALVHNLR 312          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Match: prp-19 (Pre-mRNA-processing factor 19 [Source:UniProtKB/Swiss-Prot;Acc:Q10051])

HSP 1 Score: 73.559 bits (179), Expect = 2.789e-13
Identity = 48/160 (30.00%), Postives = 74/160 (46.25%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF 1594
            V+ +++ PDG+   TG  +  VK W + N    A F  H+  V  + F  +    + + S DG V  +DL +LKN  T   EE+      ++ D  G  +  GG        V  VK+   +  L DH  PV  + +  N     LVT S DK++R++ F
Sbjct:  341 VHSIEFHPDGLIFGTGAADAVVKIWDLKNQTVAAAFPGHTAAVRSIAF-SENGYYLATGSEDGEVKLWDLRKLKNLKTFANEEKQ-PINSLSFDMTGTFLGIGGQ----KVQVLHVKSWSEVVSLSDHSGPVTGVRFGENARS--LVTCSLDKSLRVFSF 492          

HSP 2 Score: 58.5362 bits (140), Expect = 1.562e-8
Identity = 40/185 (21.62%), Postives = 79/185 (42.70%), Query Frame = 2
Query: 1040 DNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF 1594
            D  + ++ ++ +  +   KGH +  +N +   PD I  ++   + +++ W  ++    A    H  PVT +         + S+S D      D+   K+ C ++ E  S Q    + ++  + +  G G       +W +K + +      H   V SI ++ N  G YL TGS D  +++W  
Sbjct:  230 DKTVVLYDYEKEQVMQTFKGHNKK-INAVVLHPDNITAISASADSHIRVWSATDSSSKAIIDVHQAPVTDISL-NASGDYILSASDDSYWAFSDIRSGKSLCKVSVEPGS-QIAVHSIEFHPDGLIFGTGAADAVVKIWDLKNQTVAAAFPGHTAAVRSIAFSEN--GYYLATGSEDGEVKLWDL 409          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Match: snrp-40.2 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:O02097])

HSP 1 Score: 66.6254 bits (161), Expect = 2.280e-11
Identity = 56/207 (27.05%), Postives = 99/207 (47.83%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQL---NVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW 1588
            GEI T  F+  G+++A  +  D Q+   NVF       +   KGHK +++  + ++ D   LV+ G +  V+ W +  G C   F +H+  V  V   ++ PQ + S+S DGTV  +D+   +       +   YQ T V  +   + V  GG  +     VW +    + Y+L  H   + S+  +V+ +G +L++ S D ++  W
Sbjct:   37 GEIYTSQFSSDGSFLA-SAGYDQQIFLWNVFGECENFAVL--KGHKGAIME-VKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSHTDIVNSVDVNRRGPQMICSASDDGTVMVHDMRSKEAAKKFICK---YQQTAVTFNDAADNVICGGIDNQIK--VWDMLRNDVRYVLSGHRDTITSL--SVSHNGNFLLSNSMDCSLMSW 232          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Match: snrp-40.1 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q19211])

HSP 1 Score: 65.4698 bits (158), Expect = 5.279e-11
Identity = 57/208 (27.40%), Postives = 98/208 (47.12%), Query Frame = 2
Query:  974 EGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWK--SQSYIFQS-KGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW 1588
            EGEI T AF+  G  +A    +     +F W    +   F + KGH  ++++ L ++ D   LV+ G + +V+ W +  G C   F  H+  V  V   ++    V S+S DGT   +D+   +   T T     YQ T V  +   + V +GG  +     VW ++  ++ Y L  H   +  I  +++ SG ++++ S D T+R W
Sbjct:   38 EGEIYTGAFSPDGTCLATSGYDQK---IFFWNVYGECENFSTIKGHSGAVMD-LKFTTDSSSLVSCGTDKSVRVWDMETGTCARRFRTHTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNR---YQQTAVTFNDSSDQVISGGIDNVLK--VWDMRRDEITYTLTGHRDTITGI--SLSPSGKFIISNSMDCTVRQW 234          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Match: Y41C4A.32 (pep chromosome:WBcel235:III:11721706:11723602:1 gene:WBGene00270321.1 transcript:Y41C4A.32.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41C4A.32)

HSP 1 Score: 64.6994 bits (156), Expect = 6.647e-11
Identity = 54/213 (25.35%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISN-GRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW 1588
            V    V E   R   F    NWIA  S +D Q+ +F  ++ S I +   H    +  L   P    L++   +  ++ W   N  R    F  H+  +  +    + P+   S SLD T+  + L   ++ CTL   E+     CV     G +V+  G  DC S  VW ++T+K +  L +  +   +    V     ++++G+ D T++IW
Sbjct:   47 VKAMEVSEKSTRAAKFIHRKNWIATAS-DDQQIRIFDAETFSLINEFTAHS-DFIRSLTVHPTLPYLISASDDRKIRVWDWENEWRMEQEFQEHAHYIMQIAVNPEDPEMFVSGSLDKTLKVWKLGEQESICTLEGHEKG--VNCVEFLTGGRIVS--GSDDC-SICVWDIQTQKCIETLKNAHKNNVTF---VTPFKTWIISGAEDSTVKIW 249          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Match: CG12325 (gene:FBgn0033557 transcript:FBtr0345930)

HSP 1 Score: 311.612 bits (797), Expect = 1.134e-91
Identity = 181/487 (37.17%), Postives = 283/487 (58.11%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKIT------PGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQL 2392
            ++   + +  I    FN  G+W+A+ S+E  QL V+ W+S+ YI + +GH  S + C+ YS DG  + TGG +  VK W   +  CF TFS H+  VTG+ F + K + + SSSLDGTV  +D+ R +NF T T+   + QF+CVA DY GELV AGG  D F   +W VKT KL+ ++  HE PV SI ++   +   LV+GSWDKT++IW     ++  E I   SDV  V F P G EIA A L+GN+  +D  +  QV  IEG++DL   + + ++++  K ++   F  I YSADG+ +LA G S  IC+Y + + +LLK+F+I+ N SLDG+ +   R+ ++E+G    + +  + +        PG      S R+ + +V V S+KFSPTG  FAAA +EG+ +++ +K        G V D     L+++P+++   L ++ Y++AL  +LKL + +L+  V+E +P  +   +   L
Sbjct:  343 IHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQYIMKQQGHS-SEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNK-KFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPA-QFSCVAVDYSGELVVAGG-QDVFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNDLSAGRLETDIITARKNAQANYFSTIEYSADGECILAAGKSANICIYHVREAILLKKFEITQNHSLDGLNDFISRKHLSEFGNMALVEEREELEGGRVAIRLPGVQRGDMSSRRFQQEVRVFSVKFSPTGQAFAAAGTEGLCIYALDK--------GVVFDPFDLSLEVTPKAVHESLKQQNYTKALVMSLKLNEPNLIALVLERVPYKDVELVCADL 817          

HSP 2 Score: 196.823 bits (499), Expect = 1.028e-51
Identity = 116/385 (30.13%), Postives = 195/385 (50.65%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAP-SLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNK-----------------------------------TEXXXXXXXXXXXTYLKSKNLYYRNIQ--------TDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK*NFKIIIFGLL-----FQSM*RRDSNNCL*WYWKLDSY 1026
            MK +Y+FS+++G+ Y+NG + F PDGNS++SPVGN I+V  LK ++ +T+ + S YN  +IA+SP   L++ +NE+G A ++SM++  VI+ H F+  V C+ FSPNG FFA+    +V+++ AP  +        L+R + G   DV  +DWSSDS+  A+G  D+ST++ A   T+    Y+L G+   ++ C F  NSL + ++S+N QLC W+C+ +   L + E  K                                   T+ +    +       KS   +Y+ I           +Q  +++T A++N     LV  F  G   ++E+PD +  + L  +   I   L      + ++  R+    L W W+ + Y
Sbjct:    1 MKFSYKFSNLLGTIYRNGNLVFTPDGNSVISPVGNRITVYDLKNNKSRTLSLESRYNYTNIALSPDGSLLIAVNEKGEAQLISMMSCTVIHRHKFQTGVQCICFSPNGAFFAVAVQNVVLIFCAPGEITGEYNPFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAINYTKNFRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLEDAERPKIAPPQRKKEKKAVSDNESEDDVENVVEKDALKEESTKEAEDVNHIKNEDETKSHPFFYKKITRHYLADEPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQY 385          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Match: CG12325 (gene:FBgn0033557 transcript:FBtr0088227)

HSP 1 Score: 311.612 bits (797), Expect = 1.134e-91
Identity = 181/487 (37.17%), Postives = 283/487 (58.11%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKIT------PGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQL 2392
            ++   + +  I    FN  G+W+A+ S+E  QL V+ W+S+ YI + +GH  S + C+ YS DG  + TGG +  VK W   +  CF TFS H+  VTG+ F + K + + SSSLDGTV  +D+ R +NF T T+   + QF+CVA DY GELV AGG  D F   +W VKT KL+ ++  HE PV SI ++   +   LV+GSWDKT++IW     ++  E I   SDV  V F P G EIA A L+GN+  +D  +  QV  IEG++DL   + + ++++  K ++   F  I YSADG+ +LA G S  IC+Y + + +LLK+F+I+ N SLDG+ +   R+ ++E+G    + +  + +        PG      S R+ + +V V S+KFSPTG  FAAA +EG+ +++ +K        G V D     L+++P+++   L ++ Y++AL  +LKL + +L+  V+E +P  +   +   L
Sbjct:  343 IHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQYIMKQQGHS-SEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNK-KFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPA-QFSCVAVDYSGELVVAGG-QDVFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNDLSAGRLETDIITARKNAQANYFSTIEYSADGECILAAGKSANICIYHVREAILLKKFEITQNHSLDGLNDFISRKHLSEFGNMALVEEREELEGGRVAIRLPGVQRGDMSSRRFQQEVRVFSVKFSPTGQAFAAAGTEGLCIYALDK--------GVVFDPFDLSLEVTPKAVHESLKQQNYTKALVMSLKLNEPNLIALVLERVPYKDVELVCADL 817          

HSP 2 Score: 196.823 bits (499), Expect = 1.028e-51
Identity = 116/385 (30.13%), Postives = 195/385 (50.65%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAP-SLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNK-----------------------------------TEXXXXXXXXXXXTYLKSKNLYYRNIQ--------TDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK*NFKIIIFGLL-----FQSM*RRDSNNCL*WYWKLDSY 1026
            MK +Y+FS+++G+ Y+NG + F PDGNS++SPVGN I+V  LK ++ +T+ + S YN  +IA+SP   L++ +NE+G A ++SM++  VI+ H F+  V C+ FSPNG FFA+    +V+++ AP  +        L+R + G   DV  +DWSSDS+  A+G  D+ST++ A   T+    Y+L G+   ++ C F  NSL + ++S+N QLC W+C+ +   L + E  K                                   T+ +    +       KS   +Y+ I           +Q  +++T A++N     LV  F  G   ++E+PD +  + L  +   I   L      + ++  R+    L W W+ + Y
Sbjct:    1 MKFSYKFSNLLGTIYRNGNLVFTPDGNSVISPVGNRITVYDLKNNKSRTLSLESRYNYTNIALSPDGSLLIAVNEKGEAQLISMMSCTVIHRHKFQTGVQCICFSPNGAFFAVAVQNVVLIFCAPGEITGEYNPFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAINYTKNFRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLEDAERPKIAPPQRKKEKKAVSDNESEDDVENVVEKDALKEESTKEAEDVNHIKNEDETKSHPFFYKKITRHYLADEPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQY 385          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Match: U4-U6-60K (gene:FBgn0036733 transcript:FBtr0075209)

HSP 1 Score: 71.633 bits (174), Expect = 1.484e-12
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQ--TVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDC---FSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW 1588
            +  +AF+  G ++A     D+   ++  + ++ +   +GH +  V+CL Y  DG  LVTGG +   + W +  GRC      H G V GV F    P    + + S D T   +DL R +   T+ A       T + SD K +         C    +  +W  KT + +  L  H+  V S++ A N    Y+ T S+D+T ++W
Sbjct:  356 VSKVAFHPSGRFLATACY-DSSWRLWDLEQKTEVLHQEGHAKP-VHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDF---SPNGFHIATGSQDNTCKIWDLRRRQPVYTIPA------HTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDIAPNSQ--YIATTSFDRTFKLW 549          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Match: CG30116 (gene:FBgn0028496 transcript:FBtr0086721)

HSP 1 Score: 72.0182 bits (175), Expect = 1.994e-12
Identity = 64/277 (23.10%), Postives = 126/277 (45.49%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDV---LAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQI 1936
            V+CL ++P+G  L TG  +  V  W ++ G    +F  H+ PV  VV      + V S+  D  +  + +    N   L   +  Y+   V ++ +  +   G  T      +W +      Y +   ++  C   + ++   +++++GS D ++++WQ +G   S+V+   SD    +AV+       ++G+  + NL+ +D LTG++V  + G        H G ++  VKV           SADG   ++G + K + ++  ++ L L   Q+
Sbjct: 1257 VSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHTAPVVKVVVLMDSLR-VISTDRDSMLLVW-MAHSGNL--LQTIQGPYKSLSVTNNMRFAVSTNGDNT----LKIWSLTQEDEKYSVSHSDEITC---FEISADSVHIISGSRDMSLKVWQATGGKLSQVLVGHSDAVTCVAVSVTNKTQVLSGS-KDMNLILWDLLTGEEVHTLAG--------HLGPVIG-VKV-----------SADGSTAVSGSDDKTLIVWETKRGLALTSLQM 1501          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Match: CG30116 (gene:FBgn0028496 transcript:FBtr0086719)

HSP 1 Score: 72.0182 bits (175), Expect = 1.994e-12
Identity = 64/277 (23.10%), Postives = 126/277 (45.49%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDV---LAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQI 1936
            V+CL ++P+G  L TG  +  V  W ++ G    +F  H+ PV  VV      + V S+  D  +  + +    N   L   +  Y+   V ++ +  +   G  T      +W +      Y +   ++  C   + ++   +++++GS D ++++WQ +G   S+V+   SD    +AV+       ++G+  + NL+ +D LTG++V  + G        H G ++  VKV           SADG   ++G + K + ++  ++ L L   Q+
Sbjct: 1257 VSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHTAPVVKVVVLMDSLR-VISTDRDSMLLVW-MAHSGNL--LQTIQGPYKSLSVTNNMRFAVSTNGDNT----LKIWSLTQEDEKYSVSHSDEITC---FEISADSVHIISGSRDMSLKVWQATGGKLSQVLVGHSDAVTCVAVSVTNKTQVLSGS-KDMNLILWDLLTGEEVHTLAG--------HLGPVIG-VKV-----------SADGSTAVSGSDDKTLIVWETKRGLALTSLQM 1501          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Match: pwp2h (PWP2 small subunit processome component [Source:ZFIN;Acc:ZDB-GENE-021031-3])

HSP 1 Score: 331.257 bits (848), Expect = 8.140e-139
Identity = 192/522 (36.78%), Postives = 310/522 (59.39%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGD-NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSD------KKITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I  I+ N  G+WI+ G     QL V+ W+S+SY+F+ +GH  ++ N L YSPDG  L TGG +G VK W  ++G CF TF+ HS  VT V F       V S+SLDGTV  +DL R +NF T+T+  R  QF+ +A D  GELV AG   D F   +W ++T +L+ +L  HE PV ++ ++   S   L + SWDKT+R+W       T E +  TSD LAV + P+G+E+A A L+G + F++  TG Q   I G+HDL   + + E ++  + ++ K+F  +CYSADG+ +L GG SK++C+Y+I++ LL+K+F+ISCN+SLD + E  DRRK+TE+G S +++D         +   PG      S R  K ++ V+S++FSPTG  +AAA++EG++++S +           V D     +D++P SIR+ + +++++ A+  + +L ++ L+ EV+E+IP  +   +   L    V   L  ++   L++S ++ FY  W + +L 
Sbjct:  335 IHSLSISDQRISAISLNPTGDWISFGCSGLGQLLVWEWQSESYVFKQQGHFNNM-NSLAYSPDGQYLATGGDDGKVKVWNTNSGLCFVTFTEHSSGVTEVAFTSSG-FVVVSASLDGTVRAFDLHRYRNFRTMTSP-RPAQFSSLAVDGSGELVCAGS-QDSFEIFLWSMQTGRLLEVLSGHEGPVSNLCFSPVQS--VLASVSWDKTVRLWDMLDSWQTKETLQLTSDGLAVTYHPNGMELAVASLDGEITFWNPQTGRQTGSITGRHDLQMGRKESEKITAKQSAKGKSFTTLCYSADGESILTGGKSKFVCIYNIKEHLLMKKFEISCNLSLDAMEEFLDRRKMTEFG-SLSLVDEGTGDGNGVELSLPGVKKGDMSTRCFKPEISVSSLRFSPTGRSWAAASTEGLLIYSLDAAL--------VFDPYDLDIDVTPTSIRQQITKKEWASAILLSFRLNEILLIREVLEAIPFDQITVVCSSLPDVYVD-KLLNFVASTLEKSNHLQFYLTWAQCLLT 840          

HSP 2 Score: 184.496 bits (467), Expect = 8.140e-139
Identity = 116/336 (34.52%), Postives = 182/336 (54.17%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFL----------------------SNDEPN------------------KTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G I F  +G+S++SPVGN ISV  LK ++ +T+ V++S NI    +SP   L + I+E+G A +VS++T  V++HH+F   V+ VSFSP+G+ F + +  + ++Y+AP   K      L +T+ G   ++  IDW+ DSK FAVGS D +T ++ A +   LI YSLGG++  ++ C F K+SLD+++VS+   LC W+ +  LE L                        DE N                    E   + +    V YL+ K+ YY N + D     ++T A F+   + LVTGF  G   +HE+P F
Sbjct:    1 MKFAYKFSNLLGAFYRQGNISFSKNGDSVISPVGNRISVFDLKNNKSETLPVSTSKNIACFDISPDGNLAILIDEDGAAILVSLVTRAVLHHHHFHNPVHNVSFSPDGRKFVVTKENVALMYHAPGRNKEFNAFALNKTFYGPFDEMTCIDWTDDSKCFAVGSKDMTTWIFGAERWANLIYYSLGGHKDIIVGCFFEKDSLDMYTVSQEGTLCIWESDTDLEGLRKGPKYAERKEKEQKKLRVLEMEEDEANDIEIMGEDGETRGDVIKGSAETPEEVEGIKNVRYLQ-KSKYYFNKEGDFN---KLTAAAFHKRTHILVTGFASGAFHLHELPGF 332          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 72.0182 bits (175), Expect = 9.837e-13
Identity = 70/313 (22.36%), Postives = 127/313 (40.58%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNT-SEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSK 1882
            Y FR  +  I     +AFN  G+    GS  D    ++   S   +   +GH+  +      +P G ++ TG  +   K W    G+CF TF  H+  +  + F  Q    V + S+D T   +D+   +   TL          C   +  G+ +  G      +A++W V + + +++L  H   +  +++  + S   + T S DK+ ++W   G    + ++ +  +VL V F   G  IA A  +G    +   T   + ++EG        H GE+              +C++A G  +L     K
Sbjct:   83 YLFRALQAHILPLTNVAFNKSGSCFITGSY-DRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQST-LVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCF--NTTGDRLVTGSFD--HTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCS--LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEG--------HKGEI------------SKVCFNAQGSRVLTASVDK 367          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 71.2478 bits (173), Expect = 1.053e-12
Identity = 69/285 (24.21%), Postives = 125/285 (43.86%), Query Frame = 2
Query: 1085 FQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLA-VAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            F   GH ++ V+ + +SP G  L +   +  +K W   +G+   T S H   ++ V +       + S+S D T+  +D++  K  C  T +  S    C   + +  L+ +G   +  S  +W VKT K +  L  H  PV ++ +  N  G  +V+ S+D   RIW   SG     +I + +  ++ V F P+G  I  A L+  L  +D   G  +K   G        H  E   +       NF        GK +++G     + +++++ K ++++ Q
Sbjct:   39 FTLAGHTKA-VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS-NLLVSASDDKTLKIWDVSSGK--CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDE--SVRIWDVKTGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG--------HKNEKYCIF-----ANFSV----TGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 56.6102 bits (135), Expect = 5.590e-8
Identity = 56/241 (23.24%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVS-GIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGN 1699
            I  +A++   N + + + +D  L ++   S   +   KGH  + V C +++P    +V+G  + +V+ W +  G+C  T   HS PV+ V F +     + SSS DG    +D    +   TL  ++     + V     G+ + A    +     +W     K +     H+     I    +V+ G ++V+GS D  + IW        + +   +D V++ A  P    IA A L  +
Sbjct:   90 ISDVAWSSDSN-LLVSASDDKTLKIWDVSSGKCLKTLKGH-SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLK--LWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALEND 324          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Match: wdr38 (WD repeat domain 38 [Source:ZFIN;Acc:ZDB-GENE-050417-160])

HSP 1 Score: 68.5514 bits (166), Expect = 1.282e-12
Identity = 53/181 (29.28%), Postives = 85/181 (46.96%), Query Frame = 2
Query: 1079 YIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVI 1621
            Y  + KG     VNC  +SPD   L+T    G +  W+ S  +  A+ S H+GPV   VF     +   S+S D +V  +  + LK   TLTA  RS +    + D  G+ + +GG  +   AL+W +++  L+  L  H           +     + TGSWD+ +R+W+   D  +E +
Sbjct:   17 YFSRHKGE----VNCCAFSPDCQLLLTCCDAGKLYLWKTSTAKLLASVSGHTGPVKCCVFSSDG-RLFASASHDCSVRIWCSSSLKCTHTLTAHRRSVETVSFSPD--GQWLLSGGWDN--RALIWSIQSGALLEELKGHNAA--VQSSVFSSDSQSVATGSWDRAVRVWKLR-DRQAEAM 185          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 71.633 bits (174), Expect = 1.298e-12
Identity = 70/313 (22.36%), Postives = 127/313 (40.58%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNT-SEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSK 1882
            Y FR  +  I     +AFN  G+    GS  D    ++   S   +   +GH+  +      +P G ++ TG  +   K W    G+CF TF  H+  +  + F  Q    V + S+D T   +D+   +   TL          C   +  G+ +  G      +A++W V + + +++L  H   +  +++  + S   + T S DK+ ++W   G    + ++ +  +VL V F   G  IA A  +G    +   T   + ++EG        H GE+              +C++A G  +L     K
Sbjct:   83 YLFRALQAHILPLTNVAFNKSGSCFITGSY-DRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQST-LVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCF--NTTGDRLVTGSFD--HTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCS--LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEG--------HKGEI------------SKVCFNAQGSRVLTASVDK 367          

HSP 2 Score: 62.3882 bits (150), Expect = 1.396e-9
Identity = 55/205 (26.83%), Postives = 87/205 (42.44%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI ++ FN  G+ +  GS  D+   ++   S   +    GH R  ++C+ ++ D   + T   + + K W    G+C AT   H+  V  V F     Q + ++S DGT   +     +  C L   +      C  +     L A+   T    + VW VKT   + +L  H   + S   A N  G  ++TGS D T RIW 
Sbjct:  220 AEIISLCFNTTGDRLVTGSF-DHTAILWDVPSGRKVHVLSGH-RGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCF-NYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKT----SRVWCVKTGACLQVLEGHSDEIFSC--AFNYEGDTIITGSKDNTCRIWH 415          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 77.0258 bits (188), Expect = 4.233e-14
Identity = 73/320 (22.81%), Postives = 138/320 (43.12%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYS-PDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYS 1900
            Y F+V    I     +AFN  G+    GS  D    V+   S   +   +GH R++V  + ++ P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    + + S+D T   +D+   +   TL+    + +   ++ +  G+ +  G      S  VW++ + +  + L  H   + S ++  + S   + T S DK+ ++W   +G   + +  +  +VL V F   G  +A A  +G    Y A +   + ++EG        H+GE+              IC++A G  +L   + K   L++
Sbjct:  103 YLFKVLRAHILPLTNVAFNKSGSSFITGSY-DRTCKVWDTASGEELHTLEGH-RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSGH--AAEIISLSFNTTGDRLITGSFDHTVS--VWEIPSGRRNHTLIGHRGEISSAQFNWDCS--LIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEG--------HEGEI------------SKICFNAQGNRILTASSDKTSRLWN 393          

HSP 2 Score: 71.2478 bits (173), Expect = 2.627e-12
Identity = 66/241 (27.39%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEI 1675
            + FR    EI  +AFN     IA GS  D    ++  +S        GH   +++ L ++  G +L+TG  +  V  W+I +GR   T   H G ++   F       + ++S+D +   +D    K   TLT  E   +   V  D  G+LVA        +A V+   +RK +  L  HE  +  I +  N  G  ++T S DKT R+W   +G+    +  +T ++ + AF  +G  I
Sbjct:  191 HTFRGHTAEIVCLAFNPQSTLIATGSM-DTTAKLWDIQSGEEALTLSGHAAEIIS-LSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQF-NWDCSLIATASMDKSCKLWDSLNGKCVATLTGHED--EVLDVTFDSTGQLVATASADG--TARVYSASSRKCLAKLEGHEGEISKICF--NAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTI 422          

HSP 3 Score: 62.003 bits (149), Expect = 2.833e-9
Identity = 56/205 (27.32%), Postives = 88/205 (42.93%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI +++FN  G+ +  GS  D+ ++V+   S        GH R  ++   ++ D   + T   + + K W   NG+C AT + H   V  V F     Q V ++S DGT   Y  +  K    L   E      C  +     L A+   T    + +W   T + + +L  H   + S   A N  G  ++TGS D T RIW+
Sbjct:  240 AEIISLSFNTTGDRLITGSF-DHTVSVWEIPSGRRNHTLIGH-RGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTF-DSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKT----SRLWNPHTGECLQVLKGHTDEIFSC--AFNYEGNTIITGSKDNTCRIWR 435          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 76.6406 bits (187), Expect = 5.581e-14
Identity = 73/320 (22.81%), Postives = 138/320 (43.12%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYS-PDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYS 1900
            Y F+V    I     +AFN  G+    GS  D    V+   S   +   +GH R++V  + ++ P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    + + S+D T   +D+   +   TL+    + +   ++ +  G+ +  G      S  VW++ + +  + L  H   + S ++  + S   + T S DK+ ++W   +G   + +  +  +VL V F   G  +A A  +G    Y A +   + ++EG        H+GE+              IC++A G  +L   + K   L++
Sbjct:   85 YLFKVLRAHILPLTNVAFNKSGSSFITGSY-DRTCKVWDTASGEELHTLEGH-RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSG--HAAEIISLSFNTTGDRLITGSFDHTVS--VWEIPSGRRNHTLIGHRGEISSAQFNWDCS--LIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEG--------HEGEI------------SKICFNAQGNRILTASSDKTSRLWN 375          

HSP 2 Score: 71.2478 bits (173), Expect = 2.729e-12
Identity = 65/238 (27.31%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDG 1666
            + FR    EI  +AFN     IA GS  D    ++  +S        GH   +++ L ++  G +L+TG  +  V  W+I +GR   T   H G ++   F       + ++S+D +   +D    K   TLT  E   +   V  D  G+LVA        +A V+   +RK +  L  HE  +  I +  N  G  ++T S DKT R+W   +G+    +  +T ++ + AF  +G
Sbjct:  173 HTFRGHTAEIVCLAFNPQSTLIATGSM-DTTAKLWDIQSGEEALTLSGHAAEIIS-LSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQF-NWDCSLIATASMDKSCKLWDSLNGKCVATLTGHED--EVLDVTFDSTGQLVATASADG--TARVYSASSRKCLAKLEGHEGEISKICF--NAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEG 401          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 76.6406 bits (187), Expect = 5.689e-14
Identity = 73/320 (22.81%), Postives = 138/320 (43.12%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYS-PDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYS 1900
            Y F+V    I     +AFN  G+    GS  D    V+   S   +   +GH R++V  + ++ P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    + + S+D T   +D+   +   TL+    + +   ++ +  G+ +  G      S  VW++ + +  + L  H   + S ++  + S   + T S DK+ ++W   +G   + +  +  +VL V F   G  +A A  +G    Y A +   + ++EG        H+GE+              IC++A G  +L   + K   L++
Sbjct:  100 YLFKVLRAHILPLTNVAFNKSGSSFITGSY-DRTCKVWDTASGEELHTLEGH-RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSG--HAAEIISLSFNTTGDRLITGSFDHTVS--VWEIPSGRRNHTLIGHRGEISSAQFNWDCS--LIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEG--------HEGEI------------SKICFNAQGNRILTASSDKTSRLWN 390          

HSP 2 Score: 71.633 bits (174), Expect = 2.321e-12
Identity = 65/238 (27.31%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDG 1666
            + FR    EI  +AFN     IA GS  D    ++  +S        GH   +++ L ++  G +L+TG  +  V  W+I +GR   T   H G ++   F       + ++S+D +   +D    K   TLT  E   +   V  D  G+LVA        +A V+   +RK +  L  HE  +  I +  N  G  ++T S DKT R+W   +G+    +  +T ++ + AF  +G
Sbjct:  188 HTFRGHTAEIVCLAFNPQSTLIATGSM-DTTAKLWDIQSGEEALTLSGHAAEIIS-LSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQF-NWDCSLIATASMDKSCKLWDSLNGKCVATLTGHED--EVLDVTFDSTGQLVATASADG--TARVYSASSRKCLAKLEGHEGEISKICF--NAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEG 416          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 76.6406 bits (187), Expect = 5.740e-14
Identity = 72/314 (22.93%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYS-PDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSK 1882
            Y F+V    I     +AFN  G+    GS  D    V+   S   +   +GH R++V  + ++ P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    + + S+D T   +D+   +   TL+    + +   ++ +  G+ +  G      S  VW++ + +  + L  H   + S ++  + S   + T S DK+ ++W   +G   + +  +  +VL V F   G  +A A  +G    Y A +   + ++EG        H+GE+              IC++A G  +L   + K
Sbjct:   90 YLFKVLRAHILPLTNVAFNKSGSSFITGSY-DRTCKVWDTASGEELHTLEGH-RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSG--HAAEIISLSFNTTGDRLITGSFDHTVS--VWEIPSGRRNHTLIGHRGEISSAQFNWDCS--LIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEG--------HEGEI------------SKICFNAQGNRILTASSDK 374          

HSP 2 Score: 71.2478 bits (173), Expect = 2.649e-12
Identity = 65/238 (27.31%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDG 1666
            + FR    EI  +AFN     IA GS  D    ++  +S        GH   +++ L ++  G +L+TG  +  V  W+I +GR   T   H G ++   F       + ++S+D +   +D    K   TLT  E   +   V  D  G+LVA        +A V+   +RK +  L  HE  +  I +  N  G  ++T S DKT R+W   +G+    +  +T ++ + AF  +G
Sbjct:  178 HTFRGHTAEIVCLAFNPQSTLIATGSM-DTTAKLWDIQSGEEALTLSGHAAEIIS-LSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQF-NWDCSLIATASMDKSCKLWDSLNGKCVATLTGHED--EVLDVTFDSTGQLVATASADG--TARVYSASSRKCLAKLEGHEGEISKICF--NAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEG 406          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 76.6406 bits (187), Expect = 5.764e-14
Identity = 72/314 (22.93%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYS-PDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSK 1882
            Y F+V    I     +AFN  G+    GS  D    V+   S   +   +GH R++V  + ++ P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    + + S+D T   +D+   +   TL+    + +   ++ +  G+ +  G      S  VW++ + +  + L  H   + S ++  + S   + T S DK+ ++W   +G   + +  +  +VL V F   G  +A A  +G    Y A +   + ++EG        H+GE+              IC++A G  +L   + K
Sbjct:   86 YLFKVLRAHILPLTNVAFNKSGSSFITGSY-DRTCKVWDTASGEELHTLEGH-RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSG--HAAEIISLSFNTTGDRLITGSFDHTVS--VWEIPSGRRNHTLIGHRGEISSAQFNWDCS--LIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEG--------HEGEI------------SKICFNAQGNRILTASSDK 370          

HSP 2 Score: 71.2478 bits (173), Expect = 2.533e-12
Identity = 65/238 (27.31%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDG 1666
            + FR    EI  +AFN     IA GS  D    ++  +S        GH   +++ L ++  G +L+TG  +  V  W+I +GR   T   H G ++   F       + ++S+D +   +D    K   TLT  E   +   V  D  G+LVA        +A V+   +RK +  L  HE  +  I +  N  G  ++T S DKT R+W   +G+    +  +T ++ + AF  +G
Sbjct:  174 HTFRGHTAEIVCLAFNPQSTLIATGSM-DTTAKLWDIQSGEEALTLSGHAAEIIS-LSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQF-NWDCSLIATASMDKSCKLWDSLNGKCVATLTGHED--EVLDVTFDSTGQLVATASADG--TARVYSASSRKCLAKLEGHEGEISKICF--NAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEG 402          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Match: Pwp2 (PWP2 periodic tryptophan protein homolog (yeast) [Source:MGI Symbol;Acc:MGI:1341200])

HSP 1 Score: 334.724 bits (857), Expect = 9.368e-142
Identity = 204/524 (38.93%), Postives = 305/524 (58.21%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLS--PESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  + ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF T + HS  VTGV F       + +SSLDGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE PV  + +  N     L + SWDKT+R+W  F    T E +T TSD LAV FRPDG E+A A LN  + F+D     QV  IEG+HDL   + + + ++    ++ K F  +CYSADG+ +LAGG SK++CLY + +++L+KRF++SCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA ++EG+++FS          +   + F  F+LD S  P  IR  L +R+++RA+  A +L +  L  E +E++P  E   +   L    V V +  +L    +ES ++ FY  W + +L+
Sbjct:  323 IHSLSISDQRVASVAINSSGDWIAFGCSGMGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTLTEHSSGVTGVTFTTTG-HVIVTSSLDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDSSGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPVSGLCF--NPMKSILASASWDKTVRLWDMFDSWRTKETLTLTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQVGSIEGRHDLKTGRKELDKITAKHSAKGKAFTTLCYSADGQSILAGGMSKFVCLYHVREQILVKRFELSCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGEENGVAVPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATSTEGLLIFS----------LDAQMLFDPFELDTSVTPGRIREALRQREFTRAILMAFRLNEKKLAQEALEAVPQNEIEVVSTSLPELYV-VKVLEFLAASFEESRHLEFYLIWTQKLLM 828          

HSP 2 Score: 190.66 bits (483), Expect = 9.368e-142
Identity = 104/323 (32.20%), Postives = 175/323 (54.18%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEX----------XXXXXXXXXXTYLKSKNL-----------------YYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGNS++SPVGN ++V  LK +   T+ + + YNI+ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DSK F VGS D ST V+ A + + LI Y+L G++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +              ++  +  T ++ K                   Y+ N + D      +T A ++   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRCGNLNFTHDGNSVISPVGNRVTVFDLKNNRSNTLPLATKYNIKCVGLSPDGRLAIIVDEGGAALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSKCFVVGSKDMSTWVFGAERWDNLIYYALSGHKDAIVACFFESNSLDLYSLSQDGALCVWQCDTPPEGLRLKAPRGWKADILQREKEEEEEDEEEGDRETTIRGKTTPAEQERVGKVKYSRLAKYFLNKEGDFN---NLTSAAYHKKTHLLVTGFASGIFHLHELPEF 320          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 87.8113 bits (216), Expect = 2.152e-18
Identity = 80/302 (26.49%), Postives = 130/302 (43.05%), Query Frame = 2
Query: 1097 GHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYML---CDHEQ-----------------------------PVCSIE----YAVNVSGI------YLVTGSWDKTMRIWQFSGDNTS-EVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGG 1873
            G     VNC  +SPDG  L+T   +G V  W   +GR     + H GPV    F     + + SSS D ++  +D+ R K    L   +RS +    + D K     A GG D   A+VW+V++ + +++L   CD  Q                             PV S      +  N+S +       L +GSWDKT+ +W+ + +N   ++  +T  V ++AF PD L++A A  +  +  +D LTG  ++ ++G  D+                      A  ++ DGKLL++G 
Sbjct:   23 GQHHGEVNCSAFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDG-RLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSK---QLASGGWD-KRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGHTGNISCLCYSASGLLASGSWDKTICVWKPTTNNLPLQLKGHTIWVNSLAFSPDELKLASAGYSRTVKVWDCLTGKCLETLKGMLDVA--------------------HACIFTPDGKLLVSGA 299          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 87.8113 bits (216), Expect = 2.152e-18
Identity = 80/302 (26.49%), Postives = 130/302 (43.05%), Query Frame = 2
Query: 1097 GHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYML---CDHEQ-----------------------------PVCSIE----YAVNVSGI------YLVTGSWDKTMRIWQFSGDNTS-EVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGG 1873
            G     VNC  +SPDG  L+T   +G V  W   +GR     + H GPV    F     + + SSS D ++  +D+ R K    L   +RS +    + D K     A GG D   A+VW+V++ + +++L   CD  Q                             PV S      +  N+S +       L +GSWDKT+ +W+ + +N   ++  +T  V ++AF PD L++A A  +  +  +D LTG  ++ ++G  D+                      A  ++ DGKLL++G 
Sbjct:   23 GQHHGEVNCSAFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDG-RLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSK---QLASGGWD-KRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGHTGNISCLCYSASGLLASGSWDKTICVWKPTTNNLPLQLKGHTIWVNSLAFSPDELKLASAGYSRTVKVWDCLTGKCLETLKGMLDVA--------------------HACIFTPDGKLLVSGA 299          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 78.5666 bits (192), Expect = 1.033e-14
Identity = 82/333 (24.62%), Postives = 136/333 (40.84%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLT---AEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF-SGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            Y F+V    I     +A N  G+    GS  D    V+   S   +   +GHK  +      +P G ++ TG  +   K W    G+C+ TF  H+  +  + F  Q    V + S+D T   +D+   +   TLT   AE  S  F     D  G+ +  G      + +VW   T + ++ L  H   + S  +  + S   ++TGS DKT  +W   SG   + +  +  ++L   F   G  IA A  +G    Y+A T   V ++EG        H+GE+              I ++  G  LL G + K   ++ ++    L+  +
Sbjct:   83 YLFKVLRAHILPLTNVALNKAGSCFITGSY-DRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQST-VVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSF-----DTSGDRIITGSFD--HTVVVWDASTGRKVHTLIGHCAEISSALFNWDCS--LILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEG--------HEGEI------------SKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLE 384          

HSP 2 Score: 77.411 bits (189), Expect = 1.965e-14
Identity = 65/238 (27.31%), Postives = 105/238 (44.12%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDG 1666
            + FR    EI  ++FN     +A GS  D    ++  ++   +    GH   +++ L +   G +++TG  +  V  W  S GR   T   H   ++  +F       + + S+D T   +D T  K   TLT  +     +C   DY G+L+A        +A V+   TRK +  L  HE  +  I +  N  G  L+TGS DKT RIW        +V+  +T ++ + AF   G
Sbjct:  171 HTFRGHTAEIVCLSFNPQSTVVATGSM-DTTAKLWDIQNGEEVVTLTGHLAEIIS-LSFDTSGDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALF-NWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCF--DYTGKLIATASADG--TARVYNATTRKCVTKLEGHEGEISKISF--NPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKG 399          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 71.2478 bits (173), Expect = 1.279e-12
Identity = 69/285 (24.21%), Postives = 126/285 (44.21%), Query Frame = 2
Query: 1085 FQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLA-VAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            F   GH ++ V+ + +SP+G  L +   +  +K W   +G+   T S H   ++ V +       + S+S D T+  +D++  K  C  T +  S    C   + +  L+ +G   +  S  +W VKT K +  L  H  PV ++ +  N  G  +V+ S+D   RIW   SG     +I + +  ++ V F P+G  I  A L+  L  +D   G  +K   G        H  E   +       NF        GK +++G     + +++++ K ++++ Q
Sbjct:   39 FTLAGHTKA-VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS-NLLVSASDDKTLKIWDVSSGK--CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDE--SVRIWDVKTGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG--------HKNEKYCIF-----ANFSV----TGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 55.4546 bits (132), Expect = 1.343e-7
Identity = 56/241 (23.24%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVS-GIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGN 1699
            I  +A++   N + + + +D  L ++   S   +   KGH  + V C +++P    +V+G  + +V+ W +  G+C  T   HS PV+ V F +     + SSS DG    +D    +   TL  ++     + V     G+ + A    +     +W     K +     H+     I    +V+ G ++V+GS D  + IW        + +   +D V++ A  P    IA A L  +
Sbjct:   90 ISDVAWSSDSN-LLVSASDDKTLKIWDVSSGKCLKTLKGH-SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLK--LWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALEND 324          
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q15269|PWP2_HUMAN (Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 2.030e-142
Identity = 202/524 (38.55%), Postives = 302/524 (57.63%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLS--PESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF TF+ HS  VTGV F       V +SS+DGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE P+  + +  N     L + SWDKT+R+W  F    T E +  TSD LAV FRPDG E+A A LN  + F+D     Q   IEG+HDL   + + + ++    ++ K F A+CYSADG  +LAGG SK++C+Y + +++L+KRF+ISCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA T+EG++++S          +   + F  F+LD S  P  +R  L ++ ++RA+  AL+L +  L+ E +E++P  E   +   L    V   L  +L    + S ++ FY  W   +L+
Sbjct:  323 IHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATG-YVVVTSSMDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDASGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPISGLCF--NPMKSVLASASWDKTVRLWDMFDSWRTKETLALTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYS----------LDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVL-EFLASSFEVSRHLEFYLLWTHKLLM 828          

HSP 2 Score: 192.2 bits (487), Expect = 2.030e-142
Identity = 104/323 (32.20%), Postives = 177/323 (54.80%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEX----------XXXXXXXXXXTYLKSKNL-----------------YYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGNS++SPVGN ++V  LK ++  T+ + + YN++ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DS+ F VGS D ST V+ A + + LI Y+LGG++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +             + +  +  T ++ K                   Y+ N + D      +T A F+   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREEEEEEEEDQEGDRETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFN---NLTAAAFHKKSHLLVTGFASGIFHLHELPEF 320          
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q5RFQ3|PWP2_PONAB (Periodic tryptophan protein 2 homolog OS=Pongo abelii OX=9601 GN=PWP2 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 2.152e-142
Identity = 200/524 (38.17%), Postives = 301/524 (57.44%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLD--LSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF TF+ HS  VTGV F       V +SS+DGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE P+  + +  N     L + SWDKT R+W  F    T E +  TSD LAV FRPDG E+A A LN  + F+D     Q   IEG+H L   + + + ++    ++ K F  +CYSADG+ +LAGG SK++C+Y + +++L+KRF+ISCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA T+EG+++FS          +   + F  F+LD  ++P  +R  L ++ ++RA+  AL+L +  L+ E +E++P  E   +   L    V   L  +L    + S ++ FY  W   +L+
Sbjct:  320 IHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATG-YVVVTSSMDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDASGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPISGLCF--NPMKSILASASWDKTERLWDMFDSWRTKETLALTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHHLKTGRKELDKITAKHAAKGKAFTTLCYSADGQSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIFS----------LDTRVLFDPFELDTSITPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPSGEIEVVTSSLPELYVEKVL-EFLASSFEVSRHLEFYLLWTHRLLM 825          

HSP 2 Score: 196.052 bits (497), Expect = 2.152e-142
Identity = 102/317 (32.18%), Postives = 177/317 (55.84%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQT----DKQLQIE-----------------VTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGNS++SPVGN ++V  LK ++  T+ + + YN++ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DS+ F VGS D ST V+ A + + LI Y+LGG++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +  + ++ +        +    R   T    +K  +++                 +T A F+   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREQEEEEEEGDRETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSHLLVTGFASGIFHLHELPEF 317          
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q8BU03|PWP2_MOUSE (Periodic tryptophan protein 2 homolog OS=Mus musculus OX=10090 GN=Pwp2 PE=1 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 5.707e-141
Identity = 204/524 (38.93%), Postives = 305/524 (58.21%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW-QFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLS--PESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  + ++A N  G+WIA G     QL V+ W+S+SY+ + +GH  S+V  L YSPDG  +VTGG +G VK W   +G CF T + HS  VTGV F       + +SSLDGTV  +DL R +NF T T+  R  QF+CVA D  GE+V+AG   D F   VW ++T +L+ +L  HE PV  + +  N     L + SWDKT+R+W  F    T E +T TSD LAV FRPDG E+A A LN  + F+D     QV  IEG+HDL   + + + ++    ++ K F  +CYSADG+ +LAGG SK++CLY + +++L+KRF++SCN+SLD + E  +RRK+TE+G + A+ID    +        PG      S R  K ++ VTS++FSPTG  +AA ++EG+++FS          +   + F  F+LD S  P  IR  L +R+++RA+  A +L +  L  E +E++P  E   +   L    V V +  +L    +ES ++ FY  W + +L+
Sbjct:  323 IHSLSISDQRVASVAINSSGDWIAFGCSGMGQLLVWEWQSESYVLKQQGHFNSMV-ALAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTLTEHSSGVTGVTFTTTG-HVIVTSSLDGTVRAFDLHRYRNFRTFTSP-RPTQFSCVAVDSSGEIVSAGA-QDSFEIFVWSMQTGRLLDVLSGHEGPVSGLCF--NPMKSILASASWDKTVRLWDMFDSWRTKETLTLTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQVGSIEGRHDLKTGRKELDKITAKHSAKGKAFTTLCYSADGQSILAGGMSKFVCLYHVREQILVKRFELSCNLSLDAMEEFLNRRKMTEFG-NLALIDQDAGEENGVAVPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATSTEGLLIFS----------LDAQMLFDPFELDTSVTPGRIREALRQREFTRAILMAFRLNEKKLAQEALEAVPQNEIEVVSTSLPELYV-VKVLEFLAASFEESRHLEFYLIWTQKLLM 828          

HSP 2 Score: 190.66 bits (483), Expect = 5.707e-141
Identity = 104/323 (32.20%), Postives = 175/323 (54.18%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEX----------XXXXXXXXXXTYLKSKNL-----------------YYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGNS++SPVGN ++V  LK +   T+ + + YNI+ + +SP   L + ++E G A +VS++   V++H +F+  V+ VSFSP+G+ F + +G +  +Y+AP  ++      L +TY G   +   IDW+ DSK F VGS D ST V+ A + + LI Y+L G++  ++ C F  NSLD++S+S++  LC W+C+   E L    P   +              ++  +  T ++ K                   Y+ N + D      +T A ++   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYRFSNLLGTVYRCGNLNFTHDGNSVISPVGNRVTVFDLKNNRSNTLPLATKYNIKCVGLSPDGRLAIIVDEGGAALLVSLVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSKCFVVGSKDMSTWVFGAERWDNLIYYALSGHKDAIVACFFESNSLDLYSLSQDGALCVWQCDTPPEGLRLKAPRGWKADILQREKEEEEEDEEEGDRETTIRGKTTPAEQERVGKVKYSRLAKYFLNKEGDFN---NLTSAAYHKKTHLLVTGFASGIFHLHELPEF 320          
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9C1X1|PWP2_SCHPO (Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.04c PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.584e-125
Identity = 194/524 (37.02%), Postives = 303/524 (57.82%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAI------IDMSDK--KITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            +Y   + +  I T+  N  G+WIAIGS +  QL V+ W+S+SY+ + + H  +L + L YS DG +++TG  +G +K W +++G C  TF+ H+  V+G+ F K +   +FSSSLDG+V  +DL R +NF T TA  R  QF+C+A D  GE+V AG   D F   +W V+T +L+  L  HE PV S+ +  + S   L +GSWDKT+RIW  FS     E +   SDVL++AF PDG E+  A L+G L F++   G Q   I+G+ DL   +   +  +    S  K F +ICYSADG  +L+ G SKY+CLY I   +L+K+FQ+S N SL G+ E+ + RK+TE G  + I       D+ D+  +  PGA     S R+ + +++   ++FSP+G  FAAAT+EG+M++S    F        + D     +D++P +     AE ++  +L  AL+L +  ++ +V ESIPI +   +V++L ++ +      YL+    E+ ++ F+  W+K VL 
Sbjct:  289 LYQLSITQSNIDTLTVNSTGDWIAIGSSKLGQLLVWEWQSESYVLKQQSHYDAL-STLQYSSDGQRIITGADDGKIKVWDMNSGFCIVTFTQHTSAVSGLCFSK-RGNVLFSSSLDGSVRAWDLIRYRNFRTFTAPSR-VQFSCIAVDPSGEIVCAGS-QDSFEIFMWSVQTGQLLETLAGHEGPVSSLSFNSSGS--LLASGSWDKTVRIWDIFSRSGIVEPLPIPSDVLSLAFHPDGKEVCVASLDGQLTFWNVQEGKQTSLIDGRKDLSGGRRFDDARTAENSSLNKTFTSICYSADGSCVLSAGTSKYVCLYDIITGVLIKKFQLSKNESLQGVQEMLNSRKMTEAGSIELIDTQGEESDLEDRIDRTLPGARRGDLSARKTRPEIICHGVQFSPSGGAFAAATTEGLMIYSLYNDF--------LFDPINLDMDITPSTTLTMCAEGEFLISLVMALRLNEYKVVQKVYESIPITDVEHVVQELPVSYLA-NFMGYLSSFAAETPHIEFHLRWMKSVLT 797          

HSP 2 Score: 164.851 bits (416), Expect = 1.584e-125
Identity = 104/308 (33.77%), Postives = 163/308 (52.92%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAP-SL-EKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCN---KSLEFLSND-EPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYL 924
            MK  + FS+++G+ +  G + F PDG SILSPVGN +SV  LK +   T    +  NI HIA+SP   L+L ++EEG   + + +   V+++ NF+  V  + FSPNGKFFA+  GKL+ V+  P SL E+      L R Y G   D+ SI WS+DS+ F   S D + R+++    E     +L G++  V+   F K+   +++VSK+  L  WK +   ++ E +  + E NKT   +          +K ++ + +N +        +  A F+   N LV GF  G   I+E+P F+  Y L
Sbjct:    1 MKTEFGFSNLVGTIFSKGNLVFTPDGFSILSPVGNRVSVYNLKDNTSYTFPFENHKNISHIALSPTSTLLLSVDEEGRCILCNFLRRSVLHYFNFKSPVGAIEFSPNGKFFAVSLGKLIQVWRTPNSLEEREFAPFVLHREYTGHFDDIVSISWSADSRFFISTSKDLTARLHSVDPIEGFHPCALTGHKNTVVSGFFSKDQQTIYTVSKDGALFVWKYSPLFQAGEVIDEEAEENKTRTHIW--------LIKERHYFNQNSK--------LRCAAFHPTSNLLVVGFSSGLFGIYELPSFTMLYQL 292          
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9C270|PWP2_NEUCR (Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=B18D24.40 PE=3 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 2.298e-118
Identity = 195/526 (37.07%), Postives = 295/526 (56.08%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAI------IDMSDK--KITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDL--SPESIRRDL-AERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVL 2494
            ++   + + EI  +  N  G W+A G+ +  QL V+ W+S+SYI + +GH  S+ N L YSPDG ++VT   +G +K W   +G C  TF+ H+  +T   F K K   +F+SSLDG++  +DL R +NF T TA ER   F+C+A D  GE+VAAG   D F   +W V+T +L+  L  HE PV S+ +A N  G  LV+GSWD+T RIW  F+   TSE +   SDVL +AFRPD L+IA + L+GNL F+     +Q   ++G+ D+   +  G+  +   V+  K F  I YS DG  LLAGGNSKYICLYS+   +LLK++ +S N+S+ G  E  + + +TE G    +       D  D+  +  PG+     S R+   +V V  + FSP G+ F AA++EG++++S          +   I F  F L++  +P S    L  E+ Y +AL  A +L +  L+  V ++IP  +   +V+Q   N     L RY+  Q ++S +V F   W+K ++
Sbjct:  289 IHTLSISQNEIDFVTINKSGEWLAFGASKLGQLLVWEWQSESYILKQQGHFDSM-NSLVYSPDGQRIVTVADDGKIKVWDTESGFCIVTFTEHTSGITACEFSK-KGNVLFTSSLDGSIRAWDLIRYRNFRTFTAPER-LSFSCMAVDPSGEIVAAGS-VDSFDIHIWSVQTGQLLDRLSGHEGPVSSLAFAPN--GGLLVSGSWDRTARIWSIFNRTQTSEPLQLNSDVLDIAFRPDSLQIAISTLDGNLSFWSVSEAEQQAGLDGRRDVSGGRKIGDRRTAANVAGTKAFNTIRYSTDGSCLLAGGNSKYICLYSVTTMVLLKKYTVSVNLSIQGTQEFLNSKLLTEAGPQGLLDEQGEASDFEDRIDRSLPGSKRGDPSARRKNPEVRVNGVAFSPNGSAFCAASTEGLLIYS----------LDTTIQFDPFDLNMEITPTSTLAVLEKEKDYLKALVMAFRLNEAGLIQRVFQAIPYTDIPLVVEQFP-NVYVARLLRYVAAQTEQSPHVEFCLLWIKALV 797          

HSP 2 Score: 136.732 bits (343), Expect = 2.298e-118
Identity = 88/305 (28.85%), Postives = 152/305 (49.84%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQ-------RTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTV--ADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK +++FS+++G+ Y  G + F PDG  + SPVGN ++V  L  ++  T+  +   NI  I ++P+  L+L I+E+G A + ++    V+ H +F+  V  +SFSP+G+ F +G G+ + V++ PS         L+        T+     DVR I+WS DS+ F   S D + R+++  + E      L G+   V+   F K+   +++VSK+  +  W+           +P + E             +   +L +R +     +Q   TV  A F+   N LV GF +G   ++EMPDF
Sbjct:    1 MKTDFKFSNLLGTVYCQGNLLFSPDGTHLFSPVGNRVTVFNLVDNKSYTLPFSHRKNIARIGLTPQGNLLLSIDEDGQAILTNVPRRVVLYHFSFKAPVTALSFSPSGRHFIVGLGRKIEVWHVPSTPDANADGELEFAPFVKHHTHVQHFDDVRHIEWSHDSRFFLTSSKDLTARIWSVDQEEGFTPTVLSGHRQGVVGAWFSKDQETIYTVSKDGAVFDWQYVA--------KPGQDE-----------DMVDDDDLAWRIVNKHYFMQNSATVRCAAFHPESNLLVAGFSNGIFGLYEMPDF 286          
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Match: A0A419PG01 (Periodic tryptophan protein 2-like protein OS=Clonorchis sinensis OX=79923 GN=PWP2 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.817e-165
Identity = 221/540 (40.93%), Postives = 324/540 (60.00%), Query Frame = 2
Query:  965 RVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSG--IYLVTGSWDKTMRIWQFSGD-----------NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSK-HDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAI-IDMSDK---KITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS-----------GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLK-ESVNVGFYSNWLKIVL 2494
            ++ E  I T+  N  G WI   ++++ QL V+ W+SQ+   +++ H R + + L YSPDG+ LVTGG++  VK W+IS GR   TFS H+  VTGV FP  K + V S+SLDGTV  +DL R +NF TL+   R  QF C+A D  G LVAA GG D F   VW VKT  L+  L  H  PV S+ +  +V+G  I L + SWD T+R+W  +G+           +T EV+  + D L VA+R DG EIA +LLNG++VFYD   G +   I GKHDLG ++  + +L++  + ++ + FQ I YSADG+ LLAGG+SKY+CLYSI  ++LLKRF+++CN+SLDG+ E+HDRR+      ++A+ + +S      I      V  S RQ + ++ V+S++F+PTG  FAA T+EGV+V+S              V     Y G + D        +PE+ R  L E K ++AL+ A++L+  +L+ EV+ESIP  +  F+ +QL I +V   +  +L RQL   S +V FY++W   +L
Sbjct:  293 KLFEHAITTLIINRSGEWIGAATEDNGQLTVWEWRSQTCHLKAQSHARQMTS-LAYSPDGLHLVTGGQDAKVKVWRISGGRAVVTFSEHTAAVTGVAFPASKAKVVISASLDGTVRAHDLVRYRNFRTLSVPTRQVQFACLAVDAPGSLVAA-GGLDSFETFVWSVKTGVLLTSLTGHTAPVSSLAFNPDVAGYSIELASVSWDGTLRLWDLTGNSGDEHNPSSVGSTKEVVHFSHDALCVAYRGDGKEIAISLLNGDVVFYDPNEGTEKGAINGKHDLGVAQTTEADLVTPKRSAQARKFQTIAYSADGEHLLAGGDSKYVCLYSIPDRVLLKRFEVTCNLSLDGVQEVHDRRRFLAQYSTEAMHVKLSQNVSLPIPTSRAGVDRSSRQWRPEIHVSSVQFAPTGDAFAATTTEGVLVYSLASACTGFGFGDHSVLDRATYGGWLFDAVGLDETTTPENARLALVEGKQAQALDIAIRLRLHELVKEVMESIPSNQIDFLARQLPIRQVVDFVIPFLARQLSGHSRHVEFYTHWTDSIL 830          

HSP 2 Score: 225.328 bits (573), Expect = 1.817e-165
Identity = 116/297 (39.06%), Postives = 176/297 (59.26%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQ-IEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            M+ N++FS++ G+SY+ G I F  +G  +LSPVGN I+V  L+ DE  T+EV S +NI+H+A+SP   +++ +N+ G A+I+S+++G V++ +  +  V  +SFSP+GKF AI +G  VM+++AP  ++    L L R Y G   DV SIDWS+DS  F  G  DNS RV++  + +KL+IY+L G+   V+   FM NSLDV +VS + +LC W  N  L  +  D+    E             L   N  YR   + +      VT   F+  +  LVTGF  G++M+H +PDF
Sbjct:    1 MRLNFKFSNLFGTSYKCGNILFTSNGRGLLSPVGNQINVYDLQTDESTTLEVKSFFNIRHMALSPSVSMLVAVNDAGEASIISLMSGSVVSVYPLKHPVTALSFSPDGKFLAIAKGHCVMLFFAPGCQRQFNHLELYRVYYGFLDDVTSIDWSTDSCVFLAGCSDNSCRVFSVHRLKKLVIYTLSGHRNPVVGGFFMHNSLDVITVSTDGELCVWDANYKLNEVEFDDTATKEKV-----------LFRLNKRYRYASSAEGCSNALVTAVSFHKQLRMLVTGFDSGHLMLHTIPDF 286          
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Match: A0A4S2LZY5 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005055 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.431e-165
Identity = 223/540 (41.30%), Postives = 324/540 (60.00%), Query Frame = 2
Query:  965 RVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSG--IYLVTGSWDKTMRIWQFSGD-----------NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSK-HDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKIT---PGA-VDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS-----------GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLK-ESVNVGFYSNWLKIVL 2494
            ++ E  I T+  N  G WI   ++++ QL V+ W+SQ+   +++ H R + + L YSPDG+ LVTGG++  VK W+IS GR   TFS H+  VTGV FP  K + V SSSLDGTV  +DL R +NF TL+   R  QF C+A D  G LVAA GG D F   VW VKT  L+  L  H  PV S+ +  +V+G  I L + SWD T+R+W  +G+           NT EV+  + D L VA+R DG EIA + LNG++VFYD   G +   I GKHDLG ++  + +L++  + ++ + FQ I YSADG+ LLAGG+SKY+CLYSI  ++LLKRF+++CN+SLDG+ E+HDRR+      ++A+     + I+   P +   V  S RQ + ++ V+S++F+PTG  FAA T+EGV+V+S              V     Y G + D        +PE+ R  LAE K ++AL+ A++L+  +L+ EV+ESIP  +  F+ +QL   +V   +  +L RQL   S +V FY++W   VL
Sbjct:  293 KLFEHAITTLTINRSGEWIGAATEDNGQLTVWEWRSQTCHLKAQSHARQMTS-LAYSPDGLHLVTGGQDAMVKVWRISGGRAVVTFSEHTAAVTGVTFPASKAKVVISSSLDGTVRAHDLVRYRNFRTLSVPTRQVQFACLAVDAPGSLVAA-GGLDSFETFVWSVKTGVLLTALTGHTAPVSSLAFNPDVAGYSIELASVSWDGTLRLWDLTGNSGDEHNPSSVGNTKEVVHFSHDALCVAYRGDGKEIAISFLNGDVVFYDPSEGTEKGAINGKHDLGVAQTTEADLVTPKRSAQARKFQTIAYSADGEHLLAGGDSKYVCLYSIPDRVLLKRFEVTCNLSLDGVQEVHDRRRFLAQYSTEAVHAKLSQNISLPIPTSRAGVDRSSRQWRPEIHVSSVQFAPTGDAFAATTTEGVLVYSLASVCTGFGFGDHSVLDRATYGGWLFDAVGLDETATPENARLALAEGKQAQALDIAIRLRLHELVKEVMESIPSNQIDFLARQLPTRQVVEFVIPFLARQLSGHSRHVEFYTHWTDSVL 830          

HSP 2 Score: 223.016 bits (567), Expect = 2.431e-165
Identity = 114/302 (37.75%), Postives = 178/302 (58.94%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQ------TDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            M+ N++FS++ G++Y+ G I F  +G  +LSPVGN I+V  L+ DE  T++V S +NI+H+A+SP   +++ +N+ G A+I+S+I+G V++ +  +  V  +SFSP+GKF AI +G  VM+++AP  ++    L L R Y G   DV SIDWS+DS  F  G  DNS RV++  + +KL++Y+L G+   V+   FM NSLDV +VS + +LC W  N  L  +  D+                T  K K L+  N +       +  L   VT   F+  +  L+TGF  G++M+H +PDF
Sbjct:    1 MRLNFKFSNLFGTAYKCGNILFTSNGCGLLSPVGNQINVYDLQTDESTTLDVKSFFNIRHMALSPSVSMLVAVNDAGEASIISLISGSVVSVYPLKHPVTALSFSPDGKFLAIAKGHCVMLFFAPGCQRQFNHLELYRVYYGFLDDVTSIDWSTDSCVFLAGCSDNSCRVFSVHRLKKLVVYTLSGHRNPVVGGFFMHNSLDVITVSTDGELCVWDANYKLNEVEFDD----------------TATKGKVLFRLNKRYRYASSAEGCLNALVTAVSFHKQLRMLITGFDSGHLMLHTIPDF 286          
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Match: A0A4S2LU61 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005055 PE=4 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.420e-165
Identity = 223/540 (41.30%), Postives = 324/540 (60.00%), Query Frame = 2
Query:  965 RVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSG--IYLVTGSWDKTMRIWQFSGD-----------NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSK-HDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKIT---PGA-VDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS-----------GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLK-ESVNVGFYSNWLKIVL 2494
            ++ E  I T+  N  G WI   ++++ QL V+ W+SQ+   +++ H R + + L YSPDG+ LVTGG++  VK W+IS GR   TFS H+  VTGV FP  K + V SSSLDGTV  +DL R +NF TL+   R  QF C+A D  G LVAA GG D F   VW VKT  L+  L  H  PV S+ +  +V+G  I L + SWD T+R+W  +G+           NT EV+  + D L VA+R DG EIA + LNG++VFYD   G +   I GKHDLG ++  + +L++  + ++ + FQ I YSADG+ LLAGG+SKY+CLYSI  ++LLKRF+++CN+SLDG+ E+HDRR+      ++A+     + I+   P +   V  S RQ + ++ V+S++F+PTG  FAA T+EGV+V+S              V     Y G + D        +PE+ R  LAE K ++AL+ A++L+  +L+ EV+ESIP  +  F+ +QL   +V   +  +L RQL   S +V FY++W   VL
Sbjct:  293 KLFEHAITTLTINRSGEWIGAATEDNGQLTVWEWRSQTCHLKAQSHARQMTS-LAYSPDGLHLVTGGQDAMVKVWRISGGRAVVTFSEHTAAVTGVTFPASKAKVVISSSLDGTVRAHDLVRYRNFRTLSVPTRQVQFACLAVDAPGSLVAA-GGLDSFETFVWSVKTGVLLTALTGHTAPVSSLAFNPDVAGYSIELASVSWDGTLRLWDLTGNSGDEHNPSSVGNTKEVVHFSHDALCVAYRGDGKEIAISFLNGDVVFYDPSEGTEKGAINGKHDLGVAQTTEADLVTPKRSAQARKFQTIAYSADGEHLLAGGDSKYVCLYSIPDRVLLKRFEVTCNLSLDGVQEVHDRRRFLAQYSTEAVHAKLSQNISLPIPTSRAGVDRSSRQWRPEIHVSSVQFAPTGDAFAATTTEGVLVYSLASVCTGFGFGDHSVLDRATYGGWLFDAVGLDETATPENARLALAEGKQAQALDIAIRLRLHELVKEVMESIPSNQIDFLARQLPTRQVVEFVIPFLARQLSGHSRHVEFYTHWTDSVL 830          

HSP 2 Score: 222.631 bits (566), Expect = 3.420e-165
Identity = 114/302 (37.75%), Postives = 178/302 (58.94%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQ------TDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            M+ N++FS++ G++Y+ G I F  +G  +LSPVGN I+V  L+ DE  T++V S +NI+H+A+SP   +++ +N+ G A+I+S+I+G V++ +  +  V  +SFSP+GKF AI +G  VM+++AP  ++    L L R Y G   DV SIDWS+DS  F  G  DNS RV++  + +KL++Y+L G+   V+   FM NSLDV +VS + +LC W  N  L  +  D+                T  K K L+  N +       +  L   VT   F+  +  L+TGF  G++M+H +PDF
Sbjct:    1 MRLNFKFSNLFGTAYKCGNILFTSNGCGLLSPVGNQINVYDLQTDESTTLDVKSFFNIRHMALSPSVSMLVAVNDAGEASIISLISGSVVSVYPLKHPVTALSFSPDGKFLAIAKGHCVMLFFAPGCQRQFNHLELYRVYYGFLDDVTSIDWSTDSCVFLAGCSDNSCRVFSVHRLKKLVVYTLSGHRNPVVGGFFMHNSLDVITVSTDGELCVWDANYKLNEVEFDD----------------TATKGKVLFRLNKRYRYASSAEGCLNALVTAVSFHKQLRMLITGFDSGHLMLHTIPDF 286          
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Match: A0A075A1P6 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00780 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 9.922e-165
Identity = 222/540 (41.11%), Postives = 323/540 (59.81%), Query Frame = 2
Query:  965 RVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSG--IYLVTGSWDKTMRIWQFSGD-----------NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSK-HDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAI-IDMSDK---KITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS-----------GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLK-ESVNVGFYSNWLKIVL 2494
            ++ E  I T+  N  G WI   ++++ QL V+ W+SQ+   +++ H R + + L YSPDG+ LVTGG++  VK W+IS GR   TFS H+  VTGV FP  K + V S+SLDGTV  +DL R +NF TL+   R  QF C+A D  G LVAA GG D F   VW VKT  L+  L  H  PV S+ +  +V+G  I L + SWD T+R+W  +G+           NT EV+  + D L VA+R DG EIA +LLNG++VFYD   G +   I GKHDLG ++  + +L++  + ++ + FQ I YSADG+ LLAGG+SKY+CLYSI  ++LLKRF+++CN+SLDG+ E+HDRR+      ++A+   +S      I      V  S RQ + ++ V+S++F+PTG  FAA T+EGV+V+S              V     Y G + D        +PE+ R  LAE K ++AL+ A++L+  +L+ EV+ESIP  +  F+ +QL   +V   +  +L RQL   S +V FY++W   +L
Sbjct:  383 KLFEHAITTLTINRSGEWIGAATEDNGQLTVWEWRSQTCHLKAQSHARQMTS-LAYSPDGLHLVTGGQDAKVKVWRISGGRAVVTFSEHTAAVTGVAFPASKAKVVISASLDGTVRAHDLVRYRNFRTLSVPTRQVQFACLAVDAPGSLVAA-GGLDSFETFVWSVKTGVLLTTLTGHTAPVSSLAFNPDVAGYSIELASVSWDGTLRLWDLTGNSADEHNPSSVGNTKEVVHFSHDALCVAYRSDGKEIAISLLNGDVVFYDPNEGTEKGAINGKHDLGVAQTTEADLVTPKRSAQARKFQTIAYSADGEHLLAGGDSKYVCLYSIPDRVLLKRFEVTCNLSLDGVQEVHDRRRFLAQYSTEAMHAKLSQNVSLPIPTSRAGVDRSSRQWRPEIHVSSVQFAPTGDAFAATTTEGVLVYSLASVCTGFGFGDHSVLDRAAYGGWLFDAVGLDETATPENARLALAEGKQAQALDIAIRLRLHELVQEVMESIPSNQIDFLARQLPTRQVVDFVIPFLARQLSGHSRHVEFYTHWTDSIL 920          

HSP 2 Score: 221.09 bits (562), Expect = 9.922e-165
Identity = 113/293 (38.57%), Postives = 176/293 (60.07%), Query Frame = 1
Query:   28 NYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            ++ FS++ G++Y+ G I F  +G  +LSPVGN I+V  L+ DE  T+EV S +NI+H+A+SP   +++ +N+ G A+I+S+I+G V++ +  +  V  +SFSP+GKF AI +G  VM+++AP  ++    L L R Y G   DV SIDWS+DS  F  G  DNS RV++  + +KL+IY+L G+   V+   FM+NSLDV ++S + +LC W  N  L        N+ E       + V+  L  +  Y  +   +  L   VT   F+  +  LVTGF  G++M+H +PDF
Sbjct:   94 DFWFSNLFGTAYKCGNILFTSNGRGLLSPVGNQINVYDLQTDESTTLEVKSFFNIRHMALSPSVSMLVAVNDAGEASIISLISGSVVSVYPLKHPVTALSFSPDGKFLAIAKGHCVMLFFAPGCQRQFNHLELYRVYYGFLDDVTSIDWSTDSCVFLAGCSDNSCRVFSVHRLKKLVIYTLSGHRNPVVGGFFMQNSLDVITISTDGELCVWDANYKL--------NEVEFGDTATKEKVLFRLNKRYRYASS--AEGCLNALVTAVSFHKQLRLLVTGFDSGHLMLHTIPDF 376          
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Match: A0A4E0RAB1 (WD40-repeat-containing subunit of the 18S rRNA processing complex OS=Fasciola hepatica OX=6192 GN=D915_003791 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 1.686e-159
Identity = 212/529 (40.08%), Postives = 314/529 (59.36%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSG--IYLVTGSWDKTMRIWQFSGD-----------NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSK-HDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAI----IDMSDKKITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKV---FRSIDYIG------GVIDFSQFQLD--LSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQL-KESVNVGFYSNW 2479
            + T+  N  G+WIA GS E  QL V+ W+SQ+   +++ H R + + L YSPDG+ LVTGG +  VK W++++GR   TFS+H+  VTGV FP  K + V S+SLDGTV  +DL R +NF T T   R  QF  +A D  G L AA G  D F A +W ++T  L+ +L  H  P+ +I +  ++SG  + + + SWDKT+R+W  +G+           N  EV+    DVL VA+R DG E+A ALLNG++VFYD + G +   I G+ DLG S+  + +L++  + ++ K FQ I YSADG+ LLA G+SKYICLYS+  ++LLKRF+++CNMSL G+ E+HDRR+      SDA+    ++ +   I         S RQ + D+ V+SI+FSPTG  FAA T+EGV+V+S       F    + G      G   F    LD   +P++ R  LA+ +Y  AL+  ++L+  D+  EV+E IP  +  ++ +Q  +++V   L  ++ RQL   S +V FY +W
Sbjct:  299 VTTLTVNISGSWIAAGSDEHGQLTVWEWRSQACYLKAESHARHMTS-LAYSPDGLHLVTGGHDAKVKVWRVASGRTLVTFSDHTAAVTGVAFPASKAKVVVSASLDGTVRAHDLVRYRNFRTFTVPTRQVQFASLAVDGPGSL-AAAGSLDTFEAFIWSMQTGILLTVLSGHTAPISAITFNPDISGYALEMASVSWDKTLRLWNLAGNTADEHNPSSLGNVKEVVNFAHDVLCVAYRGDGKELALALLNGDIVFYDPVEGTEKGAISGQRDLGVSQTTEQDLVTPKRSAQAKRFQTIAYSADGEHLLAAGDSKYICLYSVPDRVLLKRFEVTCNMSLGGVQEVHDRRRFLATYGSDAVQARTLEKTSLPIPASRHGEDRSSRQWRPDIRVSSIQFSPTGDAFAATTTEGVLVYSLASAGSGFGVSSHFGYSQDQPGTWLFESVGLDEQCTPQNARAALADARYGEALDIIVRLRLHDVAEEVLEGIPSDQIDYLARQCPVHQVAQFLFPFIARQLGGRSRHVEFYIHW 825          

HSP 2 Score: 220.705 bits (561), Expect = 1.686e-159
Identity = 111/297 (37.37%), Postives = 175/297 (58.92%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFS 909
            M+ N++FS++ G++Y+ G + F  +GN +LSPVGN I+V  LKRDE  T+E+ S ++I HIA+SP   +++ INE G A++VS+I+G VI+ +  R  V   SFSP+GKF AI +G  V++++AP  ++    L + R   G + DV SIDW+SDSK FA G  DN+ R+++  K + L++Y L  ++  +I   F K+S+D+ SVS + ++C W+    LE L     N  E              K    +     T+   Q  +T   F+  +  LV+GF  G +M+H MP+F+
Sbjct:    1 MRLNFRFSNLFGTAYKKGNVIFTSNGNGLLSPVGNQITVFDLKRDESTTLEIKSFHDITHIAISPSLAMLIAINEIGEASLVSLISGAVISVYPLRHPVTVASFSPDGKFVAISKGHCVILFHAPCDKRLFNHLEIYRVCYGFTDDVTSIDWTSDSKVFAAGCADNTCRIFSVHKLKNLVVYGLSMHKNPIIGAFFYKDSMDLLSVSSDGEVCSWEATVRLEDLEAASQNDQE----------KVLFKLMKRHRHIPTTETGAQALITAVAFHKTLRLLVSGFDSGILMLHTMPEFT 287          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Match: pwp2h (PWP2, small subunit processome component [Source:NCBI gene;Acc:103032036])

HSP 1 Score: 337.806 bits (865), Expect = 2.067e-101
Identity = 194/522 (37.16%), Postives = 308/522 (59.00%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGD-NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I  I  N  G+WI  G     QL V+ W+S+SY+F+ +GH  ++ + L YSPDG  L TGG +G VK W  ++G CF TF+ H+  VT V F       V S+S+DGTV  +DL R +NF T+T+  R  QF+ +A D  GELV AG   D F   +W ++T +L+ +L  HE PV  + ++   S   L + SWDKT+R+W+      T E++  TSD L V +RPDG E+A A L+G + F++     Q   I G+HDL   + + + ++  + ++ K F ++CYSADG+ LLAGG SK++C+Y+I++++L+K+F+ISCNMSLD + E  DRRK+TE+G S A++D             PG      S R  K ++ VTS++FSPTG  +AAA++EG++++S +           V D     +D++P SIRR L +++++ A+  A +L +  L++EV+E++P  + A +   L    V   L  ++   L++S ++ FY  W + +L 
Sbjct:  339 IHSLSISDQRISAIVMNPTGDWIGFGCSGLGQLLVWEWQSESYVFKQQGHFNNMAS-LAYSPDGQYLATGGDDGKVKVWNTTSGLCFVTFTEHTSSVTNVTFTNSG-FVVVSASMDGTVRAFDLHRYRNFRTMTSP-RPTQFSSLAVDVSGELVCAGA-QDSFEIFLWSMQTGRLLEVLSGHEGPVSCLCFSPVQS--VLASASWDKTVRLWEMLDSWQTREILRLTSDGLTVTYRPDGQELAVATLDGEITFWNPQEATQTGSIIGRHDLQMGRKETDKITAKQSAKGKAFTSLCYSADGESLLAGGRSKFVCIYNIKEQILMKKFEISCNMSLDAMEEFLDRRKMTEFG-SLALVDEGAGDGDGVHLTLPGVKRGDMSSRHFKPEIRVTSLRFSPTGRSWAAASTEGLLIYSLDASL--------VFDPYDLDMDITPTSIRRQLKKKEWASAIVLAFRLNETSLISEVLEAVPYDQVAVVSSSLPDVYVE-KLLNFVASSLEKSRHLQFYLTWAQNLLT 844          

HSP 2 Score: 192.586 bits (488), Expect = 2.434e-50
Identity = 90/224 (40.18%), Postives = 149/224 (66.52%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFL 690
            MK +Y+FS+++G+ Y++G + F  DGNS++SPVGN +SV  LK ++ +T+ V+++ NI  + +SP   L + ++E+G A +VS++T  V+ HH+F + V+ VSFSP+G+ F + +  +V++Y+AP   +      L ++Y G   +   IDW+ DSK FAVGS D ST ++ A +   LI YSLGG+   ++ C F K+SLD+++VS++  LC W+ +  LE L
Sbjct:    1 MKFSYKFSNLLGAVYRHGNLSFSKDGNSVISPVGNRVSVFDLKNNKSETLPVSTNKNITSVGLSPDGNLAILVDEDGAAVLVSLVTRAVLYHHHFHKPVHSVSFSPDGRKFVVTKENVVLMYHAPGKNREFNAFVLDKSYYGPYDETTCIDWTDDSKCFAVGSKDMSTWIFGAERWANLIYYSLGGHRDIIVGCFFEKDSLDLYTVSQDGTLCVWESDAELEDL 224          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Match: pwp2h (PWP2, small subunit processome component [Source:NCBI gene;Acc:103032036])

HSP 1 Score: 337.806 bits (865), Expect = 2.968e-101
Identity = 194/522 (37.16%), Postives = 308/522 (59.00%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGD-NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKK------ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLV 2497
            ++   + +  I  I  N  G+WI  G     QL V+ W+S+SY+F+ +GH  ++ + L YSPDG  L TGG +G VK W  ++G CF TF+ H+  VT V F       V S+S+DGTV  +DL R +NF T+T+  R  QF+ +A D  GELV AG   D F   +W ++T +L+ +L  HE PV  + ++   S   L + SWDKT+R+W+      T E++  TSD L V +RPDG E+A A L+G + F++     Q   I G+HDL   + + + ++  + ++ K F ++CYSADG+ LLAGG SK++C+Y+I++++L+K+F+ISCNMSLD + E  DRRK+TE+G S A++D             PG      S R  K ++ VTS++FSPTG  +AAA++EG++++S +           V D     +D++P SIRR L +++++ A+  A +L +  L++EV+E++P  + A +   L    V   L  ++   L++S ++ FY  W + +L 
Sbjct:  351 IHSLSISDQRISAIVMNPTGDWIGFGCSGLGQLLVWEWQSESYVFKQQGHFNNMAS-LAYSPDGQYLATGGDDGKVKVWNTTSGLCFVTFTEHTSSVTNVTFTNSG-FVVVSASMDGTVRAFDLHRYRNFRTMTSP-RPTQFSSLAVDVSGELVCAGA-QDSFEIFLWSMQTGRLLEVLSGHEGPVSCLCFSPVQS--VLASASWDKTVRLWEMLDSWQTREILRLTSDGLTVTYRPDGQELAVATLDGEITFWNPQEATQTGSIIGRHDLQMGRKETDKITAKQSAKGKAFTSLCYSADGESLLAGGRSKFVCIYNIKEQILMKKFEISCNMSLDAMEEFLDRRKMTEFG-SLALVDEGAGDGDGVHLTLPGVKRGDMSSRHFKPEIRVTSLRFSPTGRSWAAASTEGLLIYSLDASL--------VFDPYDLDMDITPTSIRRQLKKKEWASAIVLAFRLNETSLISEVLEAVPYDQVAVVSSSLPDVYVE-KLLNFVASSLEKSRHLQFYLTWAQNLLT 856          

HSP 2 Score: 188.734 bits (478), Expect = 6.074e-49
Identity = 88/219 (40.18%), Postives = 145/219 (66.21%), Query Frame = 1
Query:   34 QFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFL 690
            QFS+++G+ Y++G + F  DGNS++SPVGN +SV  LK ++ +T+ V+++ NI  + +SP   L + ++E+G A +VS++T  V+ HH+F + V+ VSFSP+G+ F + +  +V++Y+AP   +      L ++Y G   +   IDW+ DSK FAVGS D ST ++ A +   LI YSLGG+   ++ C F K+SLD+++VS++  LC W+ +  LE L
Sbjct:   18 QFSNLLGAVYRHGNLSFSKDGNSVISPVGNRVSVFDLKNNKSETLPVSTNKNITSVGLSPDGNLAILVDEDGAAVLVSLVTRAVLYHHHFHKPVHSVSFSPDGRKFVVTKENVVLMYHAPGKNREFNAFVLDKSYYGPYDETTCIDWTDDSKCFAVGSKDMSTWIFGAERWANLIYYSLGGHRDIIVGCFFEKDSLDLYTVSQDGTLCVWESDAELEDL 236          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:103035445])

HSP 1 Score: 88.1965 bits (217), Expect = 6.180e-18
Identity = 85/321 (26.48%), Postives = 137/321 (42.68%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTL---TAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            +  +AFN  G+    GS  D    ++   S + +   +GHK  +      +P G ++ TG  +   + W +  G+CF TF  H+  +  + F  Q    V + S+D TV  +D+       TL   +AE  S  F  V S     LV    G+   +  VW V + +L++ L  H   + S+ +  N     +VT S DKT ++W   G      +T  +D VL V F   G  IA A  +G    YDA T   V ++EG        H+GE+              +C++  G  +L G   K   ++S+     L+  +
Sbjct:   95 LTNVAFNKSGSSFITGSY-DRTCKIWDTASGTELHTLEGHKNVVYAVAFNNPYGDKIATGSFDKTCRLWSVETGQCFYTFRGHTAEIVCLAFNPQS-TLVATGSMDTTVKLWDVESGVEVSTLSGHSAEIISLSFNTVGS----RLVT---GSFDHTVSVWDVPSGRLVHNLKGHRGEISSVNF--NWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCFNFKGQLIATASADGTSRVYDAQTFQFVCKLEG--------HEGEI------------SKVCFNPQGTCVLTGSADKTARVWSVSSGSCLQVLE 384          

HSP 2 Score: 78.5666 bits (192), Expect = 8.116e-15
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI +++FN +G+ +  GS  D+ ++V+   S   +   KGH R  ++ ++++ D   +VT   +   K W    GRC AT + H+  V  V F   K Q + ++S DGT   YD    +  C L   E      C   + +G  V  G      +A VW V +   + +L  H   + S   A N  G  ++TGS D T RIW+
Sbjct:  220 AEIISLSFNTVGSRLVTGSF-DHTVSVWDVPSGRLVHNLKGH-RGEISSVNFNWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCF-NFKGQLIATASADGTSRVYDAQTFQFVCKLEGHEGEISKVCF--NPQGTCVLTGSADK--TARVWSVSSGSCLQVLEGHTDEIFSC--AFNYYGDTIITGSKDNTCRIWR 415          

HSP 3 Score: 74.7146 bits (182), Expect = 1.429e-13
Identity = 63/236 (26.69%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQS--KGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAF 1654
            Y FR    EI  +AFN     +A GS +     V  W  +S +  S   GH   +++ L ++  G +LVTG  +  V  W + +GR       H G ++ V F       + ++S+D T   +D    +   TLT         C   ++KG+L+A        ++ V+  +T + +  L  HE  +  + +  N  G  ++TGS DKT R+W  S  +  +V+  +T ++ + AF
Sbjct:  171 YTFRGHTAEIVCLAFNPQSTLVATGSMD---TTVKLWDVESGVEVSTLSGHSAEIIS-LSFNTVGSRLVTGSFDHTVSVWDVPSGRLVHNLKGHRGEISSVNF-NWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCF--NFKGQLIATASADG--TSRVYDAQTFQFVCKLEGHEGEISKVCF--NPQGTCVLTGSADKTARVWSVSSGSCLQVLEGHTDEIFSCAF 395          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000035022.1 (WD repeat-containing protein 38 [Source:NCBI gene;Acc:103041500])

HSP 1 Score: 73.559 bits (179), Expect = 1.113e-13
Identity = 69/293 (23.55%), Postives = 127/293 (43.34%), Query Frame = 2
Query: 1079 YIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSL 1954
            Y  + KG     VNC  +SPD   L+T   +G +  W    G+  A    H+GPV   VF K       S+S D +V  + +T ++   TLT   RS +   V+    G+ + +GG  +  +AL+W  +T   +     H   V S  ++ +     L TGSWD T+++W    D  +  +  +  +V  + F   G+  +G+  +G +  +          +   H+  F         V+  +E+   + + +S DG  L +      + ++ +E    +K  ++  N++L
Sbjct:   16 YFSRHKGE----VNCCSFSPDCQILLTCSDDGGLYLWHAVRGKLLAKVCGHTGPVKCCVFSKDG-HFFASASHDCSVGIWSVTPIERLHTLTGHTRSVET--VSFSVDGKWLVSGGWDN--TALLWDTQTGIKVREFLGHSAAVQSSFFSTDSQ--LLATGSWDCTVKVWSLDCDEETVTLEGHQGNVACLCFSTTGMLASGS-WDGTVRVW----------LPKSHECVF---------VLGGTEQVWVRCVAFSRDGLTLASTAEGDTVKIWDMESGRCIKCLRVCDNIAL 277          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000041598.1 (WD repeat-containing protein 38 [Source:NCBI gene;Acc:103041500])

HSP 1 Score: 71.633 bits (174), Expect = 6.118e-13
Identity = 56/203 (27.59%), Postives = 93/203 (45.81%), Query Frame = 2
Query: 1079 YIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDGLEIAGA 1684
            Y  + KG     VNC  +SPD   L+T   +G +  W    G+  A    H+GPV   VF K       S+S D +V  + +T ++   TLT   RS +    + D  G+ + +GG  +  +AL+W  +T   +     H   V S  ++ +     L TGSWD T+++W    D  +  +  +  +V  + F   G+  +G+
Sbjct:   16 YFSRHKGE----VNCCSFSPDCQILLTCSDDGGLYLWHAVRGKLLAKVCGHTGPVKCCVFSKDG-HFFASASHDCSVGIWSVTPIERLHTLTGHTRSVETVSFSVD--GKWLVSGGWDN--TALLWDTQTGIKVREFLGHSAAVQSSFFSTDSQ--LLATGSWDCTVKVWSLDCDEETVTLEGHQGNVACLCFSTTGMLASGS 207          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006826.1 (pep scaffold:Pmarinus_7.0:GL480117:19454:28465:1 gene:ENSPMAG00000006164.1 transcript:ENSPMAT00000006826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 2.789e-55
Identity = 106/317 (33.44%), Postives = 176/317 (55.52%), Query Frame = 1
Query:   34 QFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQL--CFWKCNKSLEFL--------------------SNDEPNKT----EXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            QFS+++G+ Y+ G + F PDGNS++SPVGN I++  LK ++ +T+ V +  NI  + +S    L + I+EEG A +VSMI   V++H +F + V+ + FSP+G+ F + + K+ M+Y+AP L +      L +T+ G   +   IDW+ DS+ F+VGS D ST V+ A + + L+ Y+LGG+   ++ C F +NSLD++++S++A L  C W+C+  L  L                     + E  K        V+ +      + K K+ ++ N   D +    +T AD++     LV+ F  G   IHE+PDF
Sbjct:    5 QFSNLLGTVYRRGNLTFSPDGNSVVSPVGNRITLFDLKNNKSETLPVATRVNISCVGLSRDMSLAILIDEEGAAVLVSMIGKSVLHHFHFHKPVHSIKFSPDGRKFVVTKDKVAMLYHAPGLVREFNPFVLDKTFFGPYDETTCIDWTDDSRCFSVGSKDMSTWVFGAERWQNLVFYALGGHRDAIVACFFRQNSLDIYTLSRDAALCVCVWECDTPLTGLRPRAAKAPEEAAEEEREVPCGHGEGEKAGEVIHGKVETEVAQYKVHYKQKSKHFFNKDGDFKY---LTAADYHKATQILVSAFASGVFHIHELPDF 318          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001262.1 (pep scaffold:Pmarinus_7.0:GL482245:224:4916:1 gene:ENSPMAG00000001134.1 transcript:ENSPMAT00000001262.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 9.163e-52
Identity = 110/285 (38.60%), Postives = 177/285 (62.11%), Query Frame = 2
Query: 1637 VLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIID--MSDKKIT----PGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGV-ALCRYLTRQLKESVNVGFY 2470
             LAV FRPDG +IA A L+G++ F+D     Q   IEG+HDL   + D +L++    ++ K+F  +CYSADG+ +LAGG SK++C+Y+I++++L+K+F+ISCN SLD + +  DRRK+TE+G S A+ID  + D++ T    PG      S R  K +V VTS++F+PTG  +AA T+EG++V+S ++        G V D     +D++P+S+R+ L+   +S AL  + +L +  ++ EV+ESIP      + + L   EV V     ++   L+ S ++ FY
Sbjct:    1 ALAVVFRPDGKQIAVATLDGHISFWDPHQATQTGSIEGRHDLAMGRRDLDLVTAKHTAKGKSFTTLCYSADGESILAGGRSKFVCIYNIQEQILIKKFEISCNHSLDAMEQFLDRRKMTEFG-SLALIDEGVGDEEGTAISLPGVRRGDMSSRNFKPEVRVTSLQFAPTGQGWAATTTEGLLVYSLDR--------GLVFDPFDLDVDVTPQSVRKALSAGSFSTALILSFRLNEKQVIQEVLESIPHSHIEIVSRSL--AEVYVLKTLDFVAAMLESSCHLHFY 274          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 63.1586 bits (152), Expect = 3.594e-11
Identity = 45/166 (27.11%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 1097 GHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCG-YDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
            GH   +++ L  +PDG   V+G  + + K W + +G C  TFS H   +  + F        F++  D   C  +DL   +     + +      T VA    G L+ A  G D F+  VW     +   +L  H+  V  +   V   G+ + TGSWD  ++IW 
Sbjct:   94 GHSGDVMS-LALAPDGRAFVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNG--NAFATGSDDATCRLFDLRADQELVLYSHDNIICGITSVAFSRSGRLLLA--GYDDFNCNVWDAMKAERAGVLAGHDNRVSCL--GVTEDGMAVATGSWDSFLKIWN 252          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 63.929 bits (154), Expect = 5.595e-11
Identity = 52/205 (25.37%), Postives = 93/205 (45.37%), Query Frame = 2
Query:  974 EGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIW 1588
            EGE+    F+  GN +A    +   L    +         KGH  ++++ + YS DG  + T   +  V  W    G        H+  V      ++ PQ V ++S DGTV  +D TR K   ++ + + +YQ   V  +   + + +GG  +     VW ++  KL+Y +  H   V  +  +++  G YL++ + D ++RIW
Sbjct:   57 EGEVYCCKFHPNGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILD-IHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWD-TRKKG--SVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIK--VWDLRQNKLIYTMKGHNDSVTGL--SLSPDGSYLLSNAMDNSVRIW 253          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 7.806e-11
Identity = 61/255 (23.92%), Postives = 112/255 (43.92%), Query Frame = 2
Query: 1094 KGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDL--GFSKHDGELL-----SVVKVSEEKNFQAI 1834
            KGH   ++ CL +   G ++V+G  +  +K W    G+C  T   H+G   GV   + +   + S S D T+  ++       C  T    +    C+     G  V +G         VW ++T + +++L  H   V  ++Y     G  +V+G++D T+++W    +     +  +T+ V ++ F  DG+ I    L+ ++  +DA TG  +  + G   L  G    D  L+     S VK+ + K  Q +
Sbjct:  230 KGHDDHVITCLQFC--GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTG---GVWSSQMRGNIIVSGSTDRTLKVWNAD--TGQCVHTLYGHTSTVRCM--HLHGNRVVSGSRDATLR--VWDIETGQCLHVLAGHVAAVRCVQY----DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQF--DGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRDNILVSGNADSTVKIWDIKTGQCL 467          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 303.523 bits (776), Expect = 3.868e-118
Identity = 196/526 (37.26%), Postives = 285/526 (54.18%), Query Frame = 2
Query:  974 EGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTS-EVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKITPGAVDVM---------NSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQL--DLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLK-------ESVNVGFYSNWLKIVL 2494
            +  + T++ N  G W+A GS +  QL V+ W+S+SYI + +GH  S  N L YSPDG ++VT   +G +K W I++G C ATF  H+  VT V F K + Q +FSSSLDGTV  +DL R +NF T T  ER  QF C+A D  GE+V AG   D F   VW V+T +L+  L  HE PV  + ++   S   L + SWDKT+RIW   G +   E I   SDVLA++ RPDG E+A + L G +  ++     QV  I+ + D+   + + +  +       K F  I YS DG  ++AGGN+  ICLY +  ++LLKRF +S NM+L+G LE  + +K+TE G  D I D  +       +D            S R+++ +V VTS++FSPT   FAAA++EG++++S              I F  F L  D++P S    L E+++  AL  A +L +  L+ +V E+IPI E   +   +           YL R LK       ES ++ F   W+K +L
Sbjct:  302 QNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDS-TNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAK-RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTER-IQFNCLAVDPSGEVVCAGS-LDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENS--VLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNSICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNSLPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYS----------TNDTILFDPFDLDVDVTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIP--------AIYLPRILKFIGDFAIESQHIEFNLIWIKALL 803          

HSP 2 Score: 140.198 bits (352), Expect = 3.868e-118
Identity = 80/300 (26.67%), Postives = 151/300 (50.33%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSL--EKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEK-LIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFS 909
            MK++++FS+++G+ Y+ G I F  DG  +LSPVGN +SV  L  ++  T E     NI  I ++ +  L++ I+E+G A +V+    +V++H NF+++ + V FSP+G+ FA+  G+ + ++  P +  ++        R + G   D+ S+ WS DS+     S D S ++++    EK L   +  G+   V+   F  +   +++VSK+  +  W+  K      ++E    +   +         +  K+ +Y N       Q +V    F+     L  GF  G   ++++PDF+
Sbjct:    1 MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYAN-------QAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFT 293          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 61.2326 bits (147), Expect = 6.017e-10
Identity = 56/219 (25.57%), Postives = 96/219 (43.84%), Query Frame = 2
Query:  965 RVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFA-TFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTR-LKNFCTLTAEERSYQFTCVASDY-----KGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAV-NVSGIYLVTGSWDKTMRIWQFS 1597
            +V E  +R   F    NWI +GS +D ++ VF + +   +   + H    +  +   P    +++G  +  VK W   N      TF  H   V  V F  + P T  S  LD TV  + L +   NF   T +ER   +     DY     K  ++ A   +D  +  +W  +T+  +  L  H   + ++ +AV + +   +++GS D T++IW  S
Sbjct:   52 QVTETPVRAGKFIARKNWIIVGS-DDFRIRVFNYNTGEKVVDFEAHP-DYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYV----DYYPLPDKPYMITA---SDDLTIKIWDYQTKSCVATLEGH---MSNVSFAVFHPTLPIIISGSEDGTLKIWNSS 258          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 60.8474 bits (146), Expect = 6.531e-10
Identity = 48/176 (27.27%), Postives = 89/176 (50.57%), Query Frame = 2
Query: 1382 CVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAFRP-DGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIE 1906
            C + D  G+ +A G         +W ++ RK++ +L  HEQ + S++Y    SG  LV+GS D+T+RIW       S  ++    V  VA  P DG  IA   L+  +  +D+ TG  V+ ++ +++ G + H   + SVV            ++ DG+ +++G   + + L++++
Sbjct:  450 CFSPD--GKFLATGAEDRLIR--IWDIENRKIVMILQGHEQDIYSLDYFP--SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESG-TGHKDSVYSVV------------FTRDGQSVVSGSLDRSVKLWNLQ 606          

HSP 2 Score: 50.8322 bits (120), Expect = 9.183e-7
Identity = 28/93 (30.11%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFP 1261
            IR++ F+  G ++A G+ ED  + ++  +++  +   +GH++ +   LDY P G +LV+G  +  V+ W +  G+C  T S   G  T  V P
Sbjct:  446 IRSVCFSPDGKFLATGA-EDRLIRIWDIENRKIVMILQGHEQDIY-SLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP 536          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 59.3066 bits (142), Expect = 1.503e-9
Identity = 80/357 (22.41%), Postives = 137/357 (38.38%), Query Frame = 2
Query: 1040 DNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFA-TFSNHSGPVTG-------VVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTR-KLMYMLCDHEQPV----CSIEYAVNVSGI---------------------------------YLVTGSWDKTMRIWQF--SGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGK----HDLGFS---------KHDGEL---------LSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYS 1900
            DN   ++   +Q+ +   KGH  + V C+ +SPDG  + TG  +  ++ W   +G+C       HS  +T        +V P  KP+ + SSS DGT+  +D   +   C  T    +   +CV    +G L +   G+   +  VW + ++ + + +L  H   V     S +YA+ +                                     +VT S D TM +W    S    + +  +   V  VAF PDG  I  A  + ++  +D   G  +    G     + + +S           D  L         LSV     +     + +S DGK + +GG  K + L++
Sbjct:  165 DNTARIWDCDTQTPMHTLKGH-YNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPR-LASSSKDGTIKIWDT--VSRVCQYTMSGHTNSVSCVKWGGQGLLYS---GSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 55.0694 bits (131), Expect = 2.864e-8
Identity = 47/195 (24.10%), Postives = 83/195 (42.56%), Query Frame = 2
Query: 1115 VNCLDYSP-DGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTR---LKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDGLEIAGA 1684
            V C+   P D    +TG  +  +K W ++ G+   T + H   V  V    + P  +FS S D TV  +DL +   ++++    +  R+            +L+A  G        +W ++TR  +  L  H+ P+  ++         +V+ S D T+R+W      T +V+T +   V A A  P    +A A
Sbjct:  142 VRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPY-LFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTL-----DLIATAGRDSVIK--LWDMRTRIPVITLVGHKGPINQVQ--CTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASA 326          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Match: EDO45665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS02])

HSP 1 Score: 332.413 bits (851), Expect = 6.013e-132
Identity = 198/508 (38.98%), Postives = 296/508 (58.27%), Query Frame = 2
Query:  968 VCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDM-SDKK--ITPGAVDVMNSKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNW 2479
            + +  I  +A N  G W+A G     QL V+ W+S+SYI + +GH   + N L YSPDG  + TGG +G VK W    G CF TF  HS  VT V F     Q V S+SLDGTV  +DL R +NF T  A  R  QF+ +A D  GE+VAAG   D F   VW ++T +L+ +L  HE PV S+  A + S   L++G+WDKT+R+W  F    + E +  TSDV+++A RPDG E+A + L+G L F+D     QVK ++G+ DLG  +   + ++    +  K F ++CY+ADG+ +LAGG SK++C+Y++EQ++LLKRFQ+S N+S DG+ E     ++TE G  D I D  SD++    PG +    S R+ + ++ V  ++FSPTG  +AAA++EG++++S +           V D      D++PE  R+ LA  +Y+RAL    +L +  L+ EV+ESI   +   +V+ L    V   L  +++ QL  S ++ FY  W
Sbjct:  293 ISQQTISAVAVNPTGEWLAFGCTSLGQLLVWEWQSESYILKQQGHYYDM-NVLAYSPDGNYIATGGDDGKVKLWNTMTGFCFVTFHEHSASVTAVTFSPNG-QVVLSASLDGTVRAFDLNRYRNFRTF-ASPRPAQFSTLALDSSGEVVAAGS-RDTFEIFVWSIQTGRLLEVLAGHEAPVSSL--AFSPSHPVLISGAWDKTVRLWNVFESKVSRETLNLTSDVVSIAVRPDGREVAISSLDGALTFWDLEAAVQVKSVDGRRDLGAGRKADDKITARSSAFGKCFTSLCYTADGENVLAGGRSKFVCIYNVEQQILLKRFQVSRNLSFDGMKEKLRSDQMTEAGPVDMIDDRDSDEEDISLPGVLKGDMSSRRTRPEIRVKCVQFSPTGRAWAAASTEGLLIYSLDASL--------VFDPYDLDSDVTPEVTRQVLARGEYARALVLGFRLNEQQLIKEVVESIKCSDIRLVVQALSDTYVD-KLLWFVSGQLDTSAHLQFYLTW 785          

HSP 2 Score: 158.688 bits (400), Expect = 6.013e-132
Identity = 91/302 (30.13%), Postives = 155/302 (51.32%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLE--FL----SNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK +++FS+++G+ Y+ G + F   G+ ++SPVGN ++V  LK ++  T+   ++ NI  +A+SP    I+ ++E+G + + ++ T   ++  NF++ V  + FSPNG+F A+  GK V V+ AP   +      L RTY G   D   IDW      F VGS D + R+Y+    E     +L G    ++ C F + SLD +++S +  L  W C+  L+  FL     ND+ ++ +  + K  K    + + +N              E+T    +     L+ GF +G   IHE+PDF
Sbjct:    1 MKFSFKFSNLLGTVYKRGNVKFTNHGDCVISPVGNRVTVFDLKNNKSWTLPFENAKNIARLALSPDDTTIITVDEDGRSILANLRTKVALHFFNFKKPVEDIVFSPNGRFIAVTHGKHVQVWSAPGHTREFAPFVLHRTYTGHYDDTTCIDW-----FFIVGSKDMTARIYSLDPMENFSPVTLSGARNTIVGCFFQEGSLDAYTISSSGALGIWTCSAKLQEVFLRTKDKNDQTDQDKEELVKWKKGPKHFFEKENF------------TEITSCALHKATQVLIVGFSNGVFTIHELPDF 285          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 85.1149 bits (209), Expect = 2.264e-17
Identity = 85/345 (24.64%), Postives = 140/345 (40.58%), Query Frame = 2
Query:  956 YFFRVCEGEI---RTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF-SGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ------ISCNMSLDG 1960
            Y F++    I     +AFN  G     GS  D    V+   S       +GHK  +      +P G ++ TG  +   K W    G+C+ T+  HS  +  + F  Q    + + S+D T   +D+       TL+    S +    A +  G  +  G      S  VW  ++ + ++ L  H   + + ++  + S  ++VTGS DKT +IW   +G     +  +  +VL VAF   G  IA A  +G    Y+ALT   + ++EG        H+GE+              I ++A G  LL   + K   L+       L+  +       SC  + DG
Sbjct:   83 YLFKILRAHILPLTNVAFNKSGTSFITGSY-DRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQS-TVIATGSMDTTAKLWDVQTGAEISTLSGH--SAEIISCAFNSTGTQLLTGSFDHTVS--VWDTRSGRRVHTLIGHRGEISNAQFNFDCS--FIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEG--------HEGEI------------SKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDG 399          

HSP 2 Score: 62.003 bits (149), Expect = 5.013e-10
Identity = 57/207 (27.54%), Postives = 90/207 (43.48%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGE--LVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI + AFN  G  +  GS  D+ ++V+  +S   +    GH+  + N   ++ D   +VTG  +   K W    G+C  T   H   V  V F     Q + ++S DGT  G     L + C    E    + + +  + +G   L A+   T    A +W   T K + +L  H   + S   A N  G  ++TGS D T R+W+
Sbjct:  220 AEIISCAFNSTGTQLLTGSF-DHTVSVWDTRSGRRVHTLIGHRGEISNA-QFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAF-DYTGQLIATASADGT--GRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKT----ARLWDPNTGKCLQVLEGHTDEIFSC--AFNYDGDIIITGSKDNTCRLWR 415          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 68.9366 bits (167), Expect = 6.984e-13
Identity = 61/275 (22.18%), Postives = 119/275 (43.27%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF-SGDNTSEVIT-NTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            VN   +SPD  ++VTGG +  VK W    G+   T  +H G +  V F     +   S++ D  V  ++    K    L     S +  C + +  G  + +G   +  +A++W +K     Y+L  H   + +  ++ +   +   TGSWD T+R+W    GD   + +  + S+V ++AF  + +  +G+  +  +  +D+ TG+ +  + G        H G +            QA  +S  G LL +  + + + ++       +K  +
Sbjct:    2 VNTCAFSPDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSSD-GKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSPN--GAFLCSGSWDN--TAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSKTV--ATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAKNHMLASGS-WDMTIRLWDSKTGELIHLLTG--------HSGWV------------QACSFSGSGDLLASASDDQTVRVWDTSTGRCIKELE 248          

HSP 2 Score: 56.225 bits (134), Expect = 1.255e-8
Identity = 65/260 (25.00%), Postives = 104/260 (40.00%), Query Frame = 2
Query:  980 EIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQS-YIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVF--SSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIE 1747
            ++ T AF+   +W  + +  D+ L V  W S++  +  +  H    + C+ +S DG    +   +  V  W+ + G+       H+  V    F    P   F  S S D T   + L        L       Q    + D K     A G  DC   L   V+    +  L  H+  V S+ +A N     L +GSWD T+R+W         ++T  S  V A +F   G  +A A  +  +  +D  TG  +KE+E
Sbjct:    1 QVNTCAFSP--DWTRVVTGGDDDL-VKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFS---PNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSK---TVATGSWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAKN---HMLASGSWDMTIRLWDSKTGELIHLLTGHSGWVQACSFSGSGDLLASASDDQTVRVWDTSTGRCIKELE 248          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Match: EDO32893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS6])

HSP 1 Score: 70.0922 bits (170), Expect = 3.549e-12
Identity = 66/269 (24.54%), Postives = 120/269 (44.61%), Query Frame = 2
Query:  980 EIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQI---SNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKN-----FCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHD 1759
            EI  ++F G  N         NQL ++  ++       +GH + ++ CLD   DG ++VTG ++  V+ W +   SN RC A  + H+  V+GV + +   + V S S D T+  ++ T+        F  +T +        VA     +LV  G      +A VW++    LM +   H++ V   +++     I   T S D T++IW  +     +     S+ VL V F  +G+++  +  +G +  +   T + V+  +   D
Sbjct:  365 EILDMSFAGKTNDHLAVVTNSNQLRLYNLETLD-CRMVEGHSK-MILCLDVCADGTKIVTGSKDHTVRVWDVSDCSNPRCLAVGNGHTHAVSGVAWSRTSQRFVISCSQDLTIKVWEATKKAAEESSMFVKMTVKAHDKDINSVAVSPNDKLVVTGSQDK--TAKVWRIADGILMGVARGHKRGVWCAQFSPFDKCI--ATASGDSTIKIWSLTDYTCVKTFEGHSNSVLKVVFISNGMQLITSGTDGLVKLWTIKTNECVQTFDEHQD 627          

HSP 2 Score: 52.7582 bits (125), Expect = 7.559e-7
Identity = 77/360 (21.39%), Postives = 141/360 (39.17%), Query Frame = 2
Query: 1082 IFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSN-HSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFS-----GDNTSEVITNTSDVLAVAFRPDGLE-----------IAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSA----DGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEW---GFSDAIIDMSDKKITPGAVDVMNSKRQLKL 2089
            +  S   +  +++C   SPD   LVT G+   ++ W   NG    T+   H  PV+ + F          SS D T+  +D+  +K + T + +  +   + V      +++     +D     VW +   + + +L +H   V S+  A + S   +++ S DK + IW  +            I     V +V F P GL               A   G L F+   +G  V                +L+ V  +S++   Q +   A       +++   + + I +Y +E    LK+F +   ++L          +I  W   G++D I+DMS    T   + V+ +  QL+L
Sbjct:   60 VIHSLKEESDIISCFAASPDDEFLVTAGKNLLLRQWDWRNGMQTKTWKAVHVAPVSSMCFDASSTLLATGSS-DSTIKVWDI--IKQYYTHSLKGSTGVVSLVKFHPDPKVLQLFSTSDDCKIRVWDLVKSRCLCVLENHFSVVTSL--AFDPSHSTMISSSRDKVLNIWDMADMLTPNRRPPRTIPCFEGVESVEFLPKGLSSKVCEKKDEQYFVTAGNKGRLCFWSLKSGQLVH---------------KLVVVENMSDDSGLQQLLVHATLCRKRNVVMVITHDQNILMYDLENFKKLKQFSMRDTVNL---------LRIPHWQFVGYNDEILDMSFAGKTNDHLAVVTNSNQLRL 390          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 65.4698 bits (158), Expect = 1.424e-11
Identity = 57/220 (25.91%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  959 FFRVCEGE---IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCF------ATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
            F R  EG    + ++AF+  G  + +    D +L V+  +S + +    GH    V CLD+SPDG+ L + G + NV  W IS  RC+      A    HS  V  V F       + S S D TV  +D    +       + R +   C +  Y  + +     +D F   +W V+    +  +  HE  +  + ++ + S   L + + D+T+R+W 
Sbjct:   63 FLRSLEGHEDRVTSLAFSKNGKRL-VSVALDKKLKVWDVESGNLLDTLTGHDGYPV-CLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGA-LLTSGSRDRTVRVWDCAAAEKL----KKARFHSERCWSVAYSDDGMWLASASDDFKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDS--LLASAALDQTIRVWD 273          

HSP 2 Score: 58.9214 bits (141), Expect = 1.854e-9
Identity = 62/267 (23.22%), Postives = 116/267 (43.45%), Query Frame = 2
Query: 1034 QEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRK------LMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHD----LGFSKHDGELLSVV 1801
             ED  + V+  K+ + + Q  GH  + V C+  SPDG  + +   +  ++ W  S+     +   H   VT + F K   + V S +LD  +  +D+       TLT  +  Y   C+     G L+A+ G     + ++W + T +      ++ +L  H   V  + ++ +  G  L +GS D+T+R+W   + +   +   ++    +VA+  DG+ +A A  +  +  +      QV  +EG       + FS  D  L S  
Sbjct:    7 SEDCTIRVWDSKTGALLAQLDGHAGA-VTCVRVSPDGGVIASSSADKTIRLWNPSD-EFLRSLEGHEDRVTSLAFSKNGKRLV-SVALDKKLKVWDVESGNLLDTLTGHD-GYP-VCLDFSPDGMLLASTGADS--NVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSD--GALLTSGSRDRTVRVWDCAAAEKLKKARFHSERCWSVAYSDDGMWLASASDDFKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAA 264          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Match: pwp2h (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:101167684])

HSP 1 Score: 338.961 bits (868), Expect = 5.729e-143
Identity = 210/593 (35.41%), Postives = 333/593 (56.16%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGD-NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKITPGAVDVMN-----------SKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS--GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLVEWTETIWNSS-------DSQWKNISLDIVNCAKL---NKSKLSGESAAIHQEALLRSIVQKESK 2659
            V+   + +  I ++A N  G+WIA G     QL V+ W+S+SY+F+ +GH  ++   L YSPDG  +VTGG +  VK W  S+G CF TF+ H+  VT V F       + S+SLDGTV  +DL R +NF T T+  R  QF+ +A D  GELV+AG   D F   +W ++T +L+ +L  HE PV  + ++   S   L + SWD+T+R+W         E +  TSD LAV +RPDG E+A A LNG ++F++  T  Q   I G+HDL   + D + ++  ++++ K+F ++CYSADG+ +LAGG SK++C+Y++ +++L+K+F+ISCN+S D + E  DRRK+TE+G S A++D       PG  D +N           S R  K ++ V+S++FSPTG  +AA T+EG++V+S  G  VF   D            LD++P SIR+ L  ++++ A+  A +L +  L  E +E++P  +   + + L    V   L  +L   L++S ++ FY  W + +L+   + + N S        S  K+I     N +KL   N   +   +A   Q  + R   Q++ +
Sbjct:  320 VHSLSISQQRIASVAVNASGDWIAFGCSRMGQLLVWEWQSESYVFKQQGHFNNMA-ALAYSPDGQYIVTGGDDSKVKAWNTSSGLCFVTFTEHTSSVTSVAFTASG-FVIVSASLDGTVRAFDLHRYRNFRTFTSP-RPAQFSSLAVDVSGELVSAGA-QDSFEIFLWSMQTGRLLEVLGGHEGPVSGLCFSPVQS--ILASSSWDRTVRLWDMMDSWQVKETLALTSDGLAVTYRPDGQELAVATLNGEIMFWNPNTATQTGSISGRHDLEVGRKDTDKVTAKQLAKGKSFTSVCYSADGESVLAGGQSKFVCIYNVREQMLMKKFEISCNLSFDAMEEFLDRRKMTEFG-SLALVDEG-----PGDGDGVNISLPGVRRGDMSSRHFKPEIRVSSLRFSPTGRSWAATTTEGLLVYSLDGSMVFDPYD----------LDLDVTPASIRKQLRLQEWTSAIVLAFRLNESALKQEALETVPHEQIPLVCRSLPDIYVE-KLLGFLATCLEKSSHLQFYMTWAQNLLMLHGQKLKNRSGSILATLQSLQKSIQRHFDNLSKLCDFNMYSIRYAAALSKQRGMKRPAAQEDEE 889          

HSP 2 Score: 190.274 bits (482), Expect = 5.729e-143
Identity = 106/327 (32.42%), Postives = 174/327 (53.21%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFL-------------------------------SNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            MK  Y+FS+++G+ Y+ G + F  DGN+++SPVGN ISV  LK +  +T+ V+++ NI  + VSP   L + ++E+G A +VS++T  V++H +F + V+ V FSP+G+ F + +  + ++Y+AP   +      L ++Y G   +   IDW+ DSK F VGS D ST V+ A +   LI YSLGG++  V+ C F K+SLD+++VS++  LC W+ +  L+ L                                 D P   +     + K    +  +K+  + N+          T A F+   + LVTGF  G   +HE+P+F
Sbjct:    1 MKFAYKFSNLLGAVYRQGNLNFSTDGNAVISPVGNRISVFNLKNNTSETLPVSTTKNITCVGVSPDGSLAIVVDEDGAALLVSLVTRAVLHHFHFHKPVSSVRFSPDGRKFVVTKENVALMYHAPGKRREFNAFVLDKSYYGPYDETTCIDWTDDSKCFVVGSKDMSTWVFGAERWANLIYYSLGGHKDVVVGCFFEKDSLDLYTVSQDGTLCVWESDTDLDGLVLKKKGADGGVRNEDDEEERVEGEEGEVIRGKADMPEDDKKIKNVRFKQASKHFFNKDGDFNNL----------TAAAFHKQTHILVTGFASGVFHLHELPEF 317          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Match: pwp2h (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:101167684])

HSP 1 Score: 338.961 bits (868), Expect = 5.202e-124
Identity = 211/593 (35.58%), Postives = 334/593 (56.32%), Query Frame = 2
Query:  953 VYFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGD-NTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKITPGAVDVMN-----------SKRQLKLDVMVTSIKFSPTGTQFAAATSEGVMVFS--GEKVFRSIDYIGGVIDFSQFQLDLSPESIRRDLAERKYSRXXXXXXXXXXXXXXTEVIESIPIYETAFIVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLVEWTETIWNSS-------DSQWKNISLDIVNCAKL---NKSKLSGESAAIHQEALLRSIVQKESK 2659
            V+   + +  I ++A N  G+WIA G     QL V+ W+S+SY+F+ +GH  ++   L YSPDG  +VTGG +  VK W  S+G CF TF+ H+  VT V F       + S+SLDGTV  +DL R +NF T T+  R  QF+ +A D  GELV+AG   D F   +W ++T +L+ +L  HE PV  + ++  V  I L + SWD+T+R+W         E +  TSD LAV +RPDG E+A A LNG ++F++  T  Q   I G+HDL   + D + ++  ++++ K+F ++CYSADG+ +LAGG SK++C+Y++ +++L+K+F+ISCN+S D + E  DRRK+TE+G S A++D       PG  D +N           S R  K ++ V+S++FSPTG  +AA T+EG++V+S  G  VF   D            LD++P SIR+ L  ++++ A+  A +L +  L  E +E++P  +   + + L    V   L  +L   L++S ++ FY  W + +L+   + + N S        S  K+I     N +KL   N   +   +A   Q  + R   Q++ +
Sbjct:  259 VHSLSISQQRIASVAVNASGDWIAFGCSRMGQLLVWEWQSESYVFKQQGHFNNMA-ALAYSPDGQYIVTGGDDSKVKAWNTSSGLCFVTFTEHTSSVTSVAFTASG-FVIVSASLDGTVRAFDLHRYRNFRTFTSP-RPAQFSSLAVDVSGELVSAGA-QDSFEIFLWSMQTGRLLEVLGGHEGPVSGLCFS-PVQSI-LASSSWDRTVRLWDMMDSWQVKETLALTSDGLAVTYRPDGQELAVATLNGEIMFWNPNTATQTGSISGRHDLEVGRKDTDKVTAKQLAKGKSFTSVCYSADGESVLAGGQSKFVCIYNVREQMLMKKFEISCNLSFDAMEEFLDRRKMTEFG-SLALVDEG-----PGDGDGVNISLPGVRRGDMSSRHFKPEIRVSSLRFSPTGRSWAATTTEGLLVYSLDGSMVFDPYD----------LDLDVTPASIRKQLRLQEWTSAIVLAFRLNESALKQEALETVPHEQIPLVCRSLPDIYVE-KLLGFLATCLEKSSHLQFYMTWAQNLLMLHGQKLKNRSGSILATLQSLQKSIQRHFDNLSKLCDFNMYSIRYAAALSKQRGMKRPAAQEDEE 828          

HSP 2 Score: 127.487 bits (319), Expect = 5.202e-124
Identity = 75/252 (29.76%), Postives = 123/252 (48.81%), Query Frame = 1
Query:  244 EGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFL-------------------------------SNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDF 906
            +G A +VS++T  V++H +F + V+ V FSP+G+ F + +  + ++Y+AP   +      L ++Y G   +   IDW+ DSK F VGS D ST V+ A +   LI YSLGG++  V+ C F K+SLD+++VS++  LC W+ +  L+ L                                 D P   +     + K    +  +K+  + N+          T A F+   + LVTGF  G   +HE+P+F
Sbjct:   15 DGAALLVSLVTRAVLHHFHFHKPVSSVRFSPDGRKFVVTKENVALMYHAPGKRREFNAFVLDKSYYGPYDETTCIDWTDDSKCFVVGSKDMSTWVFGAERWANLIYYSLGGHKDVVVGCFFEKDSLDLYTVSQDGTLCVWESDTDLDGLVLKKKGADGGVRNEDDEEERVEGEEGEVIRGKADMPEDDKKIKNVRFKQASKHFFNKDGDFNNL----------TAAAFHKQTHILVTGFASGVFHLHELPEF 256          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 83.9593 bits (206), Expect = 1.403e-16
Identity = 80/312 (25.64%), Postives = 133/312 (42.63%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTL---TAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIE 1906
            +  +AFN  G+    GS  D +  V+   S   +   +GH   +       P G ++ TG  +   K W    G C  T   H   +  + F  Q    V + S D +   +D+ R K   TL   +AE  S  F  V S    +LV    G+   +  VW V T +L++ML  H   + + ++  + S   +V+GS D T ++W+  SG   + +  +T +VL V F   G  +A A  +G    ++A T + +  +EG        H+GE+              IC+S  G  +L   + K   L+ ++
Sbjct:   93 LTNVAFNKSGSRFITGSY-DRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQST-LVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGS----QLVT---GSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCS--LIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEG--------HEGEI------------SKICFSPQGNTILTASSDKTARLWDVQ 373          

HSP 2 Score: 70.0922 bits (170), Expect = 3.535e-12
Identity = 56/205 (27.32%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI ++ FN +G+ +  GS  D  L V+   ++  +    GH   + N   ++ D   +V+G  +   K W+  +GRC AT + H+  V  V F     Q V  +S DGT   ++    +    L   E      C +      L A+   T    A +W V+T   + +L  H   + S   A N  G  ++TGS D T +IW+
Sbjct:  218 AEILSLCFNSVGSQLVTGS-SDQTLAVWDVATERLVHMLAGHAGEISNA-QFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCF-DSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKT----ARLWDVQTGGCLQILTGHTLEIFSC--AFNYEGDTIITGSADNTCQIWR 413          

HSP 3 Score: 67.0106 bits (162), Expect = 3.237e-11
Identity = 61/231 (26.41%), Postives = 101/231 (43.72%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDG 1666
             EIR +AFN     +A GS  D    ++  K    +   KGH   +++ L ++  G QLVTG  +  +  W ++  R     + H+G ++   F       + S SLD T   ++    +   TL A        C   D  G+LVA        +A V+   T + M  L  HE  +  I ++    G  ++T S DKT R+W        +++T +T ++ + AF  +G
Sbjct:  176 AEIRCLAFNPQSTLVATGST-DASAKLWDVKRGKEVATLKGHSAEILS-LCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQF-NWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCF--DSTGQLVAIASADG--TASVFNAATYECMARLEGHEGEISKICFSPQ--GNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEG 397          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 83.1889 bits (204), Expect = 2.813e-16
Identity = 81/312 (25.96%), Postives = 134/312 (42.95%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTL---TAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIE 1906
            +  +AFN  G+    GS  D +  V+   S   +   +GH   +       P G ++ TG  +   K W    G C  T   H   +  + F  Q    V + S D +   +D+ R K   TL   +AE  S  F  V S    +LV   G +D  +  VW V T +L++ML  H   + + ++  + S   +V+GS D T ++W+  SG   + +  +T +VL V F   G  +A A  +G    ++A T + +  +EG        H+GE+              IC+S  G  +L   + K   L+ ++
Sbjct:  100 LTNVAFNKSGSRFITGSY-DRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQST-LVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGS----QLVT--GSSD-QTLAVWDVATERLVHMLAGHAGEISNAQFNWDCS--LIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEG--------HEGEI------------SKICFSPQGNTILTASSDKTARLWDVQ 380          

HSP 2 Score: 70.0922 bits (170), Expect = 4.242e-12
Identity = 56/205 (27.32%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
             EI ++ FN +G+ +  GS  D  L V+   ++  +    GH   + N   ++ D   +V+G  +   K W+  +GRC AT + H+  V  V F     Q V  +S DGT   ++    +    L   E      C +      L A+   T    A +W V+T   + +L  H   + S   A N  G  ++TGS D T +IW+
Sbjct:  225 AEILSLCFNSVGSQLVTGS-SDQTLAVWDVATERLVHMLAGHAGEISN-AQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDS-TGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKT----ARLWDVQTGGCLQILTGHTLEIFSC--AFNYEGDTIITGSADNTCQIWR 420          

HSP 3 Score: 67.0106 bits (162), Expect = 3.937e-11
Identity = 61/231 (26.41%), Postives = 101/231 (43.72%), Query Frame = 2
Query:  977 GEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVIT-NTSDVLAVAFRPDG 1666
             EIR +AFN     +A GS  D    ++  K    +   KGH   +++ L ++  G QLVTG  +  +  W ++  R     + H+G ++   F       + S SLD T   ++    +   TL A        C   D  G+LVA        +A V+   T + M  L  HE  +  I ++    G  ++T S DKT R+W        +++T +T ++ + AF  +G
Sbjct:  183 AEIRCLAFNPQSTLVATGST-DASAKLWDVKRGKEVATLKGHSAEILS-LCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQF-NWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCF--DSTGQLVAIASADG--TASVFNAATYECMARLEGHEGEISKICFSPQ--GNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEG 404          
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 70.8626 bits (172), Expect = 1.276e-12
Identity = 70/288 (24.31%), Postives = 125/288 (43.40%), Query Frame = 2
Query: 1076 SYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLA-VAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQ 1933
            S  F   GH ++ V+ + +SP G  L +   +  +K W   +G+   T S H   ++ V +       + S+S D T+  +D+   K  C  T +  S    C   + +  L+ +G   +  S  +W VKT K +  L  H  PV ++ +  N  G  +V+ S+D   RIW   SG     +I + +  ++ V F P+G  I  A L+  L  +D   G  +K   G        H  E   +       NF        GK +++G     + +++++ K ++++ Q
Sbjct:   36 SLKFTLAGHTKA-VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS-NLLVSASDDKTLKIWDVNSGK--CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDE--SVRIWDVKTGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG--------HKNEKYCIF-----ANFSV----TGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 56.9954 bits (136), Expect = 4.120e-8
Identity = 56/241 (23.24%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  983 IRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVS-GIYLVTGSWDKTMRIWQFSGDNTSEVITNTSD-VLAVAFRPDGLEIAGALLNGN 1699
            I  +A++   N + + + +D  L ++   S   +   KGH  + V C +++P    +V+G  + +V+ W +  G+C  T   HS PV+ V F +     + SSS DG    +D    +   TL  ++     + V     G+ + A    +     +W     K +     H+     I    +V+ G ++V+GS D  + IW        + +   +D V++ A  P    IA A L  +
Sbjct:   90 ISDVAWSSDSN-LLVSASDDKTLKIWDVNSGKCLKTLKGH-SNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLK--LWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALEND 324          
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Match: SMESG000079759.1 (SMESG000079759.1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 342/350 (97.71%), Postives = 345/350 (98.57%), Query Frame = 2
Query:  956 YFFRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKITEWGF 2005
            Y+ +VCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRK+    F
Sbjct:  300 YYLKVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKRFQISCNMSLDGILEIHDRRKLPNGDF 649          

HSP 2 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 302/303 (99.67%), Postives = 302/303 (99.67%), Query Frame = 1
Query:   19 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEXXXXXXXXXXXTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK 927
            MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEP KTEVSVKKKNKNVVTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK
Sbjct:    1 MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTIEVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVNCVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSIDWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNSLDVFSVSKNAQLCFWKCNKSLEFLSNDEPIKTEVSVKKKNKNVVTYLKSKNLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRYYLK 303          
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.066e-12
Identity = 48/180 (26.67%), Postives = 79/180 (43.89%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITNTSDVLAVAF 1654
            V C+ +SPD    +TG  +  +K W + NG+   + + H   V GV    + P  VFS   D TV  +DL   +N         +    C+      +L+  GG        VW ++T+  +++L  H   V S+    N+  +  ++GS D T+R+W      T  V+TN    +   F
Sbjct:  140 VRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPY-VFSCGEDKTVKCWDLE--QNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVR--VWDMRTKINVHILSGHRDAVASVRCQSNLPEV--ISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVF 312          

HSP 2 Score: 50.447 bits (119), Expect = 4.571e-6
Identity = 63/247 (25.51%), Postives = 97/247 (39.27%), Query Frame = 2
Query: 1055 VFCW--KSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQF-SGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKHDGE 1786
            V CW  +    I    GH  S V CLD  PD   L+TGGR+  V+ W +         S H   V  V      P+ V S S D TV  +DL   K    LT  +++ +   +       +  +  G   FS     +   + M  +  H   + ++   VN + +  V+G  D T+  W + SG N  +        L    +P  L+   ++L     F    T  ++  +EG   + F K D E
Sbjct:  203 VKCWDLEQNKVIRHYHGHT-SAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPE-VISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFS-----LPEGQFMQNMKGHNTIINAV--TVNENNV-AVSGGNDGTLYFWDWKSGYNFQK--------LQSPPQPGSLDSENSILG----FSFDRTSQRLVTVEGDKTIKFYKEDDE 427          
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Match: SMESG000010381.1 (SMESG000010381.1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.818e-12
Identity = 54/212 (25.47%), Postives = 92/212 (43.40%), Query Frame = 2
Query:  962 FRVCEGEIRTIAFNGIGNWIAIGSQEDNQLNVFCWKSQSYIFQSKGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGR-CFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTVCGYDL-TRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
            F VCE  +R   F    NW+  GS +D Q+ +F + +   +   + H    + C+   P    ++T G +  +K W       C   F  HS  V  +V   +   T  S+SLD T+  ++L + + NF   T E       C+     G+      G D     +W  +T+  ++ L  H Q + ++ +   +  I  +TGS D T+R+W 
Sbjct:   53 FEVCEVPVRAAKFVARKNWMISGS-DDMQIRIFNYNTLERVHAFEAHS-DYIRCIVVHPTQPFILTSGDDMTIKLWDWDKKWICAQVFEGHSHYVMQLVINPKDNNTFASASLDKTIKVWNLGSGIANF---TMEGHEKGVNCIDYYCGGDKPYLVSGADDRLVKIWDYQTKTCVHTLDGHAQNISAVAFHPELPII--ITGSEDGTIRVWH 257          
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.475e-12
Identity = 55/215 (25.58%), Postives = 96/215 (44.65%), Query Frame = 2
Query: 1094 KGHKRSLVNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVVFPKQKPQTVFSSSLDGTV---CGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ-FSGDNTSEVITNTSDVLAVAFRPDGLEIAGALLNGNLVFYDALTG 1726
            + H   L N + ++ +G + +TG  +   K W  S G    T   H   V  + +       + + S D T       D +    F   TAE       CV  +    LV  GG  D   A++W V++ K +  L  H   V S+++    +G +L+TGS+D T+ +W   +G   S++I + +++ A  F  DG  +A A ++ ++  +D   G
Sbjct:   89 RAHILPLTN-VTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAE-----VVCVQFNPSSTLVGTGG-MDTL-AMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMG 295          
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Match: SMESG000024012.1 (SMESG000024012.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.971e-10
Identity = 43/160 (26.88%), Postives = 74/160 (46.25%), Query Frame = 2
Query: 1115 VNCLDYSPDGIQLVTGGREGNVKFWQISNGRCFATFSNHSGPVTGVV-FPKQKPQTVFSSSLDGTVCGYDLTRLKNFCTLTAEERSYQFTCVASDYKGELVAAGGGTDCFSALVWQVKTRKLMYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQ 1591
            V  +D + D    ++G  + +VK W I +G C  TF+ H   +  V  FP +  Q + ++S D T   +D+   +     + +      T +     G ++ A  G D F+  VW    +  + +L  H+  V  +   V+ +G  L TGSWD T++IW 
Sbjct:  192 VMSVDVTRDNKLFISGACDASVKMWDIRSGNCVQTFTGHESDINAVTYFPNE--QLIGTASDDATCRLFDIRADQELALYSLDSIICGITSIQFSLSGRMLFA--GYDDFNCQVWDTLKQDRIGVLASHDNRVSCL--GVSKNGEALCTGSWDSTLKIWN 345          
The following BLAST results are available for this feature:
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PWP24.601e-14338.55PWP2 small subunit processome component [Source:HG... [more]
FP565260.12.144e-14238.55periodic tryptophan protein 2 homolog [Source:NCBI... [more]
DAW16.159e-1426.05dynein assembly factor with WD repeats 1 [Source:H... [more]
WDR381.035e-1325.45WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR383.744e-1330.63WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F55F8.34.646e-10832.39Periodic tryptophan protein 2 homolog [Source:Uni... [more]
prp-192.789e-1330.00Pre-mRNA-processing factor 19 [Source:UniProtKB/S... [more]
snrp-40.22.280e-1127.05Small Nuclear RibonucleoProtein homolog [Source:U... [more]
snrp-40.15.279e-1127.40Small Nuclear RibonucleoProtein homolog [Source:U... [more]
Y41C4A.326.647e-1125.35pep chromosome:WBcel235:III:11721706:11723602:1 ge... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG123251.134e-9137.17gene:FBgn0033557 transcript:FBtr0345930[more]
CG123251.134e-9137.17gene:FBgn0033557 transcript:FBtr0088227[more]
U4-U6-60K1.484e-1227.54gene:FBgn0036733 transcript:FBtr0075209[more]
CG301161.994e-1223.10gene:FBgn0028496 transcript:FBtr0086721[more]
CG301161.994e-1223.10gene:FBgn0028496 transcript:FBtr0086719[more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pwp2h8.140e-13936.78PWP2 small subunit processome component [Source:ZF... [more]
daw19.837e-1322.36dynein assembly factor with WDR repeat domains 1 [... [more]
wdr51.053e-1224.21WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr381.282e-1229.28WD repeat domain 38 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
daw11.298e-1222.36dynein assembly factor with WDR repeat domains 1 [... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw14.233e-1422.81dynein assembly factor with WDR repeat domains 1 [... [more]
daw15.581e-1422.81dynein assembly factor with WDR repeat domains 1 [... [more]
daw15.689e-1422.81dynein assembly factor with WDR repeat domains 1 [... [more]
daw15.740e-1422.93dynein assembly factor with WDR repeat domains 1 [... [more]
daw15.764e-1422.93dynein assembly factor with WDR repeat domains 1 [... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pwp29.368e-14238.93PWP2 periodic tryptophan protein homolog (yeast) [... [more]
Wdr382.152e-1826.49WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr382.152e-1826.49WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
Daw11.033e-1424.62dynein assembly factor with WDR repeat domains 1 [... [more]
Wdr51.279e-1224.21WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15269|PWP2_HUMAN2.030e-14238.55Periodic tryptophan protein 2 homolog OS=Homo sapi... [more]
sp|Q5RFQ3|PWP2_PONAB2.152e-14238.17Periodic tryptophan protein 2 homolog OS=Pongo abe... [more]
sp|Q8BU03|PWP2_MOUSE5.707e-14138.93Periodic tryptophan protein 2 homolog OS=Mus muscu... [more]
sp|Q9C1X1|PWP2_SCHPO1.584e-12537.02Periodic tryptophan protein 2 homolog OS=Schizosac... [more]
sp|Q9C270|PWP2_NEUCR2.298e-11837.07Periodic tryptophan protein 2 homolog OS=Neurospor... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419PG011.817e-16540.93Periodic tryptophan protein 2-like protein OS=Clon... [more]
A0A4S2LZY52.431e-16541.30WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A4S2LU613.420e-16541.30WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A075A1P69.922e-16541.11WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A4E0RAB11.686e-15940.08WD40-repeat-containing subunit of the 18S rRNA pro... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pwp2h2.067e-10137.16PWP2, small subunit processome component [Source:N... [more]
pwp2h2.968e-10137.16PWP2, small subunit processome component [Source:N... [more]
daw16.180e-1826.48dynein assembly factor with WD repeats 1 [Source:N... [more]
ENSAMXT00000035022.11.113e-1323.55WD repeat-containing protein 38 [Source:NCBI gene;... [more]
ENSAMXT00000041598.16.118e-1327.59WD repeat-containing protein 38 [Source:NCBI gene;... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006826.12.789e-5533.44pep scaffold:Pmarinus_7.0:GL480117:19454:28465:1 g... [more]
ENSPMAT00000001262.19.163e-5238.60pep scaffold:Pmarinus_7.0:GL482245:224:4916:1 gene... [more]
GNB33.594e-1127.11G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
snrnp405.595e-1125.37small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
ENSPMAT00000008862.17.806e-1123.92pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PWP23.868e-11837.26Conserved 90S pre-ribosomal component; essential f... [more]
SEC276.017e-1025.57Essential beta'-coat protein of the COPI coatomer;... [more]
TUP16.531e-1027.27General repressor of transcription; forms complex ... [more]
RSA41.503e-922.41WD-repeat protein involved in ribosome biogenesis;... [more]
PRP462.864e-824.10Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456656.013e-13238.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348652.264e-1724.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373286.984e-1322.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328933.549e-1224.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447951.424e-1125.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pwp2h5.729e-14335.41periodic tryptophan protein 2 homolog [Source:NCBI... [more]
pwp2h5.202e-12435.58periodic tryptophan protein 2 homolog [Source:NCBI... [more]
daw11.403e-1625.64dynein assembly factor with WD repeats 1 [Source:N... [more]
daw12.813e-1625.96dynein assembly factor with WD repeats 1 [Source:N... [more]
wdr51.276e-1224.31WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of Periodic tryptophan protein 2 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079759.10.000e+097.71SMESG000079759.1[more]
SMESG000010494.11.066e-1226.67SMESG000010494.1[more]
SMESG000010381.13.818e-1225.47SMESG000010381.1[more]
SMESG000008529.17.475e-1225.58SMESG000008529.1[more]
SMESG000024012.12.971e-1026.88SMESG000024012.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030438 ID=SMED30030438|Name=Periodic tryptophan protein 2 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2671bp
CTCTTCCGATCTTAAAGAATGAAGAATAATTATCAATTTTCGTCAATTAT
TGGTTCAAGTTATCAGAATGGCCAAATATGTTTTTTACCAGATGGAAATA
GTATTTTAAGTCCTGTTGGAAACAATATTTCAGTTTTGTATTTAAAGCGT
GATGAAATTAAAACAATTGAAGTCAATAGTTCATATAATATTCAACACAT
TGCTGTTTCGCCAAAATATCCTCTAATTTTATGTATAAATGAAGAGGGTT
TTGCTAATATAGTCTCAATGATCACAGGTCATGTTATCAATCATCATAAC
TTTCGTCAGCAAGTTAATTGTGTATCTTTCAGTCCAAATGGCAAATTTTT
TGCTATAGGAAGGGGAAAATTAGTAATGGTTTATTATGCACCGTCTTTAG
AGAAACCACTCACTCAACTCCGTCTTCAGCGTACATATGACGGGTCATCG
GCTGATGTCAGATCTATTGATTGGTCTAGCGATTCAAAAGCATTTGCAGT
CGGTTCCGACGATAACAGTACTAGAGTTTACGCGGCGTTTAAAACTGAAA
AATTGATTATATACTCCCTTGGAGGAAACGAAGGAAATGTAATAAAGTGT
TGCTTTATGAAAAACAGTTTGGATGTTTTTAGTGTTAGTAAAAACGCTCA
ATTATGCTTCTGGAAATGTAATAAATCACTGGAATTTCTTAGTAATGACG
AACCTAATAAAACTGAAGTGTCAGTTAAAAAGAAGAATAAAAATGTTGTG
ACATACTTGAAATCTAAAAATCTTTATTATCGAAATATCCAAACAGATAA
ACAATTACAAATCGAAGTTACCGTTGCGGATTTTAATGTGCACATTAATT
TTCTCGTCACTGGTTTTGTTGATGGTAACATTATGATTCACGAAATGCCT
GATTTCAGTCCGCGATATTATTTAAAGTAAAATTTTAAAATAATCATCTT
TGGTTTACTTTTTCAGAGTATGTGAAGGAGAGATTCGAACAATTGCCTTT
AATGGTATTGGAAATTGGATAGCTATAGGTAGTCAGGAAGATAATCAATT
AAATGTATTTTGTTGGAAATCTCAAAGTTACATATTCCAATCTAAAGGTC
ATAAAAGATCATTGGTAAACTGTTTGGATTATAGCCCAGATGGAATTCAA
TTGGTTACTGGCGGTCGAGAAGGAAATGTAAAATTCTGGCAGATATCGAA
TGGGCGTTGCTTTGCCACATTTAGTAATCATAGCGGACCGGTGACTGGAG
TTGTGTTTCCTAAACAGAAACCGCAAACCGTGTTTTCCAGTTCACTGGAT
GGAACAGTTTGTGGATATGATTTGACACGGCTGAAAAACTTTTGCACATT
GACAGCTGAGGAGCGATCATATCAATTTACTTGTGTCGCTTCGGATTATA
AAGGTGAGTTGGTTGCTGCTGGCGGCGGGACGGATTGTTTTTCGGCATTG
GTTTGGCAGGTAAAAACTAGAAAATTGATGTACATGTTATGCGATCACGA
ACAACCGGTTTGTTCAATCGAATACGCGGTCAATGTATCCGGCATTTACC
TTGTCACCGGTAGTTGGGATAAGACGATGAGGATTTGGCAGTTTTCTGGC
GATAACACCAGTGAGGTCATCACAAATACTTCGGACGTATTGGCTGTTGC
TTTCCGGCCGGATGGATTAGAAATTGCTGGGGCATTGCTGAATGGCAATC
TCGTGTTTTATGATGCATTGACCGGAGATCAGGTAAAGGAAATCGAAGGC
AAACACGATTTGGGATTTTCCAAACACGATGGAGAGCTGTTGTCGGTGGT
AAAAGTTTCCGAGGAAAAGAATTTCCAAGCGATTTGCTATTCTGCTGATG
GCAAACTATTGCTTGCTGGCGGTAATTCGAAATACATTTGTCTGTATTCA
ATCGAACAGAAATTGCTGTTGAAACGGTTCCAAATATCATGCAACATGTC
ATTAGATGGGATTTTAGAAATCCACGATAGGCGCAAAATTACCGAATGGG
GATTTTCTGATGCCATCATCGATATGTCTGACAAGAAGATTACTCCCGGT
GCCGTTGACGTGATGAATAGCAAACGGCAACTCAAGCTCGATGTCATGGT
TACCAGCATAAAGTTCTCACCGACTGGTACGCAATTTGCTGCCGCCACAT
CTGAGGGAGTAATGGTGTTTTCCGGTGAGAAGGTTTTCCGGAGTATTGAT
TATATCGGCGGCGTGATCGATTTCTCACAATTCCAGCTGGATTTGTCTCC
GGAATCGATCAGGCGGGATTTGGCTGAAAGGAAATATTCACGAGCACTCA
ATGACGCATTGAAATTGAAAAAACTCGATTTGTTGACAGAGGTGATCGAA
TCAATACCGATCTATGAGACGGCGTTCATTGTCAAGCAATTGGATATCAA
TGAAGTTGGGGTAGCGTTATGCAGATATTTGACACGCCAGTTGAAAGAGT
CGGTTAATGTTGGATTCTATTCCAATTGGCTGAAAATTGTGCTGGTTGAG
TGGACGGAAACCATTTGGAATTCATCAGATTCCCAGTGGAAAAATATTTC
ATTGGATATTGTCAATTGTGCAAAATTAAACAAATCAAAACTCTCAGGGG
AGTCCGCTGCAATCCATCAAGAAGCATTACTCAGATCAATTGTTCAAAAG
GAGTCGAAAAAATTGGAATAA
back to top

protein sequence of SMED30030438-orf-1

>SMED30030438-orf-1 ID=SMED30030438-orf-1|Name=SMED30030438-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MKNNYQFSSIIGSSYQNGQICFLPDGNSILSPVGNNISVLYLKRDEIKTI
EVNSSYNIQHIAVSPKYPLILCINEEGFANIVSMITGHVINHHNFRQQVN
CVSFSPNGKFFAIGRGKLVMVYYAPSLEKPLTQLRLQRTYDGSSADVRSI
DWSSDSKAFAVGSDDNSTRVYAAFKTEKLIIYSLGGNEGNVIKCCFMKNS
LDVFSVSKNAQLCFWKCNKSLEFLSNDEPNKTEVSVKKKNKNVVTYLKSK
NLYYRNIQTDKQLQIEVTVADFNVHINFLVTGFVDGNIMIHEMPDFSPRY
YLK*
back to top

protein sequence of SMED30030438-orf-2

>SMED30030438-orf-2 ID=SMED30030438-orf-2|Name=SMED30030438-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MYMLCDHEQPVCSIEYAVNVSGIYLVTGSWDKTMRIWQFSGDNTSEVITN
TSDVLAVAFRPDGLEIAGALLNGNLVFYDALTGDQVKEIEGKHDLGFSKH
DGELLSVVKVSEEKNFQAICYSADGKLLLAGGNSKYICLYSIEQKLLLKR
FQISCNMSLDGILEIHDRRKITEWGFSDAIIDMSDKKITPGAVDVMNSKR
QLKLDVMVTSIKFSPTGTQFAAATSEGVMVFSGEKVFRSIDYIGGVIDFS
QFQLDLSPESIRRDLAERKYSRALNDALKLKKLDLLTEVIESIPIYETAF
IVKQLDINEVGVALCRYLTRQLKESVNVGFYSNWLKIVLVEWTETIWNSS
DSQWKNISLDIVNCAKLNKSKLSGESAAIHQEALLRSIVQKESKKLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR027145PWP2
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030515snoRNA binding
Vocabulary: biological process
TermDefinition
GO:0000028ribosomal small subunit assembly
GO:0000462maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0032040small-subunit processome
GO:0034388Pwp2p-containing subcomplex of 90S preribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 177..216
e-value: 5.3
score: 12.4
coord: 259..292
e-value: 32.0
score: 7.5
coord: 86..123
e-value: 7.6
score: 11.4
coord: 133..172
e-value: 1.3E-4
score: 31.4
IPR001680WD40 repeatPFAMPF00400WD40coord: 86..117
e-value: 0.0037
score: 18.1
coord: 136..171
e-value: 0.0012
score: 19.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 140..171
score: 8.904
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 36..300
e-value: 1.7E-25
score: 91.6
IPR027145Periodic tryptophan protein 2PANTHERPTHR19858WD40 REPEAT PROTEINcoord: 1..298
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 140..225
score: 9.837
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 18..295