Serine/arginine-rich splicing factor

Overview
NameSerine/arginine-rich splicing factor
Smed IDSMED30030435
Length (bp)1275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/arginine-rich splicing factor (SMED30030435) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/arginine-rich splicing factor (SMED30030435) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/arginine-rich splicing factor (SMED30030435) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/arginine-rich splicing factor (SMED30030435) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030435

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030435SMESG000015564.1 SmedASXL_019277SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030435SMESG000015564.1 SmedASXL_019277SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030435SMESG000015564.1 dd_Smed_v4_3431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030435SMESG000015564.1 dd_Smed_v6_3431_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030435SMESG000015564.1 dd_Smed_v6_3431_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30030435SMESG000015564.1 dd_Smed_v6_3431_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30030435SMESG000015564.1 dd_Smed_v6_3431_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Match: SRSF4 (serine and arginine rich splicing factor 4 [Source:HGNC Symbol;Acc:HGNC:10786])

HSP 1 Score: 200.675 bits (509), Expect = 9.126e-60
Identity = 100/175 (57.14%), Postives = 129/175 (73.71%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS +A ERDVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA+++L+ K+L G RV++EHAR  RR          +            P RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R+NEG++EF + +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Match: SRSF4 (serine and arginine rich splicing factor 4 [Source:HGNC Symbol;Acc:HGNC:10786])

HSP 1 Score: 201.06 bits (510), Expect = 1.011e-58
Identity = 100/175 (57.14%), Postives = 129/175 (73.71%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS +A ERDVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA+++L+ K+L G RV++EHAR  RR          +            P RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R+NEG++EF + +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 187.578 bits (475), Expect = 1.132e-56
Identity = 100/181 (55.25%), Postives = 130/181 (71.82%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA----------XXXXXXXXXXXXXXXFAG----NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ ++ LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHA            G RS     SSRR +G      P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 188.734 bits (478), Expect = 2.012e-56
Identity = 100/181 (55.25%), Postives = 130/181 (71.82%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA----------XXXXXXXXXXXXXXXFAG----NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ ++ LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHA            G RS     SSRR +G      P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 188.348 bits (477), Expect = 3.257e-56
Identity = 97/181 (53.59%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ ++ LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHAR  RR    +    R  G                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Match: rsp-2 (Probable splicing factor, arginine/serine-rich 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23120])

HSP 1 Score: 152.91 bits (385), Expect = 4.196e-43
Identity = 79/185 (42.70%), Postives = 118/185 (63.78%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTG-EVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRL +RAS+RDVE FF+GYG++ D+ +K+G+GFV+F ++RDADDA+HDL+ KEL G RV+LE     +       S   F G                 + P  T +RL+++NL +R SWQD+KD +RK G E  +++AHKR  N+ IV F +  D++ A+ K  G +++GRKL+  ++
Sbjct:    1 MVRVYIGRLPNRASDRDVEHFFRGYGKLSDVIMKNGFGFVDFQDQRDADDAVHDLNGKELCGERVILEFP-RRKVGYNEERSGSGFRGREPTFRKGGERQFSNRYSRPCSTRFRLVIDNLSTRYSWQDIKDHIRKLGIEPTYSEAHKRNVNQAIVCFTSHDDLRDAMNKLQGEDLNGRKLKCTDE 184          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 152.91 bits (385), Expect = 9.472e-43
Identity = 82/199 (41.21%), Postives = 124/199 (62.31%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNA--------------------------------PIRTDYRLLVENLPSRVSWQDLKDLMRKTG-EVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            AR++IGRL+ R SE+D+E FF+GYG+I+D+ LK+G+GFVEFD++RDA+DA+HDL+ KEL G RV+L++++       R        G A                                P  T +R++VENL SR+SWQDLKD +R+ G E  +A+AHK R NE ++ F T +D+K  ++K DG +++GRK+++ +D
Sbjct:    3 ARIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQDLKDQVRRQGVEPTYAEAHK-RPNEALLCFATPSDLKRCIEKCDGMDLNGRKIKMIDD 200          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 103.219 bits (256), Expect = 4.370e-26
Identity = 58/144 (40.28%), Postives = 83/144 (57.64%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNA--------------------------------PIRTDYRLLVENLPSRVSWQDLK 423
            AR++IGRL+ R SE+D+E FF+GYG+I+D+ LK+G+GFVEFD++RDA+DA+HDL+ KEL G RV+L++++       R        G A                                P  T +R++VENL SR+SWQ  K
Sbjct:    3 ARIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQQEK 146          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 103.219 bits (256), Expect = 4.370e-26
Identity = 58/144 (40.28%), Postives = 83/144 (57.64%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNA--------------------------------PIRTDYRLLVENLPSRVSWQDLK 423
            AR++IGRL+ R SE+D+E FF+GYG+I+D+ LK+G+GFVEFD++RDA+DA+HDL+ KEL G RV+L++++       R        G A                                P  T +R++VENL SR+SWQ  K
Sbjct:    3 ARIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQQEK 146          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 84.3445 bits (207), Expect = 2.564e-18
Identity = 62/171 (36.26%), Postives = 84/171 (49.12%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGRIKDIRLKSG----YGFVEFDNERDADDAIHDLHHKELAGGRV----------------VLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFD 543
            +V++G L     E++VE  F  YGRIK + +KSG    + FVEF++ RDA+DA+      E  G R+                 L+     R    R        G    RT YR++VE LP   SWQDLKD MR  G+V +AD    R   G+VEF    D+K A++K D
Sbjct:   10 KVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFTRGVGPRGPGGRPLQDGGDHRGGDFRGGRGGGRGGGPQRRTGYRVIVEGLPPTGSWQDLKDHMRDAGDVCYADVA--RDGTGVVEFTRYEDVKYAVRKLD 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0082801)

HSP 1 Score: 178.718 bits (452), Expect = 5.888e-52
Identity = 95/183 (51.91%), Postives = 127/183 (69.40%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RV++G L     ERD+ERFFKGYGR +DI +K+GYGFVEF++ RDADDA+++L+ KEL G RVV+E AR   R   R     R+ G                   P+RT+YRL+VENL SRVSWQDLKD MR+ GEV +ADAHK+R+NEG+VEF + +DMK A++K D  E++GR++ + ED
Sbjct:    4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 186          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308196)

HSP 1 Score: 178.718 bits (452), Expect = 5.888e-52
Identity = 95/183 (51.91%), Postives = 127/183 (69.40%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RV++G L     ERD+ERFFKGYGR +DI +K+GYGFVEF++ RDADDA+++L+ KEL G RVV+E AR   R   R     R+ G                   P+RT+YRL+VENL SRVSWQDLKD MR+ GEV +ADAHK+R+NEG+VEF + +DMK A++K D  E++GR++ + ED
Sbjct:    4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 186          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0082806)

HSP 1 Score: 178.718 bits (452), Expect = 5.888e-52
Identity = 95/183 (51.91%), Postives = 127/183 (69.40%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RV++G L     ERD+ERFFKGYGR +DI +K+GYGFVEF++ RDADDA+++L+ KEL G RVV+E AR   R   R     R+ G                   P+RT+YRL+VENL SRVSWQDLKD MR+ GEV +ADAHK+R+NEG+VEF + +DMK A++K D  E++GR++ + ED
Sbjct:    4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 186          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308197)

HSP 1 Score: 177.178 bits (448), Expect = 2.242e-51
Identity = 95/188 (50.53%), Postives = 127/188 (67.55%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG----------------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RV++G L     ERD+ERFFKGYGR +DI +K+GYGFVEF++ RDADDA+++L+ KEL G RVV+E AR   R   R     R+ G                        P+RT+YRL+VENL SRVSWQDLKD MR+ GEV +ADAHK+R+NEG+VEF + +DMK A++K D  E++GR++ + ED
Sbjct:    4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308195)

HSP 1 Score: 177.178 bits (448), Expect = 2.242e-51
Identity = 95/188 (50.53%), Postives = 127/188 (67.55%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG----------------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RV++G L     ERD+ERFFKGYGR +DI +K+GYGFVEF++ RDADDA+++L+ KEL G RVV+E AR   R   R     R+ G                        P+RT+YRL+VENL SRVSWQDLKD MR+ GEV +ADAHK+R+NEG+VEF + +DMK A++K D  E++GR++ + ED
Sbjct:    4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 198.749 bits (504), Expect = 9.556e-61
Identity = 100/181 (55.25%), Postives = 131/181 (72.38%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG---------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R          RF+                  P+RT++R++VENL SR+SWQDLKDLMRK GEV F DAH+ ++NEG+VEF + +DMK A++K DG +++GRKL++YED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 184          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 198.749 bits (504), Expect = 9.556e-61
Identity = 100/181 (55.25%), Postives = 131/181 (72.38%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG---------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R          RF+                  P+RT++R++VENL SR+SWQDLKDLMRK GEV F DAH+ ++NEG+VEF + +DMK A++K DG +++GRKL++YED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 184          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 195.667 bits (496), Expect = 3.111e-58
Identity = 96/178 (53.93%), Postives = 127/178 (71.35%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEH-----------AXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV++G+LS RA E+DVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA++DL+ K+L G RV++EH           +    R  R            P RTDYRL+VENL SR SWQDLKD MR+ GEV +AD +K R+NEG++EF+  +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MSRVYVGKLSYRAREKDVERFFKGYGKILEVDLKNGYGFVEFDDPRDADDAVYDLNGKDLCGKRVIVEHTIGQRRDGGNRSGRSNRYGRGGGGGGGDRYGPPTRTDYRLIVENLSSRCSWQDLKDYMRQAGEVTYADTNKGRKNEGVIEFRQYSDMKRALEKLDGTEVNGRKIRLIED 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Match: srsf5b (serine and arginine rich splicing factor 5b [Source:ZFIN;Acc:ZDB-GENE-040718-354])

HSP 1 Score: 186.037 bits (471), Expect = 1.675e-55
Identity = 97/177 (54.80%), Postives = 122/177 (68.93%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             R+FIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEFD+ RDA+DA+++L  KEL   RV +EHAR   R  R      RF                P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+   NEG+VEF + +D+K AL+K  G EI+GRK+++ E
Sbjct:    4 CRIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHARVRLRGGRGRGGGGRFPARYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPNLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLVE 180          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 183.726 bits (465), Expect = 1.635e-54
Identity = 100/212 (47.17%), Postives = 131/212 (61.79%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFV-------------------------------EFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG---------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFV                               EFD+ RDADDA+++L+ KEL   RV +EHARS R          RF+                  P+RT++R++VENL SR+SWQDLKDLMRK GEV F DAH+ ++NEG+VEF + +DMK A++K DG +++GRKL++YED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVVSIKTLEGLFCLRRASEVSVLLPPAVCFCLQEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 215          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 205.297 bits (521), Expect = 1.374e-58
Identity = 99/170 (58.24%), Postives = 134/170 (78.82%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGN---APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS RA ERDVERFFKG+G+I ++ LK+GYGFVEF++ RDA+DA+++++ +EL G RV++EHAR+ RR  R     R+   +    P+RT YRL VENL SR SWQDLKD MR+ GEV +ADAH+RRQNEG++EF++ +DM+ AL+K DG EI+GRK+++ ED
Sbjct:    6 MPRVYIGRLSHRARERDVERFFKGFGKIVEVDLKNGYGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARAPRRDIRSGYGYRKGGSDKYGPPVRTMYRLRVENLSSRCSWQDLKDFMRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRKIQLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 205.297 bits (521), Expect = 1.630e-58
Identity = 99/170 (58.24%), Postives = 134/170 (78.82%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGN---APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS RA ERDVERFFKG+G+I ++ LK+GYGFVEF++ RDA+DA+++++ +EL G RV++EHAR+ RR  R     R+   +    P+RT YRL VENL SR SWQDLKD MR+ GEV +ADAH+RRQNEG++EF++ +DM+ AL+K DG EI+GRK+++ ED
Sbjct:    6 MPRVYIGRLSHRARERDVERFFKGFGKIVEVDLKNGYGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARAPRRDIRSGYGYRKGGSDKYGPPVRTMYRLRVENLSSRCSWQDLKDFMRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRKIQLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:Xenbase;Acc:XB-GENE-489112])

HSP 1 Score: 187.193 bits (474), Expect = 5.006e-56
Identity = 99/185 (53.51%), Postives = 125/185 (67.57%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXX--------XXXFA-----------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ K L   RV +EHAR+ R                  RFA              P+RT++R++VENL SRVSWQDLKD MRK GEV + DAH+  +NEG+VEF +  DMK AL K DG E+SGRK+++ ED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKVLCNERVTIEHARNRRGRGGMMGGGGGGGGRYPNRFAYRQSNSGGPSRYGPPVRTEHRIIVENLSSRVSWQDLKDFMRKAGEVTYVDAHRSNRNEGVVEFASYTDMKNALDKLDGVELSGRKIKLTED 188          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:Xenbase;Acc:XB-GENE-489112])

HSP 1 Score: 186.808 bits (473), Expect = 7.961e-56
Identity = 99/185 (53.51%), Postives = 125/185 (67.57%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXX--------XXXFA-----------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ K L   RV +EHAR+ R                  RFA              P+RT++R++VENL SRVSWQDLKD MRK GEV + DAH+  +NEG+VEF +  DMK AL K DG E+SGRK+++ ED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKVLCNERVTIEHARNRRGRGGMMGGGGGGGGRYPNRFAYRQSNSGGPSRYGPPVRTEHRIIVENLSSRVSWQDLKDFMRKAGEVTYVDAHRSNRNEGVVEFASYTDMKNALDKLDGVELSGRKIKLTED 188          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Match: srsf5 (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:448003])

HSP 1 Score: 186.037 bits (471), Expect = 1.573e-55
Identity = 98/177 (55.37%), Postives = 123/177 (69.49%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFA------------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             RVFIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEFD+ RDADDA+++L  KEL   RV +EHAR   R   R     R+                PIRT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF + +D+K A++K  G EI+GRK+++ E
Sbjct:    4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDADDAVYELDGKELCNERVTIEHARLRSRGGPRGLGRGRYNDRFSSRRPRGDRSAPPIRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNAIEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Match: Srsf4 (serine/arginine-rich splicing factor 4 [Source:MGI Symbol;Acc:MGI:1890577])

HSP 1 Score: 202.216 bits (513), Expect = 2.812e-59
Identity = 100/175 (57.14%), Postives = 129/175 (73.71%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS +A ERDVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA+++L+ K+L G RV++EHAR  RR          +            P RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R+NEG++EF + +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Match: Srsf6 (serine/arginine-rich splicing factor 6 [Source:MGI Symbol;Acc:MGI:1915246])

HSP 1 Score: 190.274 bits (482), Expect = 2.423e-56
Identity = 98/181 (54.14%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ +I LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHAR  RR    +    R  G                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 179.874 bits (455), Expect = 2.969e-53
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXX-XFAG--------NA-PIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             RVFIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEF++ RDADDA+++L  KEL   RV +EHAR+  R  R       RF+         NA P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF +  D+K A++K  G EI+GRK+++ E
Sbjct:    4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 179.874 bits (455), Expect = 2.969e-53
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXX-XFAG--------NA-PIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             RVFIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEF++ RDADDA+++L  KEL   RV +EHAR+  R  R       RF+         NA P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF +  D+K A++K  G EI+GRK+++ E
Sbjct:    4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 179.874 bits (455), Expect = 2.969e-53
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXX-XFAG--------NA-PIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             RVFIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEF++ RDADDA+++L  KEL   RV +EHAR+  R  R       RF+         NA P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF +  D+K A++K  G EI+GRK+++ E
Sbjct:    4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Match: sp|Q8VE97|SRSF4_MOUSE (Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.662e-58
Identity = 100/175 (57.14%), Postives = 129/175 (73.71%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS +A ERDVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA+++L+ K+L G RV++EHAR  RR          +            P RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R+NEG++EF + +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Match: sp|Q08170|SRSF4_HUMAN (Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 4.856e-58
Identity = 100/175 (57.14%), Postives = 129/175 (73.71%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS +A ERDVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA+++L+ K+L G RV++EHAR  RR          +            P RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R+NEG++EF + +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Match: sp|G3V6S8|SRSF6_RAT (Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus OX=10116 GN=Srsf6 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.695e-55
Identity = 98/181 (54.14%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ +I LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHAR  RR    +    R  G                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Match: sp|Q3TWW8|SRSF6_MOUSE (Serine/arginine-rich splicing factor 6 OS=Mus musculus OX=10090 GN=Srsf6 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.695e-55
Identity = 98/181 (54.14%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ +I LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHAR  RR    +    R  G                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Match: sp|Q13247|SRSF6_HUMAN (Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 4.288e-55
Identity = 97/181 (53.59%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--------------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYGR+ ++ LK+GYGFVEF++ RDADDA+++L+ KEL G RV++EHAR  RR    +    R  G                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R NEG++EF++ +DMK AL K DG EI+GR +R+ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Match: A0A1S8WLU0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_08917 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.226e-63
Identity = 106/169 (62.72%), Postives = 131/169 (77.51%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG--NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV+IG L  R SERD+ERFFKGYGR++D+ LK+GYGFVEFDNE+DADDA++DLH +EL G R+++EHAR    S      S         P RT+YR++VENL SRVSWQDLKDLMRK G+V +ADAHK  +N+GIVEF   ADMK A++KFDGYE+ GRKLR+YED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHARLPPGSRGGSRRSGGGRDRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 169          
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Match: A0A4S2LP49 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005846 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.584e-63
Identity = 106/170 (62.35%), Postives = 131/170 (77.06%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG---NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV+IG L  R SERD+ERFFKGYGR++D+ LK+GYGFVEFDNE+DADDA++DLH +EL G R+++EHAR    S      S          P RT+YR++VENL SRVSWQDLKDLMRK G+V +ADAHK  +N+GIVEF   ADMK A++KFDGYE+ GRKLR+YED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHARLPPGSRGGSRRSGGGRDRRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 170          
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Match: A0A419QAN3 (Serine/arginine-rich splicing factor 4 OS=Clonorchis sinensis OX=79923 GN=Srsf4 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.584e-63
Identity = 106/170 (62.35%), Postives = 131/170 (77.06%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG---NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV+IG L  R SERD+ERFFKGYGR++D+ LK+GYGFVEFDNE+DADDA++DLH +EL G R+++EHAR    S      S          P RT+YR++VENL SRVSWQDLKDLMRK G+V +ADAHK  +N+GIVEF   ADMK A++KFDGYE+ GRKLR+YED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHARLPPGSRGGSRRSGGGRDRRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 170          
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Match: A0A183P8C4 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10610 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.652e-62
Identity = 105/179 (58.66%), Postives = 132/179 (73.74%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA------XXXXXXXXXXXXXXXFAGN------APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV++GR+  R  ERD+ERFFKGYGR++DI LK+GYGFVEFDNE+DADDA++DLH ++L G R+++EHA      R G R          F  N       P RT+YR++VENL +RVSWQDLKDLMRK GEV +ADAHK  +N+GIVEF    DMK A++KFDGYE+ GRKLR+YED
Sbjct:    1 MSRVYVGRIPPRCCERDIERFFKGYGRLRDIVLKNGYGFVEFDNEKDADDAVYDLHGRDLRGERLIVEHARLPPGTRGGSRRAGGGGGGGGFCSNRDRRYGPPTRTEYRVIVENLSTRVSWQDLKDLMRKAGEVTYADAHKSAKNDGIVEFAAYCDMKEAIEKFDGYELYGRKLRVYED 179          
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Match: A0A068WVX0 (Splicing factor arginine:serine rich 4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000195500 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.322e-62
Identity = 103/167 (61.68%), Postives = 129/167 (77.25%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+RV+IGRL  R  ERD+ERFF+GYGR++DI LK+GYGFVEFD+ERDADDA++DLH +EL G R+V+EHAR    +           G  P RTDYR++VENL SRVSWQDLKD+MRK GEV +ADAHK+ +NEGIVEF T  DMKAA+ K+DGY +  R+L++Y D
Sbjct:    1 MSRVYIGRLPARCCERDIERFFRGYGRLRDIVLKTGYGFVEFDDERDADDAVYDLHGRELRGERIVVEHARLPPGARGSSRRRESRYG-PPTRTDYRVIVENLSSRVSWQDLKDMMRKAGEVTYADAHKQVRNEGIVEFATYNDMKAAIDKYDGYVLYERRLKVYAD 166          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 194.897 bits (494), Expect = 2.070e-59
Identity = 96/174 (55.17%), Postives = 127/174 (72.99%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+R++IG+LS R  E+DVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA++DL+ K L G RV++EH +  RR          + G         P RTDYRL+VENL SR SWQDLKD MR+ GEV +AD +K R+NEG++EF+  +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MSRIYIGKLSYRVKEKDVERFFKGYGKILEVDLKNGYGFVEFDDPRDADDAVYDLNGKNLCGERVLVEHTKGPRRDGGNNSGRSNWYGRGGRDRYGPPTRTDYRLIVENLSSRCSWQDLKDYMRQAGEVTYADTNKGRRNEGVIEFRLYSDMKRALEKLDGTEVNGRKIRLIED 174          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:103034457])

HSP 1 Score: 191.43 bits (485), Expect = 8.627e-58
Identity = 99/182 (54.40%), Postives = 131/182 (71.98%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXX-----XXXFAG-----------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             RVFIGRLS  A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R             S RF G             P+RT++R++VENL SR+SWQDLKDLMRK G+V F DAH+  +NEG+VEF + +DMK A++K DG +++GRK++++ED
Sbjct:    4 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGGRFSPRFGGYRQSRSAGSRYGPPVRTEHRIVVENLSSRISWQDLKDLMRKVGDVTFVDAHRTNKNEGVVEFASHSDMKNAIEKLDGTDLNGRKIKLFED 185          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Match: srsf4 (serine and arginine rich splicing factor 4 [Source:ZFIN;Acc:ZDB-GENE-030131-591])

HSP 1 Score: 190.66 bits (483), Expect = 2.171e-57
Identity = 96/175 (54.86%), Postives = 127/175 (72.57%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXX-XXFAG-------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+R++IG+LS R  E+DVERFFKGYG+I ++ LK+GYGFVEFD+ RDADDA++DL+ K L G RV++EH +  RR           + G         P RTDYRL+VENL SR SWQDLKD MR+ GEV +AD +K R+NEG++EF+  +DMK AL+K DG E++GRK+R+ ED
Sbjct:    1 MSRIYIGKLSYRVKEKDVERFFKGYGKILEVDLKNGYGFVEFDDPRDADDAVYDLNGKNLCGERVLVEHTKGPRRDGGGAKEPHCNWYGRGGRDRYGPPTRTDYRLIVENLSSRCSWQDLKDYMRQAGEVTYADTNKGRRNEGVIEFRLYSDMKRALEKLDGTEVNGRKIRLIED 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 187.193 bits (474), Expect = 2.960e-56
Identity = 97/177 (54.80%), Postives = 123/177 (69.49%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFA------------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             R+FIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEFD+ RDA+DA+++L  KEL   RV +EHAR   R  R      RF                P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF + +D+K AL+K  G EI+GRK+++ E
Sbjct:    4 CRIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHARVRLRGGRGRGGGGRFPDRYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 187.193 bits (474), Expect = 2.960e-56
Identity = 97/177 (54.80%), Postives = 123/177 (69.49%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFA------------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             R+FIGRL+  A E+DVERFFKGYGRI+DI LK G+GFVEFD+ RDA+DA+++L  KEL   RV +EHAR   R  R      RF                P+RT+ RL+VENL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF + +D+K AL+K  G EI+GRK+++ E
Sbjct:    4 CRIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHARVRLRGGRGRGGGGRFPDRYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Match: SRSF5 (serine and arginine rich splicing factor 5 [Source:HGNC Symbol;Acc:HGNC:10787])

HSP 1 Score: 170.629 bits (431), Expect = 3.269e-50
Identity = 93/189 (49.21%), Postives = 120/189 (63.49%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXX------------------------XXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            RVFI RL      +DVE+FFKGYG+I+DI +K+G+GFVEFD+ RDADDA+ DL+ +EL   R+ +EHAR+ R                          P    +S       P RTD+RL+VENL S VSWQDLKD MR+ GEV FADAH+  QN G+VEF TR DMK A+ K +G EI+GRK+++ E+
Sbjct:    6 RVFIARLGPHVRTKDVEKFFKGYGKIRDIDIKAGFGFVEFDDCRDADDAVSDLNGRELNNERMTVEHARAPRARGDRMDTFVRRPSGPPPTYRPRGGGPSSSSASSGGRYGPPSRTDHRLVVENLSSTVSWQDLKDYMRQAGEVTFADAHRIHQNVGVVEFATRNDMKNAIDKLNGKEINGRKIKLVEE 194          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010377.1 (pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene:ENSPMAG00000009397.1 transcript:ENSPMAT00000010377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 2.936e-49
Identity = 88/181 (48.62%), Postives = 117/181 (64.64%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA--------------XXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+R+++G LS RA ++D+ERFFKGYG+I +I +K G+GFVEFD+ RDA+DA+ +L  +EL G RVV+EHA                G                 P RTDYRL+VEN+ SR SWQDLKD MR+ GEV +AD    R +EG+VEF T ADM+ AL K DG ++ GRK+R+ E+
Sbjct:    1 MSRIYLGNLSYRARDKDIERFFKGYGKIVEISIKHGFGFVEFDDTRDANDAVCELSGRELCGERVVIEHARGPKRDLHGYGGGGGGGGGGSSSSGGGYGGMHGPPPRTDYRLVVENVSSRCSWQDLKDYMRQAGEVTYADV---RGDEGVVEFLTYADMRRALDKLDGSDMYGRKIRLTEE 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008861.1 (pep scaffold:Pmarinus_7.0:GL476733:183781:191694:-1 gene:ENSPMAG00000008001.1 transcript:ENSPMAT00000008861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 9.404e-48
Identity = 85/172 (49.42%), Postives = 122/172 (70.93%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNA-----PIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            MAR+++G+LS +ASE+D+ERF +G+G+I +I LK+GY FVE ++ RDAD A+++L+ ++L G  VV+EHAR     P    +S  F G +     PIRT+YRL+VENL +R   + LKD +R+ GEVM+ +AH  R NEG VEF+T  DMK AL + DG E+ GRKL++ E+
Sbjct:    1 MARLYLGKLSYKASEKDIERFLRGFGKIVEISLKNGYAFVELEDGRDADSAVYELNGRDLCGDPVVVEHARGRPGGPLGVGASSIFGGRSGLYRPPIRTEYRLVVENLSTRCDAEQLKDSLRRAGEVMYGEAHVERDNEGFVEFRTFVDMKRALDELDGMELFGRKLKLREE 172          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Match: srsf3a (serine and arginine rich splicing factor 3a [Source:ZFIN;Acc:ZDB-GENE-030616-631])

HSP 1 Score: 59.3066 bits (142), Expect = 8.571e-11
Identity = 26/72 (36.11%), Postives = 45/72 (62.50%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDI---RLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA 294
             +V++G L +  ++ ++ER F  YG ++ +   R   G+ FVEF++ RDA DA+ +L  + L G RV +EH+
Sbjct:   15 CKVYVGNLGNNGNKAELERSFSYYGPLRSVWVARAPPGFAFVEFEDPRDAGDAVRELDGRTLCGSRVRVEHS 86          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006373.1 (pep scaffold:Pmarinus_7.0:GL478975:164155:166212:-1 gene:ENSPMAG00000005755.1 transcript:ENSPMAT00000006373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.812e-8
Identity = 24/72 (33.33%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDI---RLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA 294
             +V++G L   A+E D+E+ F  YG ++ +   R   G+ FV+F++ RDA D+  +L  + + G RV +E +
Sbjct:   15 CKVYVGNLGSGATEYDLEKVFSYYGPLRSVWVARNPPGFAFVQFEDARDARDSCRELDGRLVCGSRVRVEMS 86          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Match: NPL3 (RNA-binding protein; promotes elongation, regulates termination, and carries poly(A) mRNA from nucleus to cytoplasm; represses translation initiation by binding eIF4G; required for pre-mRNA splicing; interacts with E3 ubiquitin ligase Bre1p, linking histone ubiquitination to mRNA processing; may have role in telomere maintenance; dissociation from mRNAs promoted by Mtr10p; phosphorylated by Sky1p in cytoplasm; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002840])

HSP 1 Score: 67.781 bits (164), Expect = 7.999e-13
Identity = 42/167 (25.15%), Postives = 77/167 (46.11%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTG-EVMFADAHKRR-QNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            R+F+        E ++   F  +G +K++++ +G+ FVEF+    A  AI ++H K  A   + + +++   +                    YR+ ++NLP   SWQDLKDL R+   E  F+  + R     G +EF +   +  AL++ +  E  G  + +  D
Sbjct:  126 RLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKR-------------------YRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVERD 273          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Match: HRB1 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; HRB1 has a paralog, GBP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004949])

HSP 1 Score: 60.8474 bits (146), Expect = 1.603e-10
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query:   94 VFIGRLSDRASERDVERFFKGYGRI--KDIRLKSGY----GFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAH----KRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRI 576
            +F+G L+  ++  D+  FF   G++   DI    G+    G VEF N  D D AI           ++ +        +  +   +         R  + ++V+NLP+ V+WQ LKD+ ++ G V  AD            G V F    D+  A++K++GY I G  L +
Sbjct:  163 IFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDV 333          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 51.9878 bits (123), Expect = 7.789e-8
Identity = 42/176 (23.86%), Postives = 78/176 (44.32%), Query Frame = 1
Query:   94 VFIGRLSDRASERDVERFFKGYGRIKDIRLKS------GYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAP---IRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADA----HKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
            +F+  L+   +  D++  F   G + +  + +      G G VEF       DAI          G + ++     R+     ++++ F+  A    I   + + + NLP  ++WQ LKD+ ++ G V+ AD     +   +  G V + T  +M  A+  F+G E+ GR L + E
Sbjct:  124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRGMGTVEFTKNESVQDAISKFD------GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVRE 293          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Match: NAB3 (RNA-binding protein, subunit of Nrd1 complex (Nrd1p-Nab3p-Sen1p); complex interacts with exosome to mediate 3'-end formation of some mRNAs, snRNAs, snoRNAs, and CUTs; required for termination of non-poly(A) transcripts and efficient splicing; Nrd1-Nab3 pathway appears to have a role in rapid suppression of some genes when cells are shifted to poor growth conditions, indicating role for Nrd1-Nab3 in regulating cellular response to nutrient availability [Source:SGD;Acc:S000006111])

HSP 1 Score: 50.8322 bits (120), Expect = 2.916e-7
Identity = 25/68 (36.76%), Postives = 39/68 (57.35%), Query Frame = 1
Query:   88 ARVFIGRLS-DRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLE 288
            +R+FIG L     S+ D+ R F  YG I  I +K+ +GF++FDN +   DAI     +   G +++LE
Sbjct:  330 SRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILE 397          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 48.521 bits (114), Expect = 1.178e-6
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRL--------KSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNE-----GIVEFKTRADMKAALKKFDGYEISGRKLRI 576
            A +F+GRLS    +  +++ F+  G +   R+          GYG+V+F+N+  A+ AI ++  KE+ G  +  + + S               G+ P      L + NL        + +L  K GEV+        + E     G V+F    D K AL    G  I  R +R+
Sbjct:  168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKF---GDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Match: EDO39290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ5])

HSP 1 Score: 169.859 bits (429), Expect = 8.132e-51
Identity = 86/178 (48.31%), Postives = 120/178 (67.42%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----------NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M+R+F+GRL     E DVE+F +GYG+I+DI LK GYGFVEFD+ RDA+DA+HDL+ ++L G RVV+E ++  R      D                    P+RT+Y ++VENL SR SWQDLKD  RK G+V +ADAHK+R  EG+VEF+++ D+  A++K D  E+ GR++R+YED
Sbjct:    1 MSRIFLGRLPRDVRESDVEKFLRGYGKIRDISLKRGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGRRSEGGGRDRRDFSGRGGRDGGRRPIYGPPVRTNYSVIVENLSSRTSWQDLKDYFRKYGKVTYADAHKKRIGEGVVEFESKDDLNTAIEKLDDTELGGRRIRVYED 178          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Match: EDO32443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV28])

HSP 1 Score: 169.088 bits (427), Expect = 1.184e-50
Identity = 90/171 (52.63%), Postives = 116/171 (67.84%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXX--------XXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRI 576
             RV+ GRL     ERD+E+F +GYGR+++I +K GYGFVEFD+ RDADD ++DL+ + L G RVV+EH+R+  R               S R     PIRT++RL VENL SR +WQDLK+ M K GEV FADAHKRRQ EG+VEF T+ DMK ALKK D  E  G+++R+
Sbjct:    5 TRVYFGRLPRDCRERDLEKFVRGYGRVREISMKLGYGFVEFDDYRDADDCVYDLNGRNLLGERVVVEHSRNPSRGSDYGYRRDSSSRSRSSRRGRTPPIRTEHRLAVENLSSRSNWQDLKEYMGKVGEVTFADAHKRRQGEGVVEFATKDDMKTALKKLDDTEFFGKRIRL 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Match: EDO47776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL13])

HSP 1 Score: 154.451 bits (389), Expect = 4.229e-45
Identity = 88/172 (51.16%), Postives = 114/172 (66.28%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIR-------TDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             RVF+GRL  RA++RD+E+FFKG+GRI DI LK G+ FVEFD+ RDADDA+++L+HKEL G RV +EHA             R F   +P R       T+YRL+VENL +R  WQDLKD MR+ GEV F   HK R  EG+ +F   +DM  ALKK DG E+ G+++R+ E
Sbjct:    6 GRVFVGRLPPRANDRDLEKFFKGFGRINDINLKQGFAFVEFDDARDADDAVYELNHKELLGERVSVEHA--HPSRGGGGGGGRGFRDRSPRRDRYPPYNTEYRLIVENLSTRAGWQDLKDYMRQAGEVTFTQCHKDRVGEGVCDFSNESDMLYALKKLDGTELFGKRIRLVE 175          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Match: EDO47549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM69])

HSP 1 Score: 149.828 bits (377), Expect = 1.717e-43
Identity = 77/166 (46.39%), Postives = 112/166 (67.47%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGR--IKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXF--AGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRI 576
            RV++GRL     E DV++FF  YGR  I++I LK GYGFVEFD   DA+DA+++ + K++ G R+++E AR   +         R       P+RT +R+ VENL SRVSWQDLKD  R+ G+V + DAHK++Q EG++EF T+ D+K AL+K DG E+ G+++R+
Sbjct:    4 RVYLGRLPYGTREDDVKKFFYTYGRFKIREIILKDGYGFVEFDYSDDAEDAVYECNGKKMLGERILVEPARGTSKGGYSSGRRGRARDKYGPPLRTPWRMTVENLSSRVSWQDLKDYCRQIGDVTYGDAHKQKQGEGVIEFATKKDLKKALRKLDGKELKGKRIRL 169          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Match: EDO31620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXE8])

HSP 1 Score: 129.413 bits (324), Expect = 1.046e-35
Identity = 59/171 (34.50%), Postives = 103/171 (60.23%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAG-----NAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
             +V+ GRL   A+E+D+E   K +G+++++  K GY +V F   +DAD A+  L++ E  G ++++E A+  R     + ++  +         P+R+++R++VENL +R  W +LK+ M   GEV +AD H+RR  EG+VEF T  DMK A+   D  E  G+++R+ ++
Sbjct:    3 GKVYCGRLPATATEKDLENLVKVFGKVREVDFKEGYAYVVFKENKDADRAVAALNNSEFHGAKILMEKAKEMRNGVGGYTAAGGYTARTRQMGPPVRSEFRVIVENLSTRAKWLELKEFMNNAGEVCYADTHRRRPGEGVVEFTTEEDMKRAIASLDKCEFYGKRIRLRQE 173          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 203.756 bits (517), Expect = 1.419e-62
Identity = 103/178 (57.87%), Postives = 132/178 (74.16%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGN------------APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RVFIGRLS +A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R          RF G              P+RT++RL+VENL SR+SWQDLKDLMRK GEV F DAH+  +NEG+VEF +R+D+K A+ K DG E++GRKL+I+ED
Sbjct:    4 SRVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYGPPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 204.142 bits (518), Expect = 2.363e-62
Identity = 103/178 (57.87%), Postives = 132/178 (74.16%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGN------------APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RVFIGRLS +A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R          RF G              P+RT++RL+VENL SR+SWQDLKDLMRK GEV F DAH+  +NEG+VEF +R+D+K A+ K DG E++GRKL+I+ED
Sbjct:    4 SRVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYGPPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 204.142 bits (518), Expect = 2.363e-62
Identity = 103/178 (57.87%), Postives = 132/178 (74.16%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGN------------APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            +RVFIGRLS +A ERDVE+FFKGYGRI++I LK+G+GFVEFD+ RDADDA+++L+ KEL   RV +EHARS R          RF G              P+RT++RL+VENL SR+SWQDLKDLMRK GEV F DAH+  +NEG+VEF +R+D+K A+ K DG E++GRKL+I+ED
Sbjct:    4 SRVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYGPPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Match: srsf5b (serine/arginine-rich splicing factor 5-like [Source:NCBI gene;Acc:105357348])

HSP 1 Score: 182.956 bits (463), Expect = 5.125e-54
Identity = 95/179 (53.07%), Postives = 121/179 (67.60%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFA--------------GNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYE 582
             R+FIGRLS  A E+DVERFFKGYGRI+DI LK G+GFVEFD+ RDA+DA+++L  KEL   RV +EHAR   R+ R                          P+RT+ RL+V+NL SRVSWQDLKD MR+ GEV FADAH+ + NEG+VEF + +D+K AL K  G EI+GRK+++ E
Sbjct:    4 CRIFIGRLSPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHARVRLRAGRGRGGGGGGGGGGRFNDRYSRGSRNPPPMRTENRLVVKNLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNALDKLSGKEINGRKIKLME 182          
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Match: srsf6a (serine and arginine rich splicing factor 6 [Source:NCBI gene;Acc:101162527])

HSP 1 Score: 179.104 bits (453), Expect = 2.524e-52
Identity = 84/167 (50.30%), Postives = 116/167 (69.46%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M RV+IGRLS    E+D++RFF GYG++ ++ +K+GYGFVEF++ RDADDA+++L+ KEL G           +                P+RT+YRL+VENL SR SWQDLKD MR+ GEV +ADAHK R N+G++EF++ +DMK AL K DG +I+GRK+R+ ED
Sbjct:    1 MPRVYIGRLSYHVREKDIQRFFSGYGKLLEVDMKNGYGFVEFEDNRDADDAVYELNGKELCGDSSSRTRVGRDKY-------------GPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNQGVIEFRSYSDMKRALDKLDGTDINGRKIRLVED 154          
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Match: SMESG000015564.1 (SMESG000015564.1)

HSP 1 Score: 386.341 bits (991), Expect = 3.951e-133
Identity = 325/325 (100.00%), Postives = 325/325 (100.00%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQTKXXXXXXXXXXXXXXXPMKNGIDNLDRSPSLKKNLXXXXXXXXXXXXXXXXXXXXXXXXXVHSNDSNSLKKTKKNESETDNRKRSVSREHSREDI 1059
            MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHARSGRRSPRRFDSSRRFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYEDSVRGRSRSRSLSSRSTSYRKGRKTVRRSSSSRRKSSRRSSSSKSYESRRSSSRSKSPQKRLQTKSSSRSHSKSPRRSNSPMKNGIDNLDRSPSLKKNLSKERSSSSKRKPSREKSESQSREHSVHSNDSNSLKKTKKNESETDNRKRSVSREHSREDI
Sbjct:    1 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHARSGRRSPRRFDSSRRFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYEDSVRGRSRSRSLSSRSTSYRKGRKTVRRSSSSRRKSSRRSSSSKSYESRRSSSRSKSPQKRLQTKSSSRSHSKSPRRSNSPMKNGIDNLDRSPSLKKNLSKERSSSSKRKPSREKSESQSREHSVHSNDSNSLKKTKKNESETDNRKRSVSREHSREDI 325          
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Match: SMESG000045501.1 (SMESG000045501.1)

HSP 1 Score: 177.178 bits (448), Expect = 2.389e-51
Identity = 93/188 (49.47%), Postives = 125/188 (66.49%), Query Frame = 1
Query:   85 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXX---------------------XXXXXXXFAGNAPIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 585
            M R+++G L  R  ERD+++FF+ YGRI+ + +K+GYGFVE D+ RDA+DA+HDL   +L G RV +E ARS  R                          DS  R+    PIR+++R++V +L SRVSWQDLKDLMRK GEV FADAHK R N+G+VEF   +DMKAA++K+DGYE+ G KL++YED
Sbjct:    1 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNARFGGDRGSGGDRGGRGFDNRNNRYDSRDSRDRYNSRKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 188          
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Match: SMESG000075205.1 (SMESG000075205.1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.752e-18
Identity = 57/183 (31.15%), Postives = 86/183 (46.99%), Query Frame = 1
Query:   88 ARVFIGRLSDRASERDVERFFKGYGRIKDI----RLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXF----------------AGNAP-------IRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEI 555
             +V++G L       +VE  FK YGRIKD+    R +S + FVE+++ RDA+DAIH  ++    G  + +E ++           S                   +GN P         T++R+ V  LP   SWQDLKD M+  G+V +AD    R   G+ ++    D+K ALK  D  E+
Sbjct:    7 TKVYVGNLPSDIRANEVESVFKKYGRIKDVDVKNRAESSFAFVEYESSRDAEDAIHGRNNYRYEGHTLKVEMSKGSGSDRGGRRGSGGGGYRGSYNGRYDDRNSGSGNRPKAFGTKSKSTEFRVRVSGLPQSASWQDLKDHMKAAGDVSYADVF--RDGTGVCDYLNEDDLKYALKTLDDSEL 187          
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Match: SMESG000077573.1 (SMESG000077573.1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.648e-16
Identity = 62/183 (33.88%), Postives = 93/183 (50.82%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGRIKDI----RLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHAXXXXXXXXXXXXXXXF--------AGNAPIR-TDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALK-----KFDGYEISGRKLRIYED 585
            ++++G L      RD++  F  +G+I DI    R K  + F+EFD+ RDA+DA+   +     G R+ +E  R    +   F S+R+           +AP R +++R+ V  LP   SWQDLKD MR+ G+V  AD    R   G+ EF    DMK A+K     KF  +E     +R+ ED
Sbjct:   11 KLYVGNLPPDIRHRDLDDLFYKFGKIVDIDIKDRKKPPFAFIEFDDPRDAEDAVTGRNGYNYDGYRLRVEFPRGNNENAGNFYSNRKAEEKNLTRNTTSAPSRRSEFRVYVSGLPPTGSWQDLKDHMREAGDVGHADVF--RDGTGVCEFLRVEDMKYAIKHLDDTKFKSHEGEISYIRVEED 191          
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Match: SMESG000013050.1 (SMESG000013050.1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.303e-9
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  352 APIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALK 534
             P  TDYR+ + N+P   +WQD+KD MR+ G+V +AD        G+ +F ++ D +  LK
Sbjct:  146 PPKSTDYRVFISNIPPYSNWQDIKDFMRRYGDVSYADVFG--NGTGVCDFVSKEDFRYVLK 204          

HSP 2 Score: 51.2174 bits (121), Expect = 3.824e-7
Identity = 23/72 (31.94%), Postives = 45/72 (62.50%), Query Frame = 1
Query:   91 RVFIGRLSDRASERDVERFFKGYGRIKDIRLKS----GYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHA 294
            ++++G L   ++ RD+E+ F  +G+I DI +K+     + F++FD+ RDA+DAI +  + +L G  + +E  
Sbjct:    6 KIYVGNLPPDSTSRDIEKLFSCFGKIIDIDIKNRNGPPFAFIQFDDRRDAEDAIRERDNYDLDGFSLRVEFP 77          
The following BLAST results are available for this feature:
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF49.126e-6057.14serine and arginine rich splicing factor 4 [Source... [more]
SRSF41.011e-5857.14serine and arginine rich splicing factor 4 [Source... [more]
SRSF61.132e-5655.25serine and arginine rich splicing factor 6 [Source... [more]
SRSF62.012e-5655.25serine and arginine rich splicing factor 6 [Source... [more]
SRSF63.257e-5653.59serine and arginine rich splicing factor 6 [Source... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-24.196e-4342.70Probable splicing factor, arginine/serine-rich 2 ... [more]
rsp-19.472e-4341.21Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-14.370e-2640.28Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-14.370e-2640.28Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-32.564e-1836.26Probable splicing factor, arginine/serine-rich 3 ... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B525.888e-5251.91gene:FBgn0004587 transcript:FBtr0082801[more]
B525.888e-5251.91gene:FBgn0004587 transcript:FBtr0308196[more]
B525.888e-5251.91gene:FBgn0004587 transcript:FBtr0082806[more]
B522.242e-5150.53gene:FBgn0004587 transcript:FBtr0308197[more]
B522.242e-5150.53gene:FBgn0004587 transcript:FBtr0308195[more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf5a9.556e-6155.25serine and arginine rich splicing factor 5a [Sourc... [more]
srsf5a9.556e-6155.25serine and arginine rich splicing factor 5a [Sourc... [more]
srsf43.111e-5853.93serine and arginine rich splicing factor 4 [Source... [more]
srsf5b1.675e-5554.80serine and arginine rich splicing factor 5b [Sourc... [more]
srsf5a1.635e-5447.17serine and arginine rich splicing factor 5a [Sourc... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm61.374e-5858.24glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
grm61.630e-5858.24glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
fnbp1l5.006e-5653.51formin binding protein 1 like [Source:Xenbase;Acc:... [more]
fnbp1l7.961e-5653.51formin binding protein 1 like [Source:Xenbase;Acc:... [more]
srsf51.573e-5555.37serine/arginine-rich splicing factor 5 [Source:NCB... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srsf42.812e-5957.14serine/arginine-rich splicing factor 4 [Source:MGI... [more]
Srsf62.423e-5654.14serine/arginine-rich splicing factor 6 [Source:MGI... [more]
Srsf52.969e-5356.57serine/arginine-rich splicing factor 5 [Source:MGI... [more]
Srsf52.969e-5356.57serine/arginine-rich splicing factor 5 [Source:MGI... [more]
Srsf52.969e-5356.57serine/arginine-rich splicing factor 5 [Source:MGI... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VE97|SRSF4_MOUSE2.662e-5857.14Serine/arginine-rich splicing factor 4 OS=Mus musc... [more]
sp|Q08170|SRSF4_HUMAN4.856e-5857.14Serine/arginine-rich splicing factor 4 OS=Homo sap... [more]
sp|G3V6S8|SRSF6_RAT1.695e-5554.14Serine/arginine-rich splicing factor 6 OS=Rattus n... [more]
sp|Q3TWW8|SRSF6_MOUSE1.695e-5554.14Serine/arginine-rich splicing factor 6 OS=Mus musc... [more]
sp|Q13247|SRSF6_HUMAN4.288e-5553.59Serine/arginine-rich splicing factor 6 OS=Homo sap... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WLU04.226e-6362.72Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LP494.584e-6362.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419QAN34.584e-6362.35Serine/arginine-rich splicing factor 4 OS=Clonorch... [more]
A0A183P8C43.652e-6258.66Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A068WVX05.322e-6261.68Splicing factor arginine:serine rich 4 OS=Echinoco... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf42.070e-5955.17serine and arginine rich splicing factor 4 [Source... [more]
srsf5a8.627e-5854.40serine and arginine rich splicing factor 5 [Source... [more]
srsf42.171e-5754.86serine and arginine rich splicing factor 4 [Source... [more]
srsf5b2.960e-5654.80serine/arginine-rich splicing factor 5 [Source:NCB... [more]
srsf5b2.960e-5654.80serine/arginine-rich splicing factor 5 [Source:NCB... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF53.269e-5049.21serine and arginine rich splicing factor 5 [Source... [more]
ENSPMAT00000010377.12.936e-4948.62pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene... [more]
ENSPMAT00000008861.19.404e-4849.42pep scaffold:Pmarinus_7.0:GL476733:183781:191694:-... [more]
srsf3a8.571e-1136.11serine and arginine rich splicing factor 3a [Sourc... [more]
ENSPMAT00000006373.15.812e-833.33pep scaffold:Pmarinus_7.0:GL478975:164155:166212:-... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NPL37.999e-1325.15RNA-binding protein; promotes elongation, regulate... [more]
HRB11.603e-1026.32Poly(A+) RNA-binding protein; key surveillance fac... [more]
GBP27.789e-823.86Poly(A+) RNA-binding protein; key surveillance fac... [more]
NAB32.916e-736.76RNA-binding protein, subunit of Nrd1 complex (Nrd1... [more]
NSR11.178e-625.00Nucleolar protein that binds nuclear localization ... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392908.132e-5148.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324431.184e-5052.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477764.229e-4551.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475491.717e-4346.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316201.046e-3534.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf5a1.419e-6257.87serine and arginine rich splicing factor 5 [Source... [more]
srsf5a2.363e-6257.87serine and arginine rich splicing factor 5 [Source... [more]
srsf5a2.363e-6257.87serine and arginine rich splicing factor 5 [Source... [more]
srsf5b5.125e-5453.07serine/arginine-rich splicing factor 5-like [Sourc... [more]
srsf6a2.524e-5250.30serine and arginine rich splicing factor 6 [Source... [more]
back to top
BLAST of Serine/arginine-rich splicing factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015564.13.951e-133100.00SMESG000015564.1[more]
SMESG000045501.12.389e-5149.47SMESG000045501.1[more]
SMESG000075205.13.752e-1831.15SMESG000075205.1[more]
SMESG000077573.13.648e-1633.88SMESG000077573.1[more]
SMESG000013050.12.303e-937.70SMESG000013050.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030435 ID=SMED30030435|Name=Serine/arginine-rich splicing factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1275bp
ATTAAAGTAAAAATTTAAAAAGTAGGCATTTTGTAAATTTTTATCTCAAT
TTTTAATTAAAATATATGTTAGCAATAATAACACATGGCAAGAGTTTTTA
TTGGTAGATTATCTGACAGGGCTAGTGAAAGGGATGTAGAGAGATTTTTT
AAAGGTTATGGAAGAATTAAAGATATTAGATTAAAAAGTGGTTATGGATT
TGTTGAATTTGACAATGAAAGAGATGCAGATGATGCTATTCATGATTTAC
ATCACAAAGAATTAGCTGGGGGAAGAGTTGTTTTAGAGCATGCTCGATCT
GGGAGAAGAAGTCCTCGTCGATTTGATAGTAGTAGAAGATTCGCAGGTAA
TGCACCGATTCGCACGGATTATCGACTTTTAGTTGAAAATCTTCCATCAA
GGGTCAGTTGGCAAGATTTAAAGGACTTAATGAGAAAAACAGGGGAAGTA
ATGTTTGCAGATGCTCACAAAAGAAGACAAAATGAAGGAATTGTTGAATT
TAAAACTCGAGCAGATATGAAAGCCGCATTAAAAAAATTTGATGGGTACG
AAATTAGTGGTAGAAAATTACGTATATATGAAGATAGCGTTCGAGGTCGT
TCAAGATCTAGATCACTATCTAGTCGTTCAACATCCTACAGAAAAGGCCG
AAAAACTGTTCGTCGTTCTAGCAGTAGTCGAAGGAAATCTTCACGGCGTT
CATCGTCAAGTAAATCATATGAAAGTAGACGCAGCTCATCCAGATCGAAA
AGCCCTCAAAAAAGGTTACAAACAAAATCTTCATCTAGAAGTCACAGTAA
AAGTCCTAGAAGATCAAACAGTCCCATGAAAAACGGCATAGACAATTTGG
ATCGATCACCATCTCTTAAAAAAAACTTATCAAAAGAAAGAAGTAGTTCT
TCAAAAAGAAAACCATCTCGCGAAAAAAGTGAAAGTCAATCAAGAGAACA
TAGTGTACATTCAAATGACAGTAATTCTTTAAAGAAAACTAAGAAAAATG
AATCGGAAACAGATAACCGTAAGCGAAGTGTATCAAGGGAGCATTCACGG
GAAGACATTTCAAGAAGCAGAAGTTATTCTGAAAATTCAAATTAATTTTT
GGCATTTAGTCTTAAAATTAAAATATAAATAGACTTAGAATATGGTTTTT
AAATAATTTAATGGTTAATGTTTGTTATCAAATAACATGTTGAAATGAAG
TAGTTGTAAGTTTTGTATAATGTTATAATTGTAAAAAATATAGAGACGAT
AAGTTAATTTCAATGGTATTTGAAG
back to top

protein sequence of SMED30030435-orf-1

>SMED30030435-orf-1 ID=SMED30030435-orf-1|Name=SMED30030435-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADD
AIHDLHHKELAGGRVVLEHARSGRRSPRRFDSSRRFAGNAPIRTDYRLLV
ENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALK
KFDGYEISGRKLRIYEDSVRGRSRSRSLSSRSTSYRKGRKTVRRSSSSRR
KSSRRSSSSKSYESRRSSSRSKSPQKRLQTKSSSRSHSKSPRRSNSPMKN
GIDNLDRSPSLKKNLSKERSSSSKRKPSREKSESQSREHSVHSNDSNSLK
KTKKNESETDNRKRSVSREHSREDISRSRSYSENSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035585RRM1_SRSF4-like
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 3..68
e-value: 5.0E-17
score: 72.6
coord: 97..165
e-value: 1.2E-14
score: 64.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 4..62
e-value: 1.4E-14
score: 53.6
coord: 98..163
e-value: 1.8E-13
score: 50.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 2..72
score: 16.483
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 96..164
score: 12.577
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..88
e-value: 3.8E-20
score: 73.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 95..168
e-value: 4.7E-23
score: 82.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 260..329
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 168..336
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 239..259
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..220
NoneNo IPR availablePANTHERPTHR23147:SF55SERINE/ARGININE-RICH SPLICING FACTOR 4coord: 1..289
NoneNo IPR availablePANTHERPTHR23147SERINE/ARGININE RICH SPLICING FACTORcoord: 1..289
NoneNo IPR availableCDDcd12600RRM2_SRSF4_likecoord: 96..167
e-value: 2.03171E-34
score: 119.01
IPR035585Serine/arginine-rich splicing factor SRSF4-like, RNA recognition motif 1CDDcd12337RRM1_SRSF4_likecoord: 3..71
e-value: 3.77379E-33
score: 115.502
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..163