Calcium-dependent protein kinase

Overview
NameCalcium-dependent protein kinase
Smed IDSMED30030428
Length (bp)1277
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30030428SMESG000077154.1 Contig5494_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 190.66 bits (483), Expect = 5.844e-56
Identity = 105/284 (36.97%), Postives = 166/284 (58.45%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--------IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   +  DVLG GA+++V    ++ T++  A+K          IAKE        +ENE  ++ K+ H NI      Y  G   YL+ +L +GGEL+D I+ K  Y+E +   +I QV+DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++   ++P +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P  R +  +A++H W +
Sbjct:   11 KQAEDIRDIY---DFRDVLGTGAFSEVILAEDKRTQKLVAIK---------CIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKM---EDPGSVLSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Match: CAMK1G (calcium/calmodulin dependent protein kinase IG [Source:HGNC Symbol;Acc:HGNC:14585])

HSP 1 Score: 192.586 bits (488), Expect = 1.214e-55
Identity = 106/275 (38.55%), Postives = 161/275 (58.55%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            K+  NI   +++ E   VLG GA+++V+    ++T +  A+K   +S         +ENE  ++ K+ H NI      Y     +YLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T E NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I+   + F    W + S     F+  LL+++P+ R +  KA+ H W 
Sbjct:   14 KQTTNIRKTFIFME---VLGSGAFSEVFLVKQRLTGKLFALKCIKKS--PAFRDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKM----EQNGIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWI 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Match: CAMK1G (calcium/calmodulin dependent protein kinase IG [Source:HGNC Symbol;Acc:HGNC:14585])

HSP 1 Score: 192.586 bits (488), Expect = 1.214e-55
Identity = 106/275 (38.55%), Postives = 161/275 (58.55%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            K+  NI   +++ E   VLG GA+++V+    ++T +  A+K   +S         +ENE  ++ K+ H NI      Y     +YLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T E NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I+   + F    W + S     F+  LL+++P+ R +  KA+ H W 
Sbjct:   14 KQTTNIRKTFIFME---VLGSGAFSEVFLVKQRLTGKLFALKCIKKS--PAFRDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKM----EQNGIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWI 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 184.496 bits (467), Expect = 8.712e-54
Identity = 99/263 (37.64%), Postives = 152/263 (57.79%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            E  + LG GA+++V     + T +  AVK   +   K      IENE  ++ K+ H NI      Y   N  YLV +L +GGEL+D I+ K  Y+E +  T+I+QV+DAV YLH  GIVHRD+KPEN+LY +++  S I + DFG+S++   +      +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A +H W +
Sbjct:   24 EFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGK-ESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKM---EGKGDVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA 280          
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 184.496 bits (467), Expect = 1.848e-53
Identity = 99/263 (37.64%), Postives = 152/263 (57.79%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            E  + LG GA+++V     + T +  AVK   +   K      IENE  ++ K+ H NI      Y   N  YLV +L +GGEL+D I+ K  Y+E +  T+I+QV+DAV YLH  GIVHRD+KPEN+LY +++  S I + DFG+S++   +      +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A +H W +
Sbjct:   24 EFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGK-ESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKM---EGKGDVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA 280          
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 179.489 bits (454), Expect = 1.707e-52
Identity = 97/264 (36.74%), Postives = 152/264 (57.58%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQI-TKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVL-IKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            +  DVLG GA++KV+   ++    + +AVK  ++   K    + +ENE +++ KL H NI +    Y      YLV +L TGGEL+D I+ K  Y+E +   +I+QV++AV ++H NG+VHRD+KPEN+LY  ++ +S I + DFG+S+     E      T   +  YVAPEVL  KP  Y K VD WS+G+I ++LL GYPP+  E+  +++  I   ++ F    W + S     F++ L+  +P  R +   A+ H W S
Sbjct:   23 DFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGK-EESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKT----EDSGVMATACGTPGYVAPEVLQQKP--YGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWIS 279          
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 166.392 bits (420), Expect = 6.437e-48
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            ++ + LGKGA++ V   +++ T  + A K  N  +      +++E EA I  KL H NI     +    +  YLVF L TGGEL+++I+ +  YSE +    I+Q+++++ Y HSNGIVHRD+KPEN+L  +K   + +KL DFG++      E    +  F  +  Y++PEVL K   Y+K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  S +  +L  NP  R+++ +A+K  W 
Sbjct:   13 DVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSE---AWHGFAGTPGYLSPEVLKKDP-YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 166.392 bits (420), Expect = 6.437e-48
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            ++ + LGKGA++ V   +++ T  + A K  N  +      +++E EA I  KL H NI     +    +  YLVF L TGGEL+++I+ +  YSE +    I+Q+++++ Y HSNGIVHRD+KPEN+L  +K   + +KL DFG++      E    +  F  +  Y++PEVL K   Y+K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  S +  +L  NP  R+++ +A+K  W 
Sbjct:   13 DVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSE---AWHGFAGTPGYLSPEVLKKDP-YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 166.392 bits (420), Expect = 6.437e-48
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            ++ + LGKGA++ V   +++ T  + A K  N  +      +++E EA I  KL H NI     +    +  YLVF L TGGEL+++I+ +  YSE +    I+Q+++++ Y HSNGIVHRD+KPEN+L  +K   + +KL DFG++      E    +  F  +  Y++PEVL K   Y+K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  S +  +L  NP  R+++ +A+K  W 
Sbjct:   13 DVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSE---AWHGFAGTPGYLSPEVLKKDP-YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 166.007 bits (419), Expect = 9.207e-48
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            ++ + LGKGA++ V   +++ T  + A K  N  +      +++E EA I  KL H NI     +    +  YLVF L TGGEL+++I+ +  YSE +    I+Q+++++ Y HSNGIVHRD+KPEN+L  +K   + +KL DFG++      E    +  F  +  Y++PEVL K   Y+K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  S +  +L  NP  R+++ +A+K  W 
Sbjct:   13 DVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSE---AWHGFAGTPGYLSPEVLKKDP-YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 173.326 bits (438), Expect = 1.418e-49
Identity = 94/263 (35.74%), Postives = 152/263 (57.79%), Query Frame = 3
Query:  114 MNDVLGKGAYAKVYCGLNQITKEKH-AVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            ++ +LG GA+++V    ++ +  +H AVK  ++   K    + +ENE  ++ +L H NI + +  Y   ++ YLV +L TGGEL+D I+ K  Y+E +   +I+Q+++AV+Y+H  G+VHRD+KPEN+LY + + +S I + DFG+S++    E      T   +  YVAPEVL  KP  Y K VD WS+G+I+++LL GYPP+  E   +++  I    F F    W E S     F+  L+      R +  +A+ H W S
Sbjct:   33 LHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGK-EESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKM----EDSGIMATACGTPGYVAPEVLAQKP--YGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWIS 288          
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333673)

HSP 1 Score: 172.17 bits (435), Expect = 3.028e-48
Identity = 91/260 (35.00%), Postives = 152/260 (58.46%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            ++ + LGKGA++ V   + + T  + A K  N  +      +++E EA I  KL+H NI     +    N  YLVF L TGGEL+++I+ +  YSE +    I+Q++++VN+ H NG+VHRD+KPEN+L  +K   + +KL DFG++   + D     +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  + ++++L  NP+ R+++A+A+KH W
Sbjct:   15 DIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDH--QAWFGFAGTPGYLSPEVLKKEP-YGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333675)

HSP 1 Score: 172.17 bits (435), Expect = 4.465e-48
Identity = 91/260 (35.00%), Postives = 152/260 (58.46%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            ++ + LGKGA++ V   + + T  + A K  N  +      +++E EA I  KL+H NI     +    N  YLVF L TGGEL+++I+ +  YSE +    I+Q++++VN+ H NG+VHRD+KPEN+L  +K   + +KL DFG++   + D     +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  + ++++L  NP+ R+++A+A+KH W
Sbjct:   15 DIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDH--QAWFGFAGTPGYLSPEVLKKE-PYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0300377)

HSP 1 Score: 171.785 bits (434), Expect = 4.494e-48
Identity = 91/260 (35.00%), Postives = 152/260 (58.46%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            ++ + LGKGA++ V   + + T  + A K  N  +      +++E EA I  KL+H NI     +    N  YLVF L TGGEL+++I+ +  YSE +    I+Q++++VN+ H NG+VHRD+KPEN+L  +K   + +KL DFG++   + D     +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  + ++++L  NP+ R+++A+A+KH W
Sbjct:   15 DIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDH--QAWFGFAGTPGYLSPEVLKKEP-YGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089217)

HSP 1 Score: 171.785 bits (434), Expect = 4.494e-48
Identity = 91/260 (35.00%), Postives = 152/260 (58.46%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            ++ + LGKGA++ V   + + T  + A K  N  +      +++E EA I  KL+H NI     +    N  YLVF L TGGEL+++I+ +  YSE +    I+Q++++VN+ H NG+VHRD+KPEN+L  +K   + +KL DFG++   + D     +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E  + ++++L  NP+ R+++A+A+KH W
Sbjct:   15 DIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDH--QAWFGFAGTPGYLSPEVLKKEP-YGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Match: camk1gb (calcium/calmodulin-dependent protein kinase IGb [Source:ZFIN;Acc:ZDB-GENE-040426-1694])

HSP 1 Score: 193.741 bits (491), Expect = 9.830e-57
Identity = 107/282 (37.94%), Postives = 167/282 (59.22%), Query Frame = 3
Query:   63 ELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE-----IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            E  K   NI D++   +  DVLG GA+++V+     + KE+   K F     KC   K      +ENE  ++ K+ H N+      Y     +YLV +L +GGEL+D I+ +  YSE +  ++I+QV++AV+YLH+NGIVHRD+KPEN+LY + + NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I   ++ F    W + S     F+  ++++NP  R ++ +A++H W
Sbjct:    9 EWKKSTDNIQDVF---DFMDVLGSGAFSEVF-----MVKERKTGKLFAM---KCVKKKNKRDINLENEIAVLRKIKHENVVCLEDFYESRTHYYLVMQLVSGGELFDRILDRGMYSEMDASSVIRQVLEAVSYLHNNGIVHRDLKPENLLYYSPDENSKIMISDFGLSKM----EDNGVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKGQYEFDSPFWDDISESAKDFIRNMMQKNPKMRFNTEQALRHPW 273          
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Match: camk1da (calcium/calmodulin-dependent protein kinase 1Da [Source:ZFIN;Acc:ZDB-GENE-080402-7])

HSP 1 Score: 191.43 bits (485), Expect = 7.479e-56
Identity = 106/278 (38.13%), Postives = 164/278 (58.99%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+  NI +I+   E  +VLG GA+++V     + T + +AVK   +   K    KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ K  Y+E +  T+I+QV+DAVNYLH+ GIVHRD+KPEN+LY   +  S I + DFG+S++  + +     +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  + + F    W + S     F+S L++++P  R +  +A++H W +
Sbjct:   16 KQVDNIKEIF---EFKEVLGTGAFSEVVLAEERSTGKMYAVKCIPK---KALKGKESSIENEIAVLRKIKHENIVALEDIYESSDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHTMGIVHRDLKPENLLYFNPQDGSKIMISDFGLSKMEGTGD---VMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPSKRNTCEQALRHPWIA 282          
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 189.119 bits (479), Expect = 1.230e-55
Identity = 104/276 (37.68%), Postives = 161/276 (58.33%), Query Frame = 3
Query:   81 KNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSI-AKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K + DI    E  ++LG GA+++V     + T + +AVK      PK ++  KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ +  Y+E +   +IKQV+DAVNYLHS GIVHRD+KPEN+LY      S I + DFG+S++      +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F++ L++++P  R +  +A++H W +
Sbjct:   15 KQVDDIRKIFEFKEILGTGAFSEVVLAQEKATGDMYAVKCI----PKKALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYFNPHEESKIMISDFGLSKM--EGAANDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIA 282          
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 189.119 bits (479), Expect = 2.196e-55
Identity = 103/275 (37.45%), Postives = 159/275 (57.82%), Query Frame = 3
Query:   81 KNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K + DI    E  ++LG GA+++V     + T + +AVK   +   K    KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ +  Y+E +   +IKQV+DAVNYLHS GIVHRD+KPEN+LY      S I + DFG+S++      +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F++ L++++P  R +  +A++H W +
Sbjct:   15 KQVDDIRKIFEFKEILGTGAFSEVVLAQEKATGDMYAVKCIPK---KALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYFNPHEESKIMISDFGLSKM--EGAANDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIA 282          
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 186.037 bits (471), Expect = 2.662e-54
Identity = 105/278 (37.77%), Postives = 163/278 (58.63%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            KK  NI DIY   +  +VLG GA+++V     + T++  AVK   +   K    KE  IENE  ++ K+ H NI      +   +  YLV +L +GGEL+D I+ K  Y+E +   +I+Q++DAV YLH  GIVHRD+KPEN+LY + +  S I + DFG+S++  S    +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A++H W +
Sbjct:   12 KKTANIKDIY---DFKEVLGTGAFSEVMLAEEKRTRKLVAVKCIAK---KALEGKENSIENEIAVLHKIKHANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEESKIMISDFGLSKIEGS---GSVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKDPNQRYTCEQALQHPWIA 278          
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Match: mlh3 (mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852])

HSP 1 Score: 191.045 bits (484), Expect = 1.111e-56
Identity = 104/258 (40.31%), Postives = 155/258 (60.08%), Query Frame = 3
Query:  135 GAYAKVYCGLNQITKEKHA---VKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            GA+++VY   ++ T + +A   +K  N SR K      +ENE  ++ ++ H NI      Y   + FYLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T + NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  IR   + F    W + S     F+S LL+++   R +  KA+KH W +
Sbjct:   44 GAFSEVYLVKHRSTGQHYALKCIKKVNSSRDK-----SLENEIAVLKRIKHENIVTLEDIYESSSHFYLVMQLVSGGELFDRILERGVYTEKDASNVIRQVLSAVKYLHDNGIVHRDLKPENLLYLTPDENSKIMITDFGLSKM----EENGIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESRLFEKIREGAYEFESPFWDDISKSAKDFISCLLEKDSKKRYNCEKALKHPWIA 290          
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Match: mlh3 (mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852])

HSP 1 Score: 190.274 bits (482), Expect = 2.308e-56
Identity = 106/264 (40.15%), Postives = 159/264 (60.23%), Query Frame = 3
Query:  105 WDEMNDVLGKGAYAKVYCGLNQITKEKHA---VKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKH 884
            + E N ++ KGA+++VY   ++ T + +A   +K  N SR K      +ENE  ++ ++ H NI      Y   + FYLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T + NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  IR   + F    W + S     F+S LL+++   R +  KA+KH
Sbjct:    7 FREGNVLILKGAFSEVYLVKHRSTGQHYALKCIKKVNSSRDK-----SLENEIAVLKRIKHENIVTLEDIYESSSHFYLVMQLVSGGELFDRILERGVYTEKDASNVIRQVLSAVKYLHDNGIVHRDLKPENLLYLTPDENSKIMITDFGLSKM----EENGIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESRLFEKIREGAYEFESPFWDDISKSAKDFISCLLEKDSKKRYNCEKALKH 259          
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 186.808 bits (473), Expect = 1.037e-54
Identity = 105/279 (37.63%), Postives = 167/279 (59.86%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSI-AKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   E  +VLG GA+++V     + T++  A+K      PK ++  KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ K  Y+E +   +IKQ++DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++  S    +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A++H W +
Sbjct:   12 KRAEDIRDIY---EFREVLGTGAFSEVVLAEEKKTQKLVAIKCI----PKKALEGKETSIENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGS---GSVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIA 278          
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 186.422 bits (472), Expect = 1.082e-54
Identity = 104/278 (37.41%), Postives = 165/278 (59.35%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   E  +VLG GA+++V     + T++  A+K   +   K    KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ K  Y+E +   +IKQ++DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++  S    +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A++H W +
Sbjct:   12 KRAEDIRDIY---EFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK---KALEGKETSIENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGS---GSVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIA 278          
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 186.422 bits (472), Expect = 1.345e-54
Identity = 104/278 (37.41%), Postives = 165/278 (59.35%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   E  +VLG GA+++V     + T++  A+K   +   K    KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ K  Y+E +   +IKQ++DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++  S    +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A++H W +
Sbjct:   12 KRAEDIRDIY---EFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK---KALEGKETSIENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGS---GSVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIA 278          
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Match: Camk1g (calcium/calmodulin-dependent protein kinase I gamma [Source:MGI Symbol;Acc:MGI:2388073])

HSP 1 Score: 192.586 bits (488), Expect = 4.350e-57
Identity = 101/258 (39.15%), Postives = 155/258 (60.08%), Query Frame = 3
Query:  120 DVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            +VLG GA+++V+    ++T +  A+K   +S         +ENE  ++ ++ H NI      Y     +YLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T E NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I+   + F    W + S     F+  LL+++P+ R +  KA++H W
Sbjct:   27 EVLGSGAFSEVFLVKQRVTGKLFALKCIKKS--PAFRDSSLENEIAVLKRIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKM----EQNGVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPW 276          
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 191.045 bits (484), Expect = 3.102e-56
Identity = 104/278 (37.41%), Postives = 166/278 (59.71%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   +  DVLG GA+++V    ++ T++  A+K   +   K    KE  +ENE  ++ K+ H NI      Y  G   YL+ +L +GGEL+D I+ K  Y+E +   +I QV+DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++   ++P +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P  R +  +A++H W +
Sbjct:   11 KQAEDIRDIY---DFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK---KALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKM---EDPGSVLSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Match: Camk1g (calcium/calmodulin-dependent protein kinase I gamma [Source:MGI Symbol;Acc:MGI:2388073])

HSP 1 Score: 193.741 bits (491), Expect = 3.119e-56
Identity = 105/275 (38.18%), Postives = 162/275 (58.91%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            K+  NI   +++ E   VLG GA+++V+    ++T +  A+K   +S         +ENE  ++ ++ H NI      Y     +YLV +L +GGEL+D I+ +  Y+E +   +I+QV+ AV YLH NGIVHRD+KPEN+LY T E NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I+   + F    W + S     F+  LL+++P+ R +  KA++H W 
Sbjct:   14 KQTTNIRKTFIFME---VLGSGAFSEVFLVKQRVTGKLFALKCIKKS--PAFRDSSLENEIAVLKRIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKM----EQNGVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWI 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 184.496 bits (467), Expect = 1.118e-53
Identity = 102/276 (36.96%), Postives = 159/276 (57.61%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I  I+   E  + LG GA+++V     + T +  AVK   +   K      IENE  ++ K+ H NI      Y   N  YLV +L +GGEL+D I+ K  Y+E +  T+I+QV+DAV YLH  GIVHRD+KPEN+LY +++  S I + DFG+S++   +      +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A +H W +
Sbjct:   14 KQAEDIKKIF---EFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGK-ESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKM---EGKGDVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA 280          
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 179.489 bits (454), Expect = 6.953e-52
Identity = 97/267 (36.33%), Postives = 151/267 (56.55%), Query Frame = 3
Query:   99 YLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            + W  +      GA+++V     + T +  AVK   +   K      IENE  ++ K+ H NI      Y   N  YLV +L +GGEL+D I+ K  Y+E +  T+I+QV+DAV YLH  GIVHRD+KPEN+LY +++  S I + DFG+S++   +      +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P+ R +  +A +H W +
Sbjct:   12 FRWSWIKGSRNSGAFSEVVLAEEKATGKLFAVKCIPKKALKGK-ESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKM---EGKGDVMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA 272          
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P25323|MYLKA_DICDI (Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 1.040e-58
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            E  + LG+GA++ VY G N+ TK+++A+K  N+S       K ++ E +I+ K+NH NI      +    + YLV +L TGGEL+D+I+ K  YSE +   ++K+++ AV YLH   IVHRD+KPEN+L ++KE +  + + DFG+S++           T   +  YVAPEVL     Y K VD WS+G+IT++LL G+PP+ G+TV +++  I  + + F E+ WG  S E   F+ KLL  +   R+++  A+ H W 
Sbjct:    9 EFKEELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHGLNIVHRDLKPENLLLKSKENHLEVAIADFGLSKIIGQ---TLVMQTACGTPSYVAPEVL-NATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDVSKRLNATNALNHPWL 265          
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O15865|CDPK2_PLAFK (Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) OX=5839 GN=CPK2 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 6.340e-56
Identity = 109/269 (40.52%), Postives = 164/269 (60.97%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIA-SKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            D Y+ DE    LG+G Y  VY G++++T + +A+K   + R K +I +  + E EIM KL+H NI +    Y   N  YL+ +L +G EL+D II    ++E    TI+KQ+  A+ YLHS  IVHRD+KPEN L++++  +S++K+IDFG+S+   +     EFTT  A + YYVAP+VL     Y K  D WS G+I + LL GYPP+ G+T  +V   ++  +F F E DWG  SS+  + ++KLL  NP+ R +  +A+ H W +
Sbjct:   70 DKYIIDEK---LGQGTYGCVYKGIDKVTNQLYAIKEEKKDRLK-NINRFFQ-EIEIMKKLDHPNIVKLYETYENDNYIYLIMELCSGRELFDSIIENGSFTEKNAATIMKQIFSAIFYLHSLNIVHRDLKPENFLFQSENKDSLLKIIDFGLSKNLGT----GEFTTTKAGTPYYVAPQVLDGK--YDKKCDIWSSGVIMYTLLCGYPPFYGDTDNEVLKKVKKGEFCFYENDWGSISSDAKNLITKLLTYNPNERCTIEEALNHPWIT 327          
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q8ICR0|CDPK2_PLAF7 (Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CPK2 PE=2 SV=3)

HSP 1 Score: 195.667 bits (496), Expect = 6.355e-56
Identity = 109/269 (40.52%), Postives = 164/269 (60.97%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIA-SKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            D Y+ DE    LG+G Y  VY G++++T + +A+K   + R K +I +  + E EIM KL+H NI +    Y   N  YL+ +L +G EL+D II    ++E    TI+KQ+  A+ YLHS  IVHRD+KPEN L++++  +S++K+IDFG+S+   +     EFTT  A + YYVAP+VL     Y K  D WS G+I + LL GYPP+ G+T  +V   ++  +F F E DWG  SS+  + ++KLL  NP+ R +  +A+ H W +
Sbjct:   70 DKYIIDEK---LGQGTYGCVYKGIDKVTNQLYAIKEEKKDRLK-NINRFFQ-EIEIMKKLDHPNIVKLYETYENDNYIYLIMELCSGRELFDSIIENGSFTEKNAATIMKQIFSAIFYLHSLNIVHRDLKPENFLFQSENKDSLLKIIDFGLSKNLGT----GEFTTTKAGTPYYVAPQVLDGK--YDKKCDIWSSGVIMYTLLCGYPPFYGDTDNEVLKKVKKGEFCFYENDWGSISSDAKNLITKLLTYNPNERCTIEEALNHPWIT 327          
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q63450|KCC1A_RAT (Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 2.124e-55
Identity = 104/278 (37.41%), Postives = 166/278 (59.71%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   +  DVLG GA+++V    ++ T++  A+K   +   K    KE  +ENE  ++ K+ H NI      Y  G   YL+ +L +GGEL+D I+ K  Y+E +   +I QV+DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++   ++P +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P  R +  +A++H W +
Sbjct:   11 KQAEDIRDIY---DFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK---KALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKM---EDPGSVLSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA 277          
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q91YS8|KCC1A_MOUSE (Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.170e-55
Identity = 104/278 (37.41%), Postives = 166/278 (59.71%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K+ ++I DIY   +  DVLG GA+++V    ++ T++  A+K   +   K    KE  +ENE  ++ K+ H NI      Y  G   YL+ +L +GGEL+D I+ K  Y+E +   +I QV+DAV YLH  GIVHRD+KPEN+LY + + +S I + DFG+S++   ++P +  +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++P  R +  +A++H W +
Sbjct:   11 KQAEDIRDIY---DFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK---KALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKM---EDPGSVLSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA 277          
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Match: F1A0D6 (Myosin light chain kinase (Fragment) OS=Dictyostelium purpureum OX=5786 GN=DICPUDRAFT_157928 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.982e-59
Identity = 103/264 (39.02%), Postives = 162/264 (61.36%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLS 902
            E  + LG+GA++ VY G+N+ TK+K+A+K  N+S       K ++ E +I+ K+NH NI      +    + YLV +L TGGEL+D+I+ K  YSE +   +I++++ AV YLHS+ IVHRD+KPEN+L ++KE +  + + DFG+S++           T   +  YVAPEVL     Y K VD WS+G+IT++LL G+PP+ G+TV +++  I  + F + E+ WG  S     F++KLL  +   R+S+  A+ H W + S
Sbjct:    3 EFKEELGRGAFSVVYLGVNRQTKQKYAIKVINKSELGSDYEKNLKMEVDILKKVNHPNIIALKELFDTPQKLYLVMELVTGGELFDKIVEKGSYSELDAANLIRKIVSAVKYLHSSNIVHRDLKPENLLLKSKENDLEVAIADFGLSKIIGQ---SVVMATACGTPSYVAPEVL-NATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQIMEANFDYPEEYWGSISKPAKDFINKLLVVDVTKRLSAEDALTHPWLNNS 262          
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Match: A0A418CH09 (Protein kinase domain-containing protein (Fragment) OS=Aphanomyces astaci OX=112090 GN=DYB26_014553 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.094e-56
Identity = 105/268 (39.18%), Postives = 160/268 (59.70%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            D+Y     N VLG+G  AKVY G ++ T ++ AVK F +++ + S   ++  E  I+ ++ H +I E  A +     FY+V  L  GGEL+D II K  YSE E + ++K ++ A+ Y+HS  IVHRD+KPENIL ++   ++ IKL DFG +   KSD   T  T    S  Y+APE+L +P  Y + VD WS G+IT++LL GYPP+ G T  +++ NI++ +F F    W + S+   +FVS +L  NP  R ++   ++H W +
Sbjct:   52 DVYAL-ATNQVLGEGGSAKVYVGTHRRTHQRVAVKVFVKAQMRDSEVSDLFEEVNILKQMKHAHILELFAFFHESTHFYIVTDLLEGGELFDRIIEKEFYSEKEARDLVKILLTAIQYMHSLNIVHRDLKPENILLQSLTDDTSIKLADFGFA---KSDIHGT-MTAKCGSPSYIAPEILSQP-QYGRAVDIWSAGVITYILLCGYPPFQGATDAELFANIQHGQFEFDAPYWDDVSTVAKAFVSSMLVLNPAERATADALLQHPWIT 313          
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Match: A0A396ZN31 (Protein kinase domain-containing protein (Fragment) OS=Aphanomyces astaci OX=112090 GN=DYB36_006538 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.345e-56
Identity = 105/268 (39.18%), Postives = 161/268 (60.07%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            D+Y     N VLG+G  AKVY G ++ T ++ AVK F +++ + S   ++  E  I+ ++ H +I E  A +     FY+V  L  GGEL+D II K  YSE E + ++K ++ A+ Y+HS  IVHRD+KPENIL ++   ++ IKL DFG +   KSD   T  T    S  Y+APE+L +P  Y++ VD WS G+IT++LL GYPP+ G T  +++ NI++ +F F    W + S+   +FVS +L  NP  R ++   ++H W +
Sbjct:   70 DVYAL-ATNQVLGEGGSAKVYVGTHRRTHQRVAVKVFIKAQMRDSEVSDLFEEVNILKQMKHAHILELFAFFHEPTHFYIVTDLLEGGELFDRIIEKEFYSEKEARDLVKILLTAIQYMHSLNIVHRDLKPENILLQSLTDDTSIKLADFGFA---KSDIHGT-MTAKCGSPSYIAPEILSQP-QYSRAVDIWSAGVITYILLCGYPPFQGATDAELFANIQHGQFEFDAPYWDDVSAVAKAFVSSMLVLNPAERATADALLQHPWIT 331          
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Match: A0A397CPL8 (Protein kinase domain-containing protein (Fragment) OS=Aphanomyces astaci OX=112090 GN=DYB38_010533 PE=3 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 4.209e-56
Identity = 105/268 (39.18%), Postives = 159/268 (59.33%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            D+Y     N VLG+G  AKVY G ++ T ++ AVK F +++ + S   ++  E  I+ ++ H +I E  A +     FY+V  L  GGEL+D II K  YSE E + ++K ++ A+ Y+HS  IVHRD+KPENIL ++   ++ IKL DFG +   KSD   T  T    S  Y+APE+L +P  Y + VD WS G+IT++LL GYPP+ G T  +++ NI+  +F F    W + S+   +FVS +L  NP  R ++   ++H W +
Sbjct:   52 DVYAL-ATNQVLGEGGSAKVYVGTHRRTHQRVAVKVFVKAQMRDSEVSDLFEEVNILKQMKHAHILELFAFFHESTHFYIVTDLLEGGELFDRIIEKEFYSEKEARDLVKILLTAIQYMHSLNIVHRDLKPENILLQSLTDDTSIKLADFGFA---KSDIHGT-MTAKCGSPSYIAPEILSQP-QYGRAVDIWSAGVITYILLCGYPPFQGATDAELFANIQRGQFEFDAPYWDDVSAVAKAFVSSMLVLNPAERATADALLQHPWIT 313          
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Match: Q86S94 (Calcium-dependent protein kinase (Fragment) OS=Babesia rodhaini OX=5870 GN=BrCDPK PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 9.284e-56
Identity = 101/259 (39.00%), Postives = 157/259 (60.62%), Query Frame = 3
Query:  123 VLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSL 899
            V+G GAY +V     + T  + AVK   ++      ++++ +E E++  L+H NIA+    +    ++YLV  LYTGGEL+DEIIR++K+SE +   +++Q++  V YLHSN IVHRD+KPEN+L E+K  ++ IK++DFG+S  F      +     + + YY+APEVL K   Y +  D WS G+I ++LL GYPP+ G+T  ++ I +   K  F   DW   S+E  S V  +L  +P  R+S+  A+ H WFS+
Sbjct:   60 VIGSGAYGQVLLCREKSTGTERAVKVIRKTANCDQDSEKLLDEVEMLKSLDHPNIAKLYEFFEDSRKYYLVMDLYTGGELFDEIIRRQKFSERDAAMVMRQILSGVLYLHSNNIVHRDLKPENLLLESKAPDAAIKIVDFGLSTNFNG----SRMRERLGTPYYIAPEVLKK--CYNEKCDIWSCGVILYILLCGYPPFGGQTDEEILIKVEKGKCTFDMNDWCNISTEVRSLVKAMLTCDPDKRISARAALTHPWFSM 312          
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 189.889 bits (481), Expect = 9.919e-56
Identity = 107/276 (38.77%), Postives = 162/276 (58.70%), Query Frame = 3
Query:   81 KNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSI-AKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K + DI    E+ ++LG GA+++V     + T + +AVK      PK ++  KE  IENE  ++ K+ H NI      Y   N  YL+ +L +GGEL+D I+ +  Y+E +   +IKQV+DAVNYLHS GIVHRD+KPEN+LY  ++  S I + DFG+S++      +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+I+++LL GYPP+  E    ++  I  + + F    W + S     F+S L+ +NP  R +  +A+ H W +
Sbjct:   15 KQVDDIKKIFELKEILGTGAFSEVVLAQERSTGKMYAVKCI----PKKALRGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYYNQD-ESKIMISDFGLSKM--EGAANDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVISYILLCGYPPFYDENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIA 281          
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 188.348 bits (477), Expect = 1.524e-54
Identity = 105/279 (37.63%), Postives = 167/279 (59.86%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE-----IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            K  +NI +I+ + E   VLG GA+++V+     + KE+   K F     KC   K      +ENE  ++ ++ H N+      Y   + +YLV +L +GGEL+D I+ +  YSE +   +I+QV++AV+YLH NGIVHRD+KPEN+LY +++ NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I  +++ F    W   S     F+  ++++NP  R ++ +A++H W
Sbjct:   30 KTVENIREIFDFIE---VLGSGAFSEVF-----MVKERKTGKLFAM---KCVKKKNKRDINLENEIAVLRRIKHENVVGLEDFYESRSHYYLVMQLVSGGELFDRILDRGMYSEMDASLVIRQVLEAVSYLHINGIVHRDLKPENLLYYSQDENSKIMISDFGLSKM----EDNDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPW 291          
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 187.193 bits (474), Expect = 4.679e-54
Identity = 104/279 (37.28%), Postives = 166/279 (59.50%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE-----IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            K   NI +++ + E   VLG GA+++V+     + KE+   K F     KC   K      +ENE  ++ ++ H N+      Y   + +YLV +L +GGEL+D I+ +  YSE +   +I+QV++AV+YLH NGIVHRD+KPEN+LY +++ NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I  +++ F    W   S     F+  ++++NP  R ++ +A++H W
Sbjct:   35 KSTDNIQEVFDFIE---VLGSGAFSEVF-----MVKERKTGKLFAM---KCVKKKNKRDINLENEIAVLRRIKHENVVGLEDFYESRSHYYLVMQLVSGGELFDRILDRGMYSEMDASLVIRQVLEAVSYLHINGIVHRDLKPENLLYYSQDENSKIMISDFGLSKM----EDNDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPW 296          
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 187.193 bits (474), Expect = 6.414e-54
Identity = 99/260 (38.08%), Postives = 159/260 (61.15%), Query Frame = 3
Query:  120 DVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEI--ENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            +VLG GA+++V+     + KE+   K F     K    ++I  ENE  ++ ++ H N+      Y   + +YLV +L +GGEL+D I+ +  YSE +   +I+QV++AV+YLH NGIVHRD+KPEN+LY +++ NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I  +++ F    W   S     F+  ++++NP  R ++ +A++H W
Sbjct:   54 EVLGSGAFSEVF-----MVKERKTGKLFAMKCVKKKNKRDINLENEIAVLRRIKHENVVGLEDFYESRSHYYLVMQLVSGGELFDRILDRGMYSEMDASLVIRQVLEAVSYLHINGIVHRDLKPENLLYYSQDENSKIMISDFGLSKM----EDNDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPW 302          
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 186.037 bits (471), Expect = 1.076e-53
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE----IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            K  +NI +I+ + E   VLG GA ++V+       KEK   K F     KC I K     +ENE  ++ ++ H NI      Y   + +YLV +L +GGEL+D ++ +  +SE +   +I+QV++ V+YLH N IVHRD+KPEN+LY +++ NS I + DFG+S++    E +   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  ET   ++  I  +++ F    W   S     F+  ++++NP  R ++ +A++H W
Sbjct:   30 KTVENIREIFDFIE---VLGSGASSEVF-----KVKEKSTGKFFAM---KCVIKKNRNTTLENEIAVLKRIKHNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYSQDENSKIMISDFGLSKM----EDNDIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPW 290          
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 2.392e-48
Identity = 89/261 (34.10%), Postives = 150/261 (57.47%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            ++ + LGKGA++ V   +   T ++ A K  N  +      +++E EA I   L H NI     +       YLVF L TGGEL+++I+ +  YSE +    I+Q++++V++ H +GIVHRD+KPEN+L  +K   + +KL DFG++   + D+    +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + F   +W   ++E  + ++++L  NP  R+++A+A+KH W 
Sbjct:   15 QLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQ--QAWFGFAGTPGYLSPEVLRKDP-YGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWI 272          
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 8.746e-47
Identity = 88/261 (33.72%), Postives = 148/261 (56.70%), Query Frame = 3
Query:  132 KGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYT----GGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYV---APEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            +GA+++V     + T    A+K   ++  +      +ENE  ++S++ H NI      Y   +  YL+ +L      GGEL+D I+ +  Y+E +   +I+QV+ AV++LH  G+VHRD+KPEN+LY + E +S I + DFG+S   K + P +  +T   +  YV   APEVL  KP  YT+ VDCWS+G+I+++LL GYPP+  E    ++  I  +++ F    W + S     F+  L++++   R +  +A++H W
Sbjct:    1 RGAFSEVVLAEERSTGRHVAIKCIAKTALRGK-DNTVENEVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLS---KVEAPGSVMSTACGTPGYVACEAPEVLAQKP--YTRAVDCWSIGVISYILLCGYPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 3.345e-38
Identity = 83/259 (32.05%), Postives = 140/259 (54.05%), Query Frame = 3
Query:  120 DVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKR-KYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            DVLG G + +V+  + + +    A K       K     E+ NE  IM++L H N+ +   AY   N+F L+ +   GGEL+D I+ +    +E +    I+Q+ + ++Y+H   I+H D+KPENIL   ++ N I K+IDFG++R +K   P  +      +  ++APEV +     +   D WS+G+I ++LL+G  P+ GE   +   NI N  + F ++ +   S E   F+S+LL +    RMS+++ +KH W 
Sbjct:   37 DVLGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEK--DEVNNEISIMNQLKHNNLLQLYDAYESKNDFVLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQI-KIIDFGLARRYK---PREKLKVHFGTPEFLAPEV-VNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWL 288          
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 135.961 bits (341), Expect = 1.885e-37
Identity = 80/268 (29.85%), Postives = 143/268 (53.36%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHF-NRSRPKCSIAKEIENEAEIMSKLN-HRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNS-IIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDG---ETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            E+ + +G G+Y+     +++ T  ++AVK   ++S+      ++   E EI+ +   H N+      Y  G   YLV +L  GGEL D+I+R++ +SE E   +++ +   V YLHS G+VHRD+KP NILY  +  N   +++ DFG ++  +++  +    T   +  +VAPEVL K   Y    D WS+G++ + +L G+ P+     +T   +   I + +F+    +W   S      V K+L  +PH R ++A+ ++H W +
Sbjct:   13 ELREDIGVGSYSVCKRCIHKTTNMEYAVKVIIDKSK------RDPSEEIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAE--NGLLMTPCYTANFVAPEVL-KRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWDTVSEAAKDLVKKMLHVDPHQRFTAAQVLRHPWIA 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 137.502 bits (345), Expect = 2.756e-37
Identity = 66/181 (36.46%), Postives = 111/181 (61.33%), Query Frame = 3
Query:  348 TGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            TGGEL+++I+ +  YSE +  T I+Q+++AV + H  GIVHRD+KPEN+L  +K   + +KL DFG++   + ++    +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + F   +W   + E  S ++++L  NP  R+++++A+ H W
Sbjct:    2 TGGELFEDIVAREYYSEADASTGIQQILEAVLHCHQLGIVHRDLKPENLLLASKTKGAAVKLADFGLAIEVQGEQ--QAWFGFAGTPGYLSPEVLRKDP-YGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKSLINQMLTINPAKRITASEALTHPW 179          
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 146.747 bits (369), Expect = 6.025e-40
Identity = 93/281 (33.10%), Postives = 147/281 (52.31%), Query Frame = 3
Query:  123 VLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAK--EIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKF--MFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH*ISTQSKIISLKPQL 953
             LG G +  V    N  T E  AVK   +   K +  +   + +E +I+ +L+H NI  +   +   ++FY++ +L  GGEL+D I++K K++E +   I+ +++ AV Y+HS  IVHRD+KPEN+LY  K   S + + DFG+++  KSDE          S  YVAPEVL +   + K  D WS+G+IT+ LL GY  +  E V D        ++   F    W   S++   F+ K L  +P  R ++A+ ++  W       I T+ K  +L P L
Sbjct:   42 TLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDE--ELLYKPAGSLGYVAPEVLTQDG-HGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI------ICTELKTHNLLPGL 313          
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 143.28 bits (360), Expect = 8.981e-39
Identity = 88/262 (33.59%), Postives = 140/262 (53.44%), Query Frame = 3
Query:  123 VLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAK--EIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKF--MFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
             LG G++  V       T E  A+K   +   + +  +   +  E  I+ KL+H NI  +   +   ++FY+V +L TGGEL+D I+ + K++E +   II Q++ AV Y+HS  +VHRD+KPEN+LY  K  NS + + DFG+++  K +E D  +     S  YVAPEVL +   + K  D WS+G+IT+ LL GY P+  E+V         S++   F    W   S +   F+ K L+ NP  R ++ + +   W +
Sbjct:   52 TLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEE-DLIYKA-AGSLGYVAPEVLTQD-GHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWIT 310          
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 146.362 bits (368), Expect = 1.700e-38
Identity = 90/277 (32.49%), Postives = 150/277 (54.15%), Query Frame = 3
Query:  114 MNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFT-TFIASKYYVAPEVL------IKPI------LYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINI-RNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLS 902
            +++V+G+GA+A V   + + T +  AVK  ++ R        +  E E++ KLNH  I      Y     +Y+V +  +GG+L D +       E+  + I +Q++ A+ Y+HS GI HRD+KP+NIL E  +   ++K+ DFG++++    + +  F  TF  +  YVAPEV+      + P        Y+ LVD WS+G + +V+LTG+ P+ G T   +Y  I R S      KD+   S E   F+  LL+ +P++R ++AKA+ H W  +S
Sbjct:  200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK-RKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDP-VLVKITDFGLAKV----QGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDF-RISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMS 469          
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 135.191 bits (339), Expect = 2.106e-35
Identity = 89/281 (31.67%), Postives = 138/281 (49.11%), Query Frame = 3
Query:  126 LGKGAYAKVYCGLNQITKEKHAVKHFN-RSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAY-----GCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENIL----------------YETKECNSIIKLIDFGVSRLFKSDEPDTEFT-TFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPY-DGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            LG G YA V    N+ T ++ AVK F+ +        K+   E  I+ ++ H NI   + ++         + YLV +    GEL++ I+RK    ++E K + KQ++  + YLH   I+HRD+KPENIL                ++  E +  +K+ DFG+++       + +FT T   +  YVAPEVL K   YT  VD WS G+I +V L G+PP+ D      +   I  +K+ F    W +     L  +S LL  NP  R +  +A+ H WF+
Sbjct:  206 LGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKF----TGEMQFTNTLCGTPSYVAPEVLTKK-GYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFN 481          
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 124.79 bits (312), Expect = 2.540e-31
Identity = 84/260 (32.31%), Postives = 131/260 (50.38%), Query Frame = 3
Query:  123 VLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAA------------YGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSS 866
            +LGKG + +VY    + T+  +A+K  ++        K I  + EI   +  RNI    A+            +    + YLV    +GGEL+  + ++ ++SE+  K  I +++ A+ +LH N IV+RD+KPENIL    + N  I L DFG+S+    D  +    TF  +  Y+APE+L+    YTK+VD WS+G++   +  G+ P+  E    +Y  I   K  F        S E  SFV  LL RNP HR+ +
Sbjct:  417 LLGKGTFGQVYQVKKKDTQRIYAMKVLSK--------KVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL---DANGNIALCDFGLSKADLKDRTN----TFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRD---VLSQEGRSFVKGLLNRNPKHRLGA 658          
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 180.259 bits (456), Expect = 1.497e-53
Identity = 101/280 (36.07%), Postives = 160/280 (57.14%), Query Frame = 3
Query:   54 MPVELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFT-TFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKW 890
            MP+   KKF + I      ++ +VLG GA+++V     + T    AVK  ++   K    + +ENE  I+ K+ H+NI      +   +  YLV  L  GGEL+D I+ K  Y+E +   +++Q+++A +YLHS GIVHRD+KPEN+LY + + +S I + DFG+S++    E    F  T   +  YVAPEVL K   Y K VDCWS+G+IT++LL GYPP+  ++  +++  I  +++ F    W E S     F+  L++ +P  R +  +A+ H W
Sbjct:    1 MPLFGKKKFDDKITKKY--DLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGK-EESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKI----EAQGSFMDTACGTPGYVAPEVL-KQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPW 272          
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 166.007 bits (419), Expect = 1.681e-46
Identity = 89/261 (34.10%), Postives = 148/261 (56.70%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            E+ + LGKGA++ V    ++ TK ++AVK  +          ++E EA I   L H N+    A       ++LVF L TGGEL+++I+ +  YSE +    I+QV+ +V + H NGIVHRD+KPEN+L  ++E  +++KL DFG++   + D     +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   +++    + K+L  +   R+++A+A+KH W 
Sbjct:   18 ELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDVHKVEREARICRHLRHPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLA--IEVDGERLGWYGFAGTPGYLSPEVLKKDP-YGKPVDLWACGVILYILLVGYPPFWDEEQQKLYSQIKAGTYDYPSPEWDTVTADAKDLIDKMLTVDAPKRITAAEALKHPWI 275          
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Match: EDO30537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0H5])

HSP 1 Score: 162.925 bits (411), Expect = 2.193e-45
Identity = 86/261 (32.95%), Postives = 149/261 (57.09%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            E+ + LGKGA++ V   +++ ++ ++A K  N  +      ++++ EA I   L H NI    A+       YLVF L TGGEL+++I+ +  YSE +    I+Q++++V + H+N +VHRD+KPEN+L  +KE N+ +KL DFG++   + +   T +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I+   + +   +W   + E    ++ +L  +   R+ + +A+KH W 
Sbjct:   14 ELKEELGKGAFSIVRRCIHKESRIEYAAKIINTRKLSSRDLQKLDREARICRLLKHPNIVRLHASIAEEGYHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIIESVQHCHTNNVVHRDLKPENLLLASKEKNAAVKLADFGLA--IEVEIEKTGWYGFAGTPGYLSPEVLKKEP-YGKPVDLWACGVILYILLVGYPPFWDEDQHKLYAQIKTGNYDYPSPEWDTVTDEAKDLINMMLTVDQSKRIGAGEALKHPWI 271          
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL08])

HSP 1 Score: 159.844 bits (403), Expect = 5.186e-45
Identity = 94/280 (33.57%), Postives = 153/280 (54.64%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDE--MNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLS 902
            +K+K   DI +  E  +  ++G+G++++V    +  TK+ +A+K     + K     E ++E  ++ ++ H  +      + C N  YLV +L TGG L D I+ K  ++E +   +I  V++ V YLHS GI HRD+KPEN+LY     +S I + DFG+S L K  + D    T   +  Y+APEVL+ KP  YT  VD WS+G+IT  +L+G  P+  +    +Y  I   KF F  + W + +     F++KL+   P  R+++ + IKH W + S
Sbjct:   56 EKYKARFDIRVTKEYEIKALIGRGSFSRVVRVEHYQTKQPYAIKMMEIEQGK----DEFQSELAVLRRVKHEFVVRLYEVFECRNRVYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHPGNDSKIMITDFGLSNLRKHPD-DRTMETTCGTPGYMAPEVLLSKP--YTNSVDIWSIGVITFNVLSGQMPFADDHRSRLYKKILRGKFSFSGEPWDDVTDMAKDFINKLIVYEPEMRLTAEQGIKHPWIASS 328          
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Match: EDO33022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC5])

HSP 1 Score: 157.532 bits (397), Expect = 7.103e-45
Identity = 89/273 (32.60%), Postives = 148/273 (54.21%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECN---SIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLS 902
            D+Y   E+ D +GKGA+ +V   +N  T+E  AVK  + S  +    K+ +NEA+I   L+H +I      +       LV +   GG+L+D ++ + ++SE +    ++QV+ A+ YL   GI+HRD+KPEN+L   +  +    IIKL DFG+++  K +           S  Y+APE +++  L T  VD W+ G+I ++LL GYPP+  E    + ++I  S + F    W   S      + K+L  +P  R+++ +A+KH+W S S
Sbjct:    5 DVY---EITDFIGKGAFGQVSKCVNLQTREVFAVKEIDFSGSEED-KKKAQNEAKICGLLDHPSIVHLEDVFFTPRRMLLVLEYLPGGDLFDGVVTRTQFSEKDACACVRQVLKALRYLTRKGIIHRDLKPENLLLSERPSDHRPPIIKLTDFGIAKQLKGN----------GSPLYLAPETILEEGL-TYAVDIWACGVILYLLLVGYPPFWNEQTEFLLLSILQSNYTFPSPYWDTVSEPAKDLIRKMLVVDPRDRITAVEALKHEWVSGS 262          
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 188.734 bits (478), Expect = 6.690e-55
Identity = 104/275 (37.82%), Postives = 159/275 (57.82%), Query Frame = 3
Query:   81 KNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K + DI    +  +VLG GA+++V     +++    AVK   +   K    KE  IENE  ++ K+ H NI      Y   +  YL+ +L +GGEL+D I+ K  Y+E +  T+I+QV+DAVNYLH  GIVHRD+KPEN+LY   +  S I + DFG+S++  S +     +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  + + F    W + S     F+S L++++P  R +  +A++H W +
Sbjct:   16 KQVDDIKKIFDFKEVLGTGAFSEVVLAQEKLSGRMFAVKCIPK---KALKGKESSIENEIAVLRKIKHENIVALEDIYESPDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHKLGIVHRDLKPENLLYFNPQDESKIMISDFGLSKMEGSGD---VMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPAKRFTCEQALRHPWIA 282          
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 185.267 bits (469), Expect = 7.571e-54
Identity = 101/265 (38.11%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            +  +VLG GA+++V     + T +  A+K   +   K    KE  IENE  ++ K+ H NI      Y   N  YL+ +L +GGEL+D I+ K  Y+E +   +I+QV+DAVNYLHS GIVHRD+KPEN+LY +   +S I + DFG+S++  +        T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  + + F    W + S     F+S L++++P  R +  +A++H W +
Sbjct:   25 DFKEVLGTGAFSEVVMAREKATGKMVAIKCIPK---KALKGKETSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLVSGGELFDRIVEKGFYTEMDASRLIRQVLDAVNYLHSMGIVHRDLKPENLLYFSPHDDSKIMISDFGLSKMEGT---GGVMATACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPWIA 281          
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 184.882 bits (468), Expect = 2.272e-53
Identity = 98/276 (35.51%), Postives = 166/276 (60.14%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTE-FTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            K  +NI +I+   ++ + LG GA+++V+    + T +K A+K   + + +      +ENE  ++ ++ H N+      Y     +YL+ +L +GGEL+D I+ +  Y+E +   +I+QV+ AV+YLH NGIVHRD+KPENILY +++ +S I + DFG+S++      DT   +T   +  YVAPEVL  KP  Y+K VDCWS+G+IT++LL GYPP+  E+   ++  I  +++ F    W + S     F+  ++++ P  R S+ +A++H W 
Sbjct:   12 KSTENIQEIF---DLMEELGSGAFSEVFMVRERKTGKKFAMKCIKKKKKR---DINLENEMAVLRRIKHENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGLSKMT-----DTGIMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVITYILLCGYPPFYEESETKLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKTPSMRYSTEQALRHPWI 274          
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 179.104 bits (453), Expect = 1.790e-51
Identity = 98/257 (38.13%), Postives = 149/257 (57.98%), Query Frame = 3
Query:  135 GAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            GA+++V     + T +  A+K   +   K    KE  IENE  ++ K+ H NI      Y   N  YL+ +L +GGEL+D I+ K  Y+E +   +I+QV+DAVNYLHS GIVHRD+KPEN+LY +   +S I + DFG+S++  +        T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  + + F    W + S     F+S L++++P  R +  +A++H W +
Sbjct:   29 GAFSEVVMAREKATGKMVAIKCIPK---KALKGKETSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLVSGGELFDRIVEKGFYTEMDASRLIRQVLDAVNYLHSMGIVHRDLKPENLLYFSPHDDSKIMISDFGLSKMEGT---GGVMATACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPWIA 277          
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000012877.2 (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101157124])

HSP 1 Score: 175.637 bits (444), Expect = 4.067e-50
Identity = 95/276 (34.42%), Postives = 156/276 (56.52%), Query Frame = 3
Query:   72 KKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI-KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            K   NI D++   +    +G G++++V+    + T   +A+K   +   K      +ENE  I+ ++ H N+      Y     +YLV +L +GGEL+D I+ K  Y+E +   +IKQV+ AV+YLH N IVHRD+KPEN+L+   + N+ I + DFG+S+  +        +T   +  YVAPEVL  KP  Y+K VDCWS+G+I ++LL GYPP+  E    ++  I  +++ F    W + S     FV  ++++NP  R ++ +A++H W +
Sbjct:   12 KSTSNIKDVF---DFEGKMGSGSFSEVFMVREKKTGRLYALKCLKK---KHLAHSNLENEINILRRIKHENVVGLEDFYESRTHYYLVMQLVSGGELFDRILDKGVYTEKDASRVIKQVLQAVSYLHQNSIVHRDLKPENLLFFNTDENAKIMVSDFGLSKTPEHG----VMSTACGTPGYVAPEVLAQKP--YSKAVDCWSIGVIAYILLCGYPPFFEENETRLFSKIMRAEYAFHSPFWDDISESAKDFVRNMMEKNPLKRFTTEQALRHPWIA 275          
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Match: SMESG000077154.1 (SMESG000077154.1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 285/285 (100.00%), Postives = 285/285 (100.00%), Query Frame = 3
Query:   54 MPVELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH 908
            MPVELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH
Sbjct:    1 MPVELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH 285          
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Match: SMESG000053555.1 (SMESG000053555.1)

HSP 1 Score: 213.001 bits (541), Expect = 6.549e-65
Identity = 116/259 (44.79%), Postives = 168/259 (64.86%), Query Frame = 3
Query:  123 VLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDT--EFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWF 893
            VLGKG+YA+V+  +++++K K A K +  SR   +   ++++E  IM  L H +I             YL+ +  +GGEL+D II K  ++E E + +I Q+MDAV Y+H+ G+VHRD+KPENI+Y TK  +SIIKL DFGVS+LF   + +   EF +FIASKYYVAPE+L +   YTK VDCW+VGII +++L GY P+DG+T  +VY  I+ +   +  K+W + S + L F   LL +NP  RMSS  A++H W 
Sbjct:   56 VLGKGSYAEVFITIHKLSKVKFAAKKYLTSRSSSTTGLDMKSEFLIMRLLLHPHIVRAYEGINDNGTCYLISEYCSGGELFDRIISKTAFTEREVQILIGQLMDAVYYMHTVGVVHRDIKPENIIYFTKSKDSIIKLTDFGVSKLFSYSDSNVNPEFHSFIASKYYVAPEILDEHPCYTKEVDCWAVGIIIYIILIGYAPFDGKTSFEVYKKIKKNPVSYFSKEWKKYSQDSLHFTKSLLVKNPKERMSSKSAVEHPWL 314          
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.821e-54
Identity = 96/277 (34.66%), Postives = 160/277 (57.76%), Query Frame = 3
Query:  111 EMNDVLGKGAYAKVYCGLNQITK--------EKHAVKHFNRSRPKC---SIAKE--IENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLI--KPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFS 896
            +  +VLG GA+++V    +   +        +K A+   +R+  K    + A+E  ++NE  ++ KL H NI + +      + +YLV +L TGGEL+D I+ K  Y+E +   +I+QV++A +Y+H  G+VHRD+KPEN+LY + + +S I + DFG+S++   D+ D+   T   +  YVAPEVL       Y K VDCW+VG+I ++LL GYPP+  E   +++  I+ +++ F    W E S     F+  L+++NP  R S  +++ H W S
Sbjct:   11 QFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLRKLKHENIVQLLDVLESDDTYYLVMELVTGGELFDRIVEKGSYTEKDASNLIRQVLEATDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKM---DDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWIS 284          
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008997.1 (SMESG000008997.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.034e-50
Identity = 95/272 (34.93%), Postives = 157/272 (57.72%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH 908
            D+Y   EM + LG+GA++ V   + + +  + A K  N  R      +++E EA I   L H NI     +       YLVF L TGGEL+++I+ +  YSE +    ++Q++++VNY H N I+HRD+KPEN+L  +K  N+ +KL DFG++   K +E +  +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I++  F +   +W   ++E  + ++++L  NP  R+++A+A+KH W    +H
Sbjct:   10 DLY---EMKEELGRGAFSIVKRCVQKASNLEFAAKIINTKRLSSRDMQKLEREARICRLLKHPNIVRLHDSIQDDGFHYLVFDLVTGGELFEDIVAREFYSEADASNCMQQILESVNYCHQNNIIHRDLKPENLLLSSKSKNARVKLADFGLAVEMKENE-EASWLGFAGTPGYLSPEVLRKDP-YGKPVDVWACGVILYILLVGYPPFWDEDQNRLYAQIKSGLFDYPSPEWDTVTAEAKNLINQMLTVNPTKRITAAEALKHPWIYQREH 276          
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008997.1 (SMESG000008997.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.458e-50
Identity = 95/272 (34.93%), Postives = 157/272 (57.72%), Query Frame = 3
Query:   93 DIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHFNRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTGGELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYETKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYTKLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECSSECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH 908
            D+Y   EM + LG+GA++ V   + + +  + A K  N  R      +++E EA I   L H NI     +       YLVF L TGGEL+++I+ +  YSE +    ++Q++++VNY H N I+HRD+KPEN+L  +K  N+ +KL DFG++   K +E +  +  F  +  Y++PEVL K   Y K VD W+ G+I ++LL GYPP+  E    +Y  I++  F +   +W   ++E  + ++++L  NP  R+++A+A+KH W    +H
Sbjct:   10 DLY---EMKEELGRGAFSIVKRCVQKASNLEFAAKIINTKRLSSRDMQKLEREARICRLLKHPNIVRLHDSIQDDGFHYLVFDLVTGGELFEDIVAREFYSEADASNCMQQILESVNYCHQNNIIHRDLKPENLLLSSKSKNARVKLADFGLAVEMKENE-EASWLGFAGTPGYLSPEVLRKDP-YGKPVDVWACGVILYILLVGYPPFWDEDQNRLYAQIKSGLFDYPSPEWDTVTAEAKNLINQMLTVNPTKRITAAEALKHPWIYQREH 276          
The following BLAST results are available for this feature:
BLAST of Calcium-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK15.844e-5636.97calcium/calmodulin dependent protein kinase I [Sou... [more]
CAMK1G1.214e-5538.55calcium/calmodulin dependent protein kinase IG [So... [more]
CAMK1G1.214e-5538.55calcium/calmodulin dependent protein kinase IG [So... [more]
CAMK1D8.712e-5437.64calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK1D1.848e-5337.64calcium/calmodulin dependent protein kinase ID [So... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-11.707e-5236.74Calcium/calmodulin-dependent protein kinase type 1... [more]
unc-436.437e-4834.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.437e-4834.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.437e-4834.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-439.207e-4834.48Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI1.418e-4935.74gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKII3.028e-4835.00gene:FBgn0264607 transcript:FBtr0333673[more]
CaMKII4.465e-4835.00gene:FBgn0264607 transcript:FBtr0333675[more]
CaMKII4.494e-4835.00gene:FBgn0264607 transcript:FBtr0300377[more]
CaMKII4.494e-4835.00gene:FBgn0264607 transcript:FBtr0089217[more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1gb9.830e-5737.94calcium/calmodulin-dependent protein kinase IGb [S... [more]
camk1da7.479e-5638.13calcium/calmodulin-dependent protein kinase 1Da [S... [more]
camk1db1.230e-5537.68calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk1db2.196e-5537.45calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk1b2.662e-5437.77calcium/calmodulin-dependent protein kinase Ib [So... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlh31.111e-5640.31mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852][more]
mlh32.308e-5640.15mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852][more]
dnz11.037e-5437.63DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.082e-5437.41DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.345e-5437.41DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk1g4.350e-5739.15calcium/calmodulin-dependent protein kinase I gamm... [more]
Camk13.102e-5637.41calcium/calmodulin-dependent protein kinase I [Sou... [more]
Camk1g3.119e-5638.18calcium/calmodulin-dependent protein kinase I gamm... [more]
Camk1d1.118e-5336.96calcium/calmodulin-dependent protein kinase ID [So... [more]
Camk1d6.953e-5236.33calcium/calmodulin-dependent protein kinase ID [So... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25323|MYLKA_DICDI1.040e-5838.31Myosin light chain kinase A OS=Dictyostelium disco... [more]
sp|O15865|CDPK2_PLAFK6.340e-5640.52Calcium-dependent protein kinase 2 OS=Plasmodium f... [more]
sp|Q8ICR0|CDPK2_PLAF76.355e-5640.52Calcium-dependent protein kinase 2 OS=Plasmodium f... [more]
sp|Q63450|KCC1A_RAT2.124e-5537.41Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q91YS8|KCC1A_MOUSE2.170e-5537.41Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1A0D65.982e-5939.02Myosin light chain kinase (Fragment) OS=Dictyostel... [more]
A0A418CH093.094e-5639.18Protein kinase domain-containing protein (Fragment... [more]
A0A396ZN313.345e-5639.18Protein kinase domain-containing protein (Fragment... [more]
A0A397CPL84.209e-5639.18Protein kinase domain-containing protein (Fragment... [more]
Q86S949.284e-5639.00Calcium-dependent protein kinase (Fragment) OS=Bab... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1db9.919e-5638.77calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb1.524e-5437.63calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb4.679e-5437.28calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb6.414e-5438.08calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb1.076e-5337.41calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008748.12.392e-4834.10pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000003135.18.746e-4733.72pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000000175.13.345e-3832.05pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
RPS6KA31.885e-3729.85ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
camk2a2.756e-3736.46calcium/calmodulin-dependent protein kinase II alp... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK16.025e-4033.10Calmodulin-dependent protein kinase; may play a ro... [more]
CMK28.981e-3933.59Calmodulin-dependent protein kinase; may play a ro... [more]
RAD531.700e-3832.49DNA damage response protein kinase; required for c... [more]
DUN12.106e-3531.67Cell-cycle checkpoint S/T protein kinase; required... [more]
SCH92.540e-3132.31AGC family protein kinase; functional ortholog of ... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362531.497e-5336.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498981.681e-4634.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305372.193e-4532.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356115.186e-4533.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330227.103e-4532.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1da6.690e-5537.82calcium/calmodulin dependent protein kinase ID [So... [more]
camk1db7.571e-5438.11calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb2.272e-5335.51calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db1.790e-5138.13calcium/calmodulin-dependent protein kinase type 1... [more]
ENSORLT00000012877.24.067e-5034.42calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077154.10.000e+0100.00SMESG000077154.1[more]
SMESG000053555.16.549e-6544.79SMESG000053555.1[more]
SMESG000078937.13.821e-5434.66SMESG000078937.1[more]
SMESG000008997.11.034e-5034.93SMESG000008997.1[more]
SMESG000008997.11.458e-5034.93SMESG000008997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030428 ID=SMED30030428|Name=Calcium-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1277bp
GACCGATTCATTGAAATCGATGCTCACTAATTTATAAGTAATTTAATATC
TCGATGCCTGTTGAGTTGATAAAAAAATTTAAAAATATAATCGACATTTA
CTTATGGGACGAAATGAATGATGTGCTGGGAAAAGGCGCGTACGCCAAAG
TCTACTGCGGACTGAACCAAATAACGAAAGAGAAACACGCAGTGAAACAT
TTCAATAGAAGTCGACCAAAATGTTCAATTGCCAAAGAAATTGAGAACGA
AGCGGAAATCATGTCCAAATTAAATCATCGGAATATCGCAGAATATGTCG
CAGCCTACGGCTGTGGCAATGAATTTTATTTAGTCTTTAAGTTATACACT
GGCGGAGAACTCTACGATGAAATTATTAGGAAGCGAAAATATTCAGAAAA
CGAATGCAAAACAATCATAAAACAAGTGATGGATGCTGTGAACTACCTTC
ACAGCAATGGGATCGTCCATAGGGATGTGAAACCGGAAAACATTCTTTAC
GAAACTAAAGAATGTAATTCAATAATAAAACTTATAGATTTCGGAGTTTC
TAGGCTGTTTAAATCTGACGAACCAGACACGGAATTTACTACTTTTATTG
CCAGCAAATATTATGTCGCTCCCGAAGTATTAATAAAGCCAATACTCTAT
ACGAAATTGGTTGATTGCTGGTCAGTCGGCATTATAACTCACGTACTTTT
GACTGGCTATCCACCATACGATGGGGAAACGGTCATGGACGTTTATATTA
ATATACGCAACAGTAAATTTATGTTTATTGAAAAAGATTGGGGAGAATGC
TCGTCAGAATGCCTATCGTTTGTCAGCAAGCTATTGAAAAGAAATCCTCA
TCATCGAATGAGCAGTGCAAAAGCAATAAAGCACAAATGGTTTTCCCTCT
CTCAACATTGAATTTCTACACAATCAAAAATTATTTCACTAAAGCCTCAG
CTATCAAAATGAGCCGACAGAAATGTTTAAAAATTTCTTCATTATTGCAG
AAATGTCTTATGGTTGATTATTGAAAGTAAAACCTAGAATAATGTCTTTT
TGATGATTATTGACATATGAAAATTGTGTCATTTTGCCCATAGAAGTGCT
AATAAAATTATCCAAATAATCGGAGGAAACTAATATGAGTGGGGAGATTT
AATTCGATAAAAATCAAAAGTAGCGGCATGTTTCCTATCTGATCCTGTTT
TTGGACTCCCCTTTACTACTTACTAATTAATAAATATTTCACATTTCCTT
AAACTAGATAAAGTGTGTTGTTATGCG
back to top

protein sequence of SMED30030428-orf-1

>SMED30030428-orf-1 ID=SMED30030428-orf-1|Name=SMED30030428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MPVELIKKFKNIIDIYLWDEMNDVLGKGAYAKVYCGLNQITKEKHAVKHF
NRSRPKCSIAKEIENEAEIMSKLNHRNIAEYVAAYGCGNEFYLVFKLYTG
GELYDEIIRKRKYSENECKTIIKQVMDAVNYLHSNGIVHRDVKPENILYE
TKECNSIIKLIDFGVSRLFKSDEPDTEFTTFIASKYYVAPEVLIKPILYT
KLVDCWSVGIITHVLLTGYPPYDGETVMDVYINIRNSKFMFIEKDWGECS
SECLSFVSKLLKRNPHHRMSSAKAIKHKWFSLSQH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005509calcium ion binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 19..280
e-value: 8.5E-83
score: 291.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 23..280
e-value: 3.8E-67
score: 226.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 19..280
score: 44.541
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 13..276
e-value: 9.9E-20
score: 68.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 21..100
e-value: 2.3E-85
score: 289.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 101..282
e-value: 2.3E-85
score: 289.1
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 11..281
NoneNo IPR availablePANTHERPTHR24347:SF412CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE Icoord: 11..281
NoneNo IPR availableCDDcd05117STKc_CAMKcoord: 20..279
e-value: 5.94297E-102
score: 296.31
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 137..149
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 21..281