Ubiquitin carboxyl-terminal hydrolase 7

Overview
NameUbiquitin carboxyl-terminal hydrolase 7
Smed IDSMED30030425
Length (bp)4140
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase 7 (SMED30030425) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase 7 (SMED30030425) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase 7 (SMED30030425) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase 7 (SMED30030425) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030425

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030425SMESG000050890.1 dd_Smed_v4_1847_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Match: USP7 (ubiquitin specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:12630])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 467/1126 (41.47%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E LV+V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   64 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1086          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Match: USP7 (ubiquitin specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:12630])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 467/1126 (41.47%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E LV+V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   80 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1102          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Match: USP7 (ubiquitin specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:12630])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 466/1126 (41.39%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL+               KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E LV+V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:  115 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDLLQF------------FKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1137          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Match: USP7 (ubiquitin specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:12630])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 421/976 (43.14%), Postives = 598/976 (61.27%), Query Frame = 1
Query:  799 PDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPF 3681
            PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E LV+V+H   +    FGIPF
Sbjct:    8 PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPF 908          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Match: USP7 (ubiquitin specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:12630])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 286/450 (63.56%), Postives = 353/450 (78.44%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDRS-QRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDI 2055
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  +
Sbjct:   22 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKL 466          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 449.129 bits (1154), Expect = 1.257e-136
Identity = 243/559 (43.47%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNP---------DRSQRCMGFFLQCNN---TSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVD--WDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENS---HNSKTKYILHTVLVHSGDNHGGHYVAYLN---------PSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFD 2238
            DP  P G L L I   SK+     R + +I+S +PI VR +PW+IL + R Q           +RS    GFFLQCNN     +  +W C+  A L ++    N     I K I H+F   E DWG+S++  +  L NP  G+V  +D++ LR +  AD P G +  WDSK+HTG +GL+NQGATCYMNS+LQ+ +FT   R+AVY +   T+  + ++ LA+QRVFYELQ   +AV T  LT++FGW+ LD F QHD QE CRVLLDNLE+KMKGT  E +IPNLF G M S+I+C+ V  ES R E+FYD+QL V G   +  AF+ Y T E LD +NKYDAG++G+Q AEKG+ F++ PP+L++QLMRFQY        KIN+RF FP  ++L+   E           Y LH VLVHSG+ HGGHYV Y+N         P+   +W KFDDDVVSR +  +AI+SN+GG ++ M+    ++AYMLVY+ +  I + L PI    IP ++ + F  E+   ++++K+     L   +++V  +       ++L D
Sbjct:   26 DPFGPEGHLSLDIDCFSKFMS---RSDNRIMS-KPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVLEVL----NADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYV-VNDTIKLRCRFTADVPTGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQRAEKGVKFVELPPILHVQLMRFQY---CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGG-EKTMN----SSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREKKKLEEEQLCMGIVLVTPDIVASNHSFDLVD 567          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 448.743 bits (1153), Expect = 1.431e-136
Identity = 243/559 (43.47%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNP---------DRSQRCMGFFLQCNN---TSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVD--WDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENS---HNSKTKYILHTVLVHSGDNHGGHYVAYLN---------PSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFD 2238
            DP  P G L L I   SK+     R + +I+S +PI VR +PW+IL + R Q           +RS    GFFLQCNN     +  +W C+  A L ++    N     I K I H+F   E DWG+S++  +  L NP  G+V  +D++ LR +  AD P G +  WDSK+HTG +GL+NQGATCYMNS+LQ+ +FT   R+AVY +   T+  + ++ LA+QRVFYELQ   +AV T  LT++FGW+ LD F QHD QE CRVLLDNLE+KMKGT  E +IPNLF G M S+I+C+ V  ES R E+FYD+QL V G   +  AF+ Y T E LD +NKYDAG++G+Q AEKG+ F++ PP+L++QLMRFQY        KIN+RF FP  ++L+   E           Y LH VLVHSG+ HGGHYV Y+N         P+   +W KFDDDVVSR +  +AI+SN+GG ++ M+    ++AYMLVY+ +  I + L PI    IP ++ + F  E+   ++++K+     L   +++V  +       ++L D
Sbjct:   26 DPFGPEGHLSLDIDCFSKFMS---RSDNRIMS-KPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVLEVL----NADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYV-VNDTIKLRCRFTADVPTGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQRAEKGVKFVELPPILHVQLMRFQY---CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGG-EKTMN----SSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREKKKLEEEQLCMGIVLVTPDIVASNHSFDLVD 567          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 448.743 bits (1153), Expect = 1.444e-136
Identity = 243/559 (43.47%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNP---------DRSQRCMGFFLQCNN---TSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVD--WDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENS---HNSKTKYILHTVLVHSGDNHGGHYVAYLN---------PSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFD 2238
            DP  P G L L I   SK+     R + +I+S +PI VR +PW+IL + R Q           +RS    GFFLQCNN     +  +W C+  A L ++    N     I K I H+F   E DWG+S++  +  L NP  G+V  +D++ LR +  AD P G +  WDSK+HTG +GL+NQGATCYMNS+LQ+ +FT   R+AVY +   T+  + ++ LA+QRVFYELQ   +AV T  LT++FGW+ LD F QHD QE CRVLLDNLE+KMKGT  E +IPNLF G M S+I+C+ V  ES R E+FYD+QL V G   +  AF+ Y T E LD +NKYDAG++G+Q AEKG+ F++ PP+L++QLMRFQY        KIN+RF FP  ++L+   E           Y LH VLVHSG+ HGGHYV Y+N         P+   +W KFDDDVVSR +  +AI+SN+GG ++ M+    ++AYMLVY+ +  I + L PI    IP ++ + F  E+   ++++K+     L   +++V  +       ++L D
Sbjct:   26 DPFGPEGHLSLDIDCFSKFMS---RSDNRIMS-KPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVLEVL----NADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYV-VNDTIKLRCRFTADVPTGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQRAEKGVKFVELPPILHVQLMRFQY---CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGG-EKTMN----SSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREKKKLEEEQLCMGIVLVTPDIVASNHSFDLVD 567          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 448.743 bits (1153), Expect = 1.462e-136
Identity = 243/559 (43.47%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNP---------DRSQRCMGFFLQCNN---TSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVD--WDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENS---HNSKTKYILHTVLVHSGDNHGGHYVAYLN---------PSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFD 2238
            DP  P G L L I   SK+     R + +I+S +PI VR +PW+IL + R Q           +RS    GFFLQCNN     +  +W C+  A L ++    N     I K I H+F   E DWG+S++  +  L NP  G+V  +D++ LR +  AD P G +  WDSK+HTG +GL+NQGATCYMNS+LQ+ +FT   R+AVY +   T+  + ++ LA+QRVFYELQ   +AV T  LT++FGW+ LD F QHD QE CRVLLDNLE+KMKGT  E +IPNLF G M S+I+C+ V  ES R E+FYD+QL V G   +  AF+ Y T E LD +NKYDAG++G+Q AEKG+ F++ PP+L++QLMRFQY        KIN+RF FP  ++L+   E           Y LH VLVHSG+ HGGHYV Y+N         P+   +W KFDDDVVSR +  +AI+SN+GG ++ M+    ++AYMLVY+ +  I + L PI    IP ++ + F  E+   ++++K+     L   +++V  +       ++L D
Sbjct:   26 DPFGPEGHLSLDIDCFSKFMS---RSDNRIMS-KPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVLEVL----NADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYV-VNDTIKLRCRFTADVPTGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQRAEKGVKFVELPPILHVQLMRFQY---CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGG-EKTMN----SSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREKKKLEEEQLCMGIVLVTPDIVASNHSFDLVD 567          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 448.743 bits (1153), Expect = 1.646e-136
Identity = 243/559 (43.47%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNP---------DRSQRCMGFFLQCNN---TSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVD--WDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENS---HNSKTKYILHTVLVHSGDNHGGHYVAYLN---------PSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFD 2238
            DP  P G L L I   SK+     R + +I+S +PI VR +PW+IL + R Q           +RS    GFFLQCNN     +  +W C+  A L ++    N     I K I H+F   E DWG+S++  +  L NP  G+V  +D++ LR +  AD P G +  WDSK+HTG +GL+NQGATCYMNS+LQ+ +FT   R+AVY +   T+  + ++ LA+QRVFYELQ   +AV T  LT++FGW+ LD F QHD QE CRVLLDNLE+KMKGT  E +IPNLF G M S+I+C+ V  ES R E+FYD+QL V G   +  AF+ Y T E LD +NKYDAG++G+Q AEKG+ F++ PP+L++QLMRFQY        KIN+RF FP  ++L+   E           Y LH VLVHSG+ HGGHYV Y+N         P+   +W KFDDDVVSR +  +AI+SN+GG ++ M+    ++AYMLVY+ +  I + L PI    IP ++ + F  E+   ++++K+     L   +++V  +       ++L D
Sbjct:   26 DPFGPEGHLSLDIDCFSKFMS---RSDNRIMS-KPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVLEVL----NADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYV-VNDTIKLRCRFTADVPTGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQRAEKGVKFVELPPILHVQLMRFQY---CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGG-EKTMN----SSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREKKKLEEEQLCMGIVLVTPDIVASNHSFDLVD 567          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0073641)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 425/1167 (36.42%), Postives = 620/1167 (53.13%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVK-NIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIK-------DALPSSDNPVMIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESF----TSPYNGLIIIYE-PNI-SRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARY-IDIMKALVANIPGTEIGKIQL------YKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIIS----QIPLKMKLSEFQP-----NPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            D  R   T    + N+ + K       ++ LSP P++VR LPW+I+ +        + R +GFFLQCN  ++S  W C+A AELRL C +  P  Q   +  I+H F+ +END+GYS+FITW +L + +K +V  ++S+ L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ L+FTN LR +VY +PTE DD  +SV L+LQRVF+ELQ+G++ VGTK+LTKSFGWETLD+FMQHD QE  RVLLD LESKMKGT +E TIP LF GKM S+I+C  V   S R E FYDIQL +K   +IYE+F +Y+  ETL+GDNKYDAG +G+Q+A KG++F  FPPVL+L LMRFQYD  TD++IK NDRFEF   ++L +YL  S N+   Y+LH VLVHSGDNHGGHYV ++NP  +  W+KFDDDVVS C ++EAI  NYGG D+++S   +C+NAYMLVY+ + ++  +L  I+  +I ++L +R   EK IE  +RKE+  A  Y SV ++L+E+F       LFD+EK    R  R  +   V EL             R+R+W +     Q + S  +         + + +S  P +IW+Q L   +    LPP + K + L+F KY++P+   ++++          + D+   +  +       +LT+++E   + +  +    ES          G I+I+E  N+ +++ L  +G                     D+  DL  +IE+ F            ++K NP+     L    RY  D +   VA    T+  K+Q       YK T            G+ V  TF+GT+ DL+S   QS                                       KR+++Q L + IHE++  +QF C++V    +++ E+ +   +      +L EA K      N+    RL ++ +H+I++     IPL   L   +         +   IE +P E++++  + E L+ V+H   +    FGIPF  K    E    L+ RI+ R+    KE+E Y+  + +       N            + + + + ++ S +S                     P+  LDH     KR+  N SEK IKI+N
Sbjct:   96 DQFRSETTFSFTVENVVQLK-------SQRLSP-PVYVRMLPWRIMVI-------PNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHK--PDAQPFTRARIKHLFYSKENDYGYSNFITWQELKDSEKSYV-HNNSITLEVHVVADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEENFEEQHKRRLFDLEKVH-PRVFRIKQNQTVDELVDLFVRGFGVSRQRMRMWNLCTAQTQ-KFSHFDFVAEGSRTIEQISTSQKPWVIWLQ-LAWTDVPGPLPPFNPKTESLLFLKYYDPRNKRLNYIGCTQQPHTRRLIDLVPDVNSKLGFEPDTELTIYDEYADKKLVNLNEPIESALFIPQDHLQGHILIFERENVDAKLDLPTVG---------------------DYFLDLVYRIEIIF------------SDKCNPNEPDFTLELSNRYNYDQLANAVAERLNTDPQKLQFFMCINNYKET-----------AGNAVPYTFKGTIKDLVSYTKQSST-------------------------------------KRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRRKLRLLKISNHKIVAVCKDDIPLDTLLKSNESITTAQGAQKTFRIEEVPAEDMQL-AENEFLIPVAHFSKELYNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGHNADVN------------DNTPVDLEVYRSWTSG------------------QLPFFGLDHINKSRKRSSLNFSEKAIKIYN 1129          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0342732)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 423/1167 (36.25%), Postives = 617/1167 (52.87%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVK-NIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIK-------DALPSSDNPVMIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESF----TSPYNGLIIIYE-PNI-SRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARY-IDIMKALVANIPGTEIGKIQL------YKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIIS----QIPLKMKLSEFQP-----NPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            D  R   T    + N+ + K       ++ LSP P++VR LPW+I+ +        + R +GFFLQCN  ++S  W C+A AELRL C +  P  Q   +  I+H F+ +END+GYS+FITW +L + +K +V  ++S+ L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ L+FTN LR +VY +PTE DD  +SV L+LQRVF+ELQ+G++ VGTK+LTKSFGWETLD+FMQHD QE  RVLLD LESKMKGT +E TIP LF GKM S+I+C  V   S R E FYDIQL +K   +IYE+F +Y+  ETL+GDNKYDAG +G+Q+A KG++F  FPPVL+L LMRFQYD  TD++IK NDRFEF   ++L +YL  S N+   Y+LH VLVHSGDNHGGHYV ++NP  +  W+KFDDDVVS C ++EAI  NYGG D+++S   +C+NAYMLVY+ + ++  +L  I+  +I ++L +R   EK IE  +RKE+  A  Y SV ++L+E+F       LFD+EK    R  R  +   V EL             R+R+W +     Q + S  +         + + +S  P +IW+Q L   +    LPP + K + L+F KY++P+   ++++          + D+   +  +       +LT+++E   + +  +    ES          G I+I+E  N+ +++ L  +G                     D+  DL  +IE+ F            ++K NP+     L    RY  D +   VA    T+  K+Q       YK T            G+ V  TF+    DL+S   QS                                       KR+++Q L + IHE++  +QF C++V    +++ E+ +   +      +L EA K      N+    RL ++ +H+I++     IPL   L   +         +   IE +P E++++  + E L+ V+H   +    FGIPF  K    E    L+ RI+ R+    KE+E Y+  + +       N            + + + + ++ S +S                     P+  LDH     KR+  N SEK IKI+N
Sbjct:   96 DQFRSETTFSFTVENVVQLK-------SQRLSP-PVYVRMLPWRIMVI-------PNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHK--PDAQPFTRARIKHLFYSKENDYGYSNFITWQELKDSEKSYV-HNNSITLEVHVVADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEENFEEQHKRRLFDLEKVH-PRVFRIKQNQTVDELVDLFVRGFGVSRQRMRMWNLCTAQTQ-KFSHFDFVAEGSRTIEQISTSQKPWVIWLQ-LAWTDVPGPLPPFNPKTESLLFLKYYDPRNKRLNYIGCTQQPHTRRLIDLVPDVNSKLGFEPDTELTIYDEYADKKLVNLNEPIESALFIPQDHLQGHILIFERENVDAKLDLPTVG---------------------DYFLDLVYRIEIIF------------SDKCNPNEPDFTLELSNRYNYDQLANAVAERLNTDPQKLQFFMCINNYKET-----------AGNAVPYTFK----DLVSYTKQSST-------------------------------------KRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRRKLRLLKISNHKIVAVCKDDIPLDTLLKSNESITTAQGAQKTFRIEEVPAEDMQL-AENEFLIPVAHFSKELYNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGHNADVN------------DNTPVDLEVYRSWTSG------------------QLPFFGLDHINKSRKRSSLNFSEKAIKIYN 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077096)

HSP 1 Score: 202.216 bits (513), Expect = 6.290e-52
Identity = 118/296 (39.86%), Postives = 168/296 (56.76%), Query Frame = 1
Query:  952 NFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNS 1815
            NF+ R+  +G      W  +      FV S        +  A+A       S    G+VGL NQ  TCY+NSLLQALF T + R A+Y    + D+E +++   LQ++F  LQ   KA V T  LT+SFGW++ + + QHD QELCRV+ D LE K K T+  + I NL+ GKM  +++C++   E  RE+ F DI L V+  G+S  Y    EA   ++  ETLDG+N+Y   +   + DA KG+ F  FP +L L L RF +DY+T   IK+NDR  FP +L+L+ ++  S NS
Sbjct:  349 NFYRRK--YGGDELRAWQRVNTTGADFVSS-----ATTETEAEARQA----SLGPRGYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNS 633          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077095)

HSP 1 Score: 202.216 bits (513), Expect = 6.290e-52
Identity = 118/296 (39.86%), Postives = 168/296 (56.76%), Query Frame = 1
Query:  952 NFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNS 1815
            NF+ R+  +G      W  +      FV S        +  A+A       S    G+VGL NQ  TCY+NSLLQALF T + R A+Y    + D+E +++   LQ++F  LQ   KA V T  LT+SFGW++ + + QHD QELCRV+ D LE K K T+  + I NL+ GKM  +++C++   E  RE+ F DI L V+  G+S  Y    EA   ++  ETLDG+N+Y   +   + DA KG+ F  FP +L L L RF +DY+T   IK+NDR  FP +L+L+ ++  S NS
Sbjct:  349 NFYRRK--YGGDELRAWQRVNTTGADFVSS-----ATTETEAEARQA----SLGPRGYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNS 633          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0306259)

HSP 1 Score: 201.83 bits (512), Expect = 7.282e-52
Identity = 118/296 (39.86%), Postives = 168/296 (56.76%), Query Frame = 1
Query:  952 NFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNS 1815
            NF+ R+  +G      W  +      FV S        +  A+A       S    G+VGL NQ  TCY+NSLLQALF T + R A+Y    + D+E +++   LQ++F  LQ   KA V T  LT+SFGW++ + + QHD QELCRV+ D LE K K T+  + I NL+ GKM  +++C++   E  RE+ F DI L V+  G+S  Y    EA   ++  ETLDG+N+Y   +   + DA KG+ F  FP +L L L RF +DY+T   IK+NDR  FP +L+L+ ++  S NS
Sbjct:  331 NFYRRK--YGGDELRAWQRVNTTGADFVSS-----ATTETEAEARQA----SLGPRGYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNS 615          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Match: usp7 (ubiquitin specific peptidase 7 (herpes virus-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-3656])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 461/1126 (40.94%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GFV  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+         YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EA   NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V +V ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL+               KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+   +   RL E+  ++II        L    P  +R   IE IP +++ ++++ E L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   81 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFV-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDVKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEATEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDMDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLAEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQGTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDTSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDLLQF------------FKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKAIWLNSMFREE-EITLYPDKHGCVRDLLEECKKAVELSDKGSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKENEMLIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1103          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Match: usp7 (ubiquitin specific peptidase 7 (herpes virus-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-3656])

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 461/1133 (40.69%), Postives = 664/1133 (58.61%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GFV  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+         YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EA   NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V +V ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL+               KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+   +   RL E+  ++II        L    P  +R   IE IP +++ ++++ E L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   81 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFV-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDVKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSVTAPIWCKFDDDVVSRCTKEEATEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDMDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLAEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQGTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDTSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDLLQF------------FKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKAIWLNSMFREE-EITLYPDKHGCVRDLLEECKKAVELSDKGSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKENEMLIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1110          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Match: usp47 (ubiquitin specific peptidase 47 [Source:ZFIN;Acc:ZDB-GENE-070719-7])

HSP 1 Score: 198.749 bits (504), Expect = 6.586e-51
Identity = 137/417 (32.85%), Postives = 204/417 (48.92%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYL--ENSHNSKTKYILHTVLVHSGDNH---------------------------------------------------GGHYVAYLNPSGENEWYKFDDDVVSRCS----RREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   ES R + + DI L ++  G S  +    EA   +I  ETLDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S ++  E+  + +T+    +   + G  H                                                   GGHY A +    +++WY F+D  VS+ +    R+    S+        +    TNAYML+Y  + D     + +  +D P ++ +    EK  E+Q+++++
Sbjct:  166 KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYNWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDNASSAERVLKPKSSLTFELFSVMVHSGSAAGGHYYACIKSFSDSQWYSFNDQHVSKITQDDIRKTYGGSSGSRGYYSSAFASSTNAYMLMYRLK-DPSRNAKFLEVEDFPEHIKRLVQREKESEEQEKRQR 581          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 170.629 bits (431), Expect = 2.392e-44
Identity = 122/375 (32.53%), Postives = 186/375 (49.60%), Query Frame = 1
Query: 1072 NADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLP--------TETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLE---SKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGE-YGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSG-DNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMS--------IKQCT-------NAYMLVYMSEGDIKELLQPISRDDIPTNLHQ 2109
            N D P+    + +    FVGL N GATCY+N+ LQ  F   +LR+A+Y           T++D E R++   LQ +F  LQ   +  +    L K+ G   LDT  Q DAQE  ++ L  LE   SK K   +++ I   FCG+      C K   ES     FY+++L ++G+ ++ E   E++  E LDGDN+Y        Q+A + I     P  L  QLMRF +D ++    K+N    FP  LD+  +LE     K  Y L  VL+H G   + GHY+A++  +  N+WYKF+D+ + +   ++  L    G +ED++          +C+       NAYMLVY  +   +E+ Q  S  D+P  L +
Sbjct:   75 NIDDPNS---ERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALG---LDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLE-GREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL----GIEEDIAETAKSQTRKPKCSKGYHCSRNAYMLVYKQQ--TEEINQTESPVDVPAFLQK 436          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 169.474 bits (428), Expect = 4.223e-42
Identity = 122/375 (32.53%), Postives = 186/375 (49.60%), Query Frame = 1
Query: 1072 NADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLP--------TETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLE---SKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGE-YGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSG-DNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMS--------IKQCT-------NAYMLVYMSEGDIKELLQPISRDDIPTNLHQ 2109
            N D P+    + +    FVGL N GATCY+N+ LQ  F   +LR+A+Y           T++D E R++   LQ +F  LQ   +  +    L K+ G   LDT  Q DAQE  ++ L  LE   SK K   +++ I   FCG+      C K   ES     FY+++L ++G+ ++ E   E++  E LDGDN+Y        Q+A + I     P  L  QLMRF +D ++    K+N    FP  LD+  +LE     K  Y L  VL+H G   + GHY+A++  +  N+WYKF+D+ + +   ++  L    G +ED++          +C+       NAYMLVY  +   +E+ Q  S  D+P  L +
Sbjct:   74 NIDDPNS---ERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALG---LDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLE-GREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL----GIEEDIAETAKSQTRKPKCSKGYHCSRNAYMLVYKQQ--TEEINQTESPVDVPAFLQK 435          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Match: syp (synaptophysin [Source:Xenbase;Acc:XB-GENE-943861])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 465/1126 (41.30%), Postives = 667/1126 (59.24%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  +     +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+   +     YILH VLVHSGDNHGGHYV YLNP GE +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P++ S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C++++   +E+ EV +   + GC  D+L E ++  +L+   +   RL E+  ++II        L    P  +R   IE IP ++++I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   80 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD--EEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYSHVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCVWLNSQFREE-EVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVSLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1102          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Match: syp (synaptophysin [Source:Xenbase;Acc:XB-GENE-943861])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 465/1126 (41.30%), Postives = 665/1126 (59.06%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  +     +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+   +     YILH VLVHSGDNHGGHYV YLNP GE +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P++ S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G      PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C++++   +E+ EV +   + GC  D+L E ++  +L+   +   RL E+  ++II        L    P  +R   IE IP ++++I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   60 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD--EEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYSHVAKT-VAQRLNTDPMLLQFFK----SQGDG----PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCVWLNSQFREE-EVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVSLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1080          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Match: syp (synaptophysin [Source:Xenbase;Acc:XB-GENE-943861])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 465/1126 (41.30%), Postives = 667/1126 (59.24%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  +     +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+   +     YILH VLVHSGDNHGGHYV YLNP GE +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P++ S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C++++   +E+ EV +   + GC  D+L E ++  +L+   +   RL E+  ++II        L    P  +R   IE IP ++++I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:  109 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD--EEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYSHVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCVWLNSQFREE-EVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVSLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1131          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Match: syp (synaptophysin [Source:Xenbase;Acc:XB-GENE-943861])

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 465/1134 (41.01%), Postives = 667/1134 (58.82%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGEN--------EWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  +     +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+   +     YILH VLVHSGDNHGGHYV YLNP GE         +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P++ S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C++++   +E+ EV +   + GC  D+L E ++  +L+   +   RL E+  ++II        L    P  +R   IE IP ++++I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   69 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD--EEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKKHFLFFLQWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYSHVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCVWLNSQFREE-EVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVSLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1099          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Match: syp (synaptophysin [Source:Xenbase;Acc:XB-GENE-943861])

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 465/1157 (40.19%), Postives = 667/1157 (57.65%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRK-------AVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENE------------------------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  +     +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRK       AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+   +     YILH VLVHSGDNHGGHYV YLNP GE +                        W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P++ S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C++++   +E+ EV +   + GC  D+L E ++  +L+   +   RL E+  ++II        L    P  +R   IE IP ++++I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +          ++ EE+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   67 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD--EEKFFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EDDKVTFEVYVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKKVIYFCKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGEGKCIFTFPKSKNMGIIYLYYICNGHSWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDQDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDYEADCSKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKSRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYSHVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCVWLNSQFREE-EVTLYPDKHGCVRDLLEECKRAVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVEIDKENEMLITVAHFHKEVFGTFGIPFLLRIQQGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQ----------YINEEDY-EVSLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1120          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Match: Usp7 (ubiquitin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:2182061])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 466/1126 (41.39%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +  ++   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   81 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--DKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGDKASGRLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1103          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Match: Usp7 (ubiquitin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:2182061])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 466/1126 (41.39%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +  ++   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:  121 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--DKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGDKASGRLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1143          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Match: Usp7 (ubiquitin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:2182061])

HSP 1 Score: 406.757 bits (1044), Expect = 1.521e-130
Identity = 189/281 (67.26%), Postives = 228/281 (81.14%), Query Frame = 1
Query: 1207 AVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSE 2046
            AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E
Sbjct:    1 AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE 281          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 207.994 bits (528), Expect = 9.924e-54
Identity = 141/421 (33.49%), Postives = 208/421 (49.41%), Query Frame = 1
Query: 1105 SKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY---------------------------------------------LENSHNSKT-----------KYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCS----RREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            +K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   E  R + + DI L ++  G+S  +    EA   +I  E LDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S +                                             LE+S  S+             Y L +V+VHSG   GGHY A +    +++WY F+D  VSR +    ++    S+        +    TNAYML+Y  + D     + +  D+ P ++      E+ +E+Q+++++
Sbjct:  181 NKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDAVDEGICLESSSGSEKISKPGLEKNSLMYELFSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLK-DPTRNAKFLEVDEYPEHIKNLVQKERELEEQEKRQR 600          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 207.994 bits (528), Expect = 1.163e-53
Identity = 141/421 (33.49%), Postives = 208/421 (49.41%), Query Frame = 1
Query: 1105 SKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY---------------------------------------------LENSHNSKT-----------KYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCS----RREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            +K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   E  R + + DI L ++  G+S  +    EA   +I  E LDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S +                                             LE+S  S+             Y L +V+VHSG   GGHY A +    +++WY F+D  VSR +    ++    S+        +    TNAYML+Y  + D     + +  D+ P ++      E+ +E+Q+++++
Sbjct:  161 NKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDAVDEGICLESSSGSEKISKPGLEKNSLMYELFSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLK-DPTRNAKFLEVDEYPEHIKNLVQKERELEEQEKRQR 580          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Match: sp|Q93009|UBP7_HUMAN (Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 467/1126 (41.47%), Postives = 664/1126 (58.97%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E LV+V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   80 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1102          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Match: sp|Q4VSI4|UBP7_RAT (Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 466/1126 (41.39%), Postives = 665/1126 (59.06%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +  ++   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C +V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   81 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--DKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGSKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGDEASGRLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVNIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1103          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Match: sp|Q6A4J8|UBP7_MOUSE (Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 466/1126 (41.39%), Postives = 663/1126 (58.88%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  R +  ++   + I H FF+ ENDWG+S+F+ W+++T+P+KGF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQ ++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S+++E  ++++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+  RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F CI+++   +E+ E+ +   + GC  D+L E +K  +L    +   RL E+  ++II        L    P  +R   IE IP +++ I+++ E L++V+H   +    FGIPF +++   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR+R    EK IKIHN
Sbjct:   81 RLSESVLSP-PCFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDD--DKSFSRRISHLFFHEENDWGFSNFMAWSEVTDPEKGFI-DDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRY-TVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELGDKASGRLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRSRYTYLEKAIKIHN 1103          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Match: sp|Q6U7I1|UBP7_CHICK (Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus gallus OX=9031 GN=USP7 PE=2 SV=1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 463/1128 (41.05%), Postives = 662/1128 (58.69%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDH--KMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP P FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F+ W+++T+P+KGF+  +D +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL  PPVL+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ +       YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK IE QKRKE+  A+LY  V IV ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D+IRLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AK++  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C +++   +E+ E+ V   + GC  D+L E +K+ +L+   +   RL E+  ++II        L    P  +R   IE IP  ++ I+++ E L++V+H   +    FGIPF +++       ++  RI+  ++   KEFEK++ A+         N           E+  ++ +  FE                S P     +PWL LDH  K P   ++R    EK  KIHN
Sbjct:   80 RLSESVLSP-PCFVRNLPWKIMVMPRLY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFI-EEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKY-TVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQETNLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDSSELPTAKEYFRDLYSRVDVIFCDK----------TIPNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKCTWLNSQFREE-EITVYPDKHGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLAQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGGHFREVMKRIQTMLDIQEKEFEKFKFAIVMMGRHTYLN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAP---KDRYTYLEKAYKIHN 1101          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Match: sp|Q9VYQ8|UBP7_DROME (Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 425/1167 (36.42%), Postives = 620/1167 (53.13%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVK-NIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIK-------DALPSSDNPVMIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESF----TSPYNGLIIIYE-PNI-SRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARY-IDIMKALVANIPGTEIGKIQL------YKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIIS----QIPLKMKLSEFQP-----NPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            D  R   T    + N+ + K       ++ LSP P++VR LPW+I+ +        + R +GFFLQCN  ++S  W C+A AELRL C +  P  Q   +  I+H F+ +END+GYS+FITW +L + +K +V  ++S+ L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ L+FTN LR +VY +PTE DD  +SV L+LQRVF+ELQ+G++ VGTK+LTKSFGWETLD+FMQHD QE  RVLLD LESKMKGT +E TIP LF GKM S+I+C  V   S R E FYDIQL +K   +IYE+F +Y+  ETL+GDNKYDAG +G+Q+A KG++F  FPPVL+L LMRFQYD  TD++IK NDRFEF   ++L +YL  S N+   Y+LH VLVHSGDNHGGHYV ++NP  +  W+KFDDDVVS C ++EAI  NYGG D+++S   +C+NAYMLVY+ + ++  +L  I+  +I ++L +R   EK IE  +RKE+  A  Y SV ++L+E+F       LFD+EK    R  R  +   V EL             R+R+W +     Q + S  +         + + +S  P +IW+Q L   +    LPP + K + L+F KY++P+   ++++          + D+   +  +       +LT+++E   + +  +    ES          G I+I+E  N+ +++ L  +G                     D+  DL  +IE+ F            ++K NP+     L    RY  D +   VA    T+  K+Q       YK T            G+ V  TF+GT+ DL+S   QS                                       KR+++Q L + IHE++  +QF C++V    +++ E+ +   +      +L EA K      N+    RL ++ +H+I++     IPL   L   +         +   IE +P E++++  + E L+ V+H   +    FGIPF  K    E    L+ RI+ R+    KE+E Y+  + +       N            + + + + ++ S +S                     P+  LDH     KR+  N SEK IKI+N
Sbjct:   96 DQFRSETTFSFTVENVVQLK-------SQRLSP-PVYVRMLPWRIMVI-------PNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHK--PDAQPFTRARIKHLFYSKENDYGYSNFITWQELKDSEKSYV-HNNSITLEVHVVADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEENFEEQHKRRLFDLEKVH-PRVFRIKQNQTVDELVDLFVRGFGVSRQRMRMWNLCTAQTQ-KFSHFDFVAEGSRTIEQISTSQKPWVIWLQ-LAWTDVPGPLPPFNPKTESLLFLKYYDPRNKRLNYIGCTQQPHTRRLIDLVPDVNSKLGFEPDTELTIYDEYADKKLVNLNEPIESALFIPQDHLQGHILIFERENVDAKLDLPTVG---------------------DYFLDLVYRIEIIF------------SDKCNPNEPDFTLELSNRYNYDQLANAVAERLNTDPQKLQFFMCINNYKET-----------AGNAVPYTFKGTIKDLVSYTKQSST-------------------------------------KRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRRKLRLLKISNHKIVAVCKDDIPLDTLLKSNESITTAQGAQKTFRIEEVPAEDMQL-AENEFLIPVAHFSKELYNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGHNADVN------------DNTPVDLEVYRSWTSG------------------QLPFFGLDHINKSRKRSSLNFSEKAIKIYN 1129          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Match: A0A384WIE7 (Ubiquitin OS=Onchidium struma nom. nud. OX=643549 GN=Ubiq PE=2 SV=1)

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 483/1150 (42.00%), Postives = 688/1150 (59.83%), Query Frame = 1
Query:  634 ENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSADSLPPIDS-KQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISM--FESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            E D +R   T +  + N SK        E  +LSP P  VR LPWKI+ M R  + +R Q+ +GFFLQCN  SEST W C A AELR++  + +P  +   ++I+H F+++ENDWG+S F+ W D+ +P  GF+  DD ++L+V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTNKLR+AVYL+PTE+DD  RSV LALQRVFYELQ+ +K VGTK+LT+SFGWETLD+FMQHD QELCRVLLDN+ESKMKGT VE TIP LF GKM+S+I+C  V  +SKREE F+DIQL +KG  +++E+F EY T+ETLDGDNKYDAGEYG+Q++EKG++FL FPPVL+L LMRF YD  TDANIKINDRFEFP  L+L ++L+    +   Y+LH VLVHSGDNHGGHYV Y+NP G+ +W KFDDDVVSRC++ EAI  N+GG D+D++++ CTNAYMLVY+ E ++ E+L+P+S  DIP +L  R  +E+ +E  KRKE+  A+LY +V ++ +++F G QG +LFD EK ++ R  +  + S +SE  + +A +L     +IR W    + NQ     +   DA        L   +NP +I+V+TLP ++    LPP D    +L+F K ++P+T SI ++  + V I A   ++   L ++A    +  L L+EE +  ++ ++    E  + P   L            L ++ +GD   FQ    +         K++  DL+ ++EV F +K          +  N     + LSQK  Y D M   VAN  GT+  K+Q +K      G ++   PG+PV+ T+EG L DL            L   KP Q                          K+LY+Q L + I+E+E  +QF  ++++   +E+ E+ +   + G   D+L EA+K  +L+ N +   RL E+  ++I++     + L        +   IE IP +E+ +    E L+ V+H Q +    FG+PF +K+ D E  +D+++RI+ +++ P KEFEKY+ A+          R  + P     E++  +R+ +  F  ++    +   +            +PWL LDH     KR R N  EK IKIHN
Sbjct:   55 EEDESRAEATFQFVVENFSKL-------EESVLSP-PCMVRNLPWKIMAMPRKNHAER-QKSLGFFLQCNGESESTSWSCQASAELRML--KWDPDGEPCKRSIQHLFYHKENDWGFSHFMAWQDVLDPSNGFI-KDDKIILQVHVTADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNKLRRAVYLMPTESDDSTRSVPLALQRVFYELQFSDKPVGTKKLTRSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPKLFEGKMLSYIKCKHVDYDSKREETFFDIQLNIKGKRNVHESFKEYCTVETLDGDNKYDAGEYGLQESEKGVVFLSFPPVLHLHLMRFMYDPVTDANIKINDRFEFPERLNLDEFLQKKEKTSATYLLHAVLVHSGDNHGGHYVVYINPKGDGKWCKFDDDVVSRCTKSEAIDHNFGGQDDDLTVRHCTNAYMLVYIRESELSEILEPVSEKDIPDSLTARLNDERKLEALKRKERTEAHLYMNVHVLTEDNFCGHQGNDLFDTEKVNY-RGFKVKKSSTLSEFMETLAENLKYPVQQIRPWPFHCRQNQTFRPTILDLDADLNKQVSELSEQENPWVIFVETLPPESGMQELPPFDKDSDVLLFLKMYDPRTRSISYVGHLYVPISAKANELVPQLNRKAGFPVNTPLLLYEEVKPNLIERL----EDLSLPMEKL------------LDELMDGDIIVFQREEEDLSQYPLPTPKEYFRDLFYQVEVTFCDK----------SVPNDPGFTLDLSQKMNY-DQMANAVANHLGTDPYKLQFFK----CQGYRDG--PGNPVKCTYEGNLRDL------------LVYSKPRQP-------------------------KKLYYQQLDMKINELENKKQFKVLWLNGKMKEERELVLYPNKNGKVQDLLEEAKKQVELSENGSGKLRLLEIISYKILAVQKEDLALDNLVVGGTKTYRIEEIPADEVNM-AVDELLIPVAHFQKEMYQTFGMPFLLKIKDNELFSDVKDRIQKKLDIPEKEFEKYKFAIIV------MGRLEYIP-----EDSQDVRVDLKKFLPHAVQTGMGMQA------------RPWLGLDHVNKTPKRARYNYLEKAIKIHN 1097          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Match: A0A2R5LCL6 (Putative ubiquitin carboxyl-terminal hydrolase posttranslational modification (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 477/1151 (41.44%), Postives = 677/1151 (58.82%), Query Frame = 1
Query:  634 ENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQ--RCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQ-IQLSPMEIKDALPSS-------DNPVMIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            E D AR   T    +PN S+ K+        +LSP P +VR LPWKI+ M RT   +  Q  + +GFFLQCN  SES+ W C+A AELRL+ Q++   N   ++ I+H F+ +ENDWG+S F+TW+D+ +P+KG++  DD+++L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY +PTE+DD  +SVALALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+ESKMKGT VE TIP LF GKM+SFI+C  V   S+R E FYDIQL VKG  +I+E+F +Y   E+LDGDNKYDAGEYG+Q+AEKGI+F   PPV++L L+RFQYD  TD NIKINDRFEFP  L+L+++L     S   Y LH VLVHSGDNHGGHYV ++NP G+ +W KFDDDVVSRC+++EAI  N+GG D+D+++ + CTNAYMLVY+ +  I+E+LQ +  +DIP  L +R   EK  E  +RKE+  A+LY SV ++ +++F G QG +L+D+EK ++ R  +  + + + EL + +A  +      IR W I Y++NQ  + + +++++ +  S        NP  I+++T+  D   D LP  D +  +L+F K ++P+   I +     + I A   ++  +L KRA      +L L+EE +  +V +I    E    P   +            L ++ +GD   FQ    N  V      K++  DL+ ++EV F +K          +  N     + LS K  Y  I  A+   + GT+   +Q +K      G      PG+P+R T+EGTL DL            L   KP Q                          K++Y+Q L IPI+E+E  +QF C++V+   +E+ E+ +   +TGC  D+L EA+K  +L  +     RL EV  ++I +    ++ L       ++   IE IP+E+L ++   E +V  +H Q +    FG+PF +K+  +E  + +++RI+ +++ P KEFEKY+ A+                           R    E N    N+  D   Q  +      +PWL ++H     KR+R    EK IKIHN
Sbjct:  145 EEDEARSEATFRFTVPNFSRLKET-------LLSP-PTYVRNLPWKIMVMPRTNTGNDRQPTKSLGFFLQCNGESESSTWSCNAAAELRLISQKEGVDN--FIRKIQHLFYSKENDWGFSHFMTWSDVLDPEKGYI-LDDTIILEVWVCADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYQMPTESDDSSKSVALALQRVFYELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLFEGKMISFIKCKHVEYASRRMEPFYDIQLNVKGKKNIHESFQDYCATESLDGDNKYDAGEYGLQEAEKGIIFACLPPVVHLHLLRFQYDPMTDNNIKINDRFEFPEKLNLNEFLHEPEASPATYTLHAVLVHSGDNHGGHYVVFINPKGDGKWCKFDDDVVSRCTKQEAIDHNFGGTDDDVAVSRHCTNAYMLVYIRDSAIQEVLQTVQENDIPEQLVERLQEEKRQEALRRKERNEAHLYMSVQVLTEDNFAGHQGNDLYDMEKANY-RTFKVKKLATLKELMELMAEQMKYPIQGIRPWSITYRSNQTFRPAAIDLENDMNKSVIDLSENANPWTIFLETIAPDQPVDRLPDFDKETDVLLFFKLYDPRLKHIAYCGHTYMSISAKANELVPLLNKRAGFPSDTELMLYEEVKPNIVERI----EDLDLPLERV------------LGELMDGDIIVFQKAELNVDVFDLPTVKEYFRDLFYRVEVTFCDK----------SIPNDPGITVELSLKMNYDQIANAVSQRL-GTDPYLLQFFKVQSYREG------PGNPLRCTYEGTLKDL------------LVYFKPRQP-------------------------KKIYYQQLSIPINELEDKKQFKCVWVNSKLKEEKELVLYPNKTGCVKDLLEEAKKQVELAEDGTGKLRLMEVISYKIFTIQREEVALDSLNQANSKTYRIEEIPREDLVVS-DDELIVPCAHFQKEIFSTFGVPFLLKIKHREPFSKVKDRIQRKLDVPEKEFEKYKFAIVVMG-----------------------RAQFIEDNEYIVNLP-DFTTQQPQGAAMHPRPWLGIEHVNKAPKRSRYTYLEKAIKIHN 1188          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Match: A0A293MIZ3 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 479/1151 (41.62%), Postives = 678/1151 (58.91%), Query Frame = 1
Query:  634 ENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQ--RCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQ-IQLSPMEIKDALPSS-------DNPVMIWVQTLPADNSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            E D AR   T    +PN S+ K+        +LSP P +VR LPWKI+ M RT   +  Q  + +GFFLQCN  SES+ W C+A AELRL+ Q++   N   V+ I+H F+ +ENDWG+S F+TW+D+ +P+KG++  +D++ L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY +PTE+DD  +SVALALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+ESKMKGT VE TIP LF GKM+SFI+C  V   S+R E FYDIQL VKG  +I+E+F +Y   E+LDGDNKYDAGEYG+Q+AEKGI+F   PPV++L L+RFQYD  TD NIKINDRFEFP  L+L+++L     S   Y LH VLVHSGDNHGGHYV ++NP G+ +W KFDDDVVSRC+++EAI  N+GG D+++++ + CTNAYMLVY+ +  I+E+LQP+  DDIP  L +R   EK  E  +RKE+  A+LY SV ++ +++F G QG +L+DVEK ++ R  +  + + + EL + +A  +      IR W I Y++NQ  + + +++++ +  S        NP  I+++T+  D   D LP  D +  +L+F K ++P+   I +     + I A   ++  +L KRA      +L L+EE +  +V +I    E    P   +            L ++ +GD   FQ    N  V      K++  DL+ ++EV F +K          +  N     + LS K  Y  I  A+   + GT+   +Q +K      G      PG+P+R T+EGTL DL            L   KP Q                          K++Y+Q L IPI+E+E  +QF C++V+   +E+ E+ +   +TGC  D+L EA+K  +L  +     RL EV  ++I +    ++ L       ++   IE IP+E+L ++   E +V  +H Q +    FG+PF +K+  +E  + +++RI+ +++ P KEFEKY+ A+                           R    E N    N+  D   Q ++      +PWL ++H     KR+R    EK IKIHN
Sbjct:   60 EEDEARSEATFRFTVPNFSRLKET-------LLSP-PTYVRNLPWKIMVMPRTNTGNDRQPTKSLGFFLQCNGESESSTWSCNATAELRLISQKEGVEN--FVRKIQHLFYSKENDWGFSHFMTWSDVLDPEKGYI-LEDTITLEVWVCADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYQMPTESDDSSKSVALALQRVFYELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLFEGKMISFIKCKHVEYASRRMEPFYDIQLNVKGKKNIHESFQDYCATESLDGDNKYDAGEYGLQEAEKGIIFACLPPVVHLHLLRFQYDPLTDNNIKINDRFEFPEKLNLNEFLHEPEPSPATYTLHAVLVHSGDNHGGHYVVFINPRGDGKWCKFDDDVVSRCTKQEAIDHNFGGTDDEVAVSRHCTNAYMLVYIRDSAIQEVLQPVQEDDIPEQLVERLQEEKRQEALRRKERNEAHLYMSVQVLTEDNFAGHQGNDLYDVEKVNY-RTFKVKKLATLKELIELMAEQMKYPIQGIRPWSITYRSNQTFRPAAIDLENDMNKSVIDLSENANPWTIFLETIAPDQPVDRLPDFDKESDVLLFFKLYDPRLKHIAYCGHTYMAISAKANELVPLLNKRAGFPSDTELMLYEEVKPNIVERI----EDLDLPLERV------------LGELMDGDIIVFQKADLNVDVFDLPTVKEYFRDLFYRVEVTFCDK----------SIPNDPGITVELSLKMNYDQIANAVSKRL-GTDPYLLQFFKVQSYREG------PGNPLRCTYEGTLKDL------------LVYFKPRQP-------------------------KKIYYQQLSIPINELEDKKQFKCVWVNNKLKEEKELVLYPNKTGCVKDLLEEAKKQVELAEDGTGKLRLMEVISYKIFTIQREEVALDSLNQANSKTYRIEEIPREDLVVS-DDELIVPCAHFQKEIFSTFGVPFLLKIKHREPFSKVKDRIQRKLDVPDKEFEKYKFAIVVMG-----------------------RAQFIEDNEYIVNLP-DFTTQAAQGAAMHPRPWLGIEHVNKAPKRSRYTYLEKAIKIHN 1103          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Match: A0A067RK91 (Ubiquitin carboxyl-terminal hydrolase 7 OS=Zootermopsis nevadensis OX=136037 GN=L798_06743 PE=3 SV=1)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 486/1153 (42.15%), Postives = 686/1153 (59.50%), Query Frame = 1
Query:  634 ENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRT-QNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDED--MSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQ------IQLSPMEIKDALPSSD--NPVMIWVQTLPADNSADSLPPIDS-KQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQ-DIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            E D AR   T    + N SK K+         LSP P +VR LPWKI+ M RT Q  DR +QR +GFFLQCN  SES+ W C+A AELRL+ Q+ +   +   + I+H F+ +ENDWG+S F++W D+ +P+KGF+  DDS++L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ L+FTN+LRKAVY +PTE+DD  +SVALALQRVF+ELQ+ +K VGTK+LTKSFGWETLD+FMQHD QE  RVLLD LESKMKGT VE T+P LF GKMVSFI+C  +   S R E FYDIQL +KG  +I E+F +YI  E LDGDNKYDAGE+G+QDAEKG++F  FPPVL+L LMRFQYD  TD ++K NDRFEF   + L  YL+    ++  YILH VLVHSGDNHGGHYV ++NP G+ +W KFDDDVVSRC+++EAI  NYGG+D+D  M++K CTNAYMLVY+ + ++K +LQ ++ +DIP  L +R   EK +E  +RKE+  A+LY SV ++L++ F G QG +L+D ++ + +R  R  +++ + EL + +A+SL    ++IR W   Y++NQ      I L     K  L  ++  NP  ++V+ +P D+   +LPP D    +L+F K+++P+T  IH+     + + A ++++  +L +RA  +    L L+EE +  +V +I N  E                     L ++ +GD   FQ D R + +  +    +D+  DL+ ++EV F +K+            N     I LSQ+  Y D M   VA   GT+   +Q +K        K+   PG P+R TFEGTL +L            L   KP                            K++++Q L I I+E+E  +QF C++V P  +E+ E+ +   + G  AD+L EARK  +L+ N +   R+ E+  ++I+  +     L        +   IE IP++EL +    E L+ V+H   D    FGIPF +KV   E  + +++R++ ++  P KEFEK++ AL               P+F+ EE+   I +  F+++           +Q S    +  +PWL LDH     KR+R N  EK IKI+N
Sbjct:   59 EEDEARSEATFHYTVHNFSKLKESQ-------LSP-PCYVRNLPWKIMVMPRTSQTQDRQTQRSLGFFLQCNGESESSSWSCYAVAELRLLSQKDDV--EAFSRKIQHLFYSKENDWGFSHFMSWQDVLDPEKGFI-KDDSIILEVHVVADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYKMPTESDDSSKSVALALQRVFHELQFCDKPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTCVEGTVPKLFEGKMVSFIKCKNIDYTSTRVETFYDIQLNIKGKKNIEESFHDYIATEVLDGDNKYDAGEHGLQDAEKGVIFASFPPVLHLHLMRFQYDPITDCSVKFNDRFEFDEKISLESYLQTPEPTRADYILHAVLVHSGDNHGGHYVVFINPKGDGKWCKFDDDVVSRCTKQEAIDHNYGGHDDDMNMTVKHCTNAYMLVYIRDSELKNVLQEVTEEDIPQELVERLQEEKRMEQIRRKERNEAHLYMSVQVLLEDSFDGHQGNDLYDPDR-ALYRVFRVRKQTTLQELLEHLADSLKYPIEQIRPWPFSYRSNQTCRPTLIDLETDLHKSVLDVAENQNPWNVFVEVVPPDSGLQALPPFDKDSDVLLFFKFYDPKTKRIHYCGHHYMPVAAKVQELIPLLNERAGFAADTDLVLYEEIKPNMVERIENYNEPLEK----------------VLEELMDGDIIVFQKDERDDMY--ELPTCRDYFKDLFHRVEVTFCDKM----------IPNDPGFTIDLSQRMTY-DQMAHAVAQRVGTDPYLLQFFK----CQNYKDS--PGHPLRCTFEGTLKEL------------LVYSKPKTP-------------------------KKIFYQQLSIRINELENKKQFKCVWVGPKLKEEKELILYPNKNGTVADLLEEARKQVELSENGSGKLRICEIHSNKIVCGLKEDAPLESLNTGGTKAFRIEEIPRDELNL-ADDEMLIPVAHFCKDIYTPFGIPFFLKVKHGEPFSKVKDRLQKKLGIPEKEFEKFKFALVL----------VGRPQFINEESEFFINLQDFKNHP----------NQGS----STPKPWLGLDHINKTPKRSRFNYLEKAIKIYN 1102          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Match: A0A1E1XR42 (Putative ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 851.662 bits (2199), Expect = 0.000e+0
Identity = 487/1153 (42.24%), Postives = 673/1153 (58.37%), Query Frame = 1
Query:  640 DPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQ--RCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYL-ENSHN--SKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSI-KQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIK-DA--------LPSSDNPVMIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            D AR   T    +P  S+ K+        +LSP P +VR LPWKI+ M RT   +  Q  + +GFFLQCN  SES+ W C+A AELR++ Q++   N   V+ I+H F+ +ENDWG+S F+TW D+ +P+KGF+  DD+++L V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LRKAVY +PTE+DD  +SVALALQRVFYELQ+ ++ VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+ESKMKGT VE TIP LF GKM+SFI+C  V   S+R E FYDIQL VKG  +I+E+F +Y   E+LDGDNKYDAGEYG+Q+AEKGI+F   PPV++L L+RFQYD+ TD NIKINDRFEFP  L+LS++L E   N  S   Y LH VLVHSGDNHGGHYV ++NP G+  W KFDDDVVSRC+++EAI  N+GG ++D+++ + CTNAYMLVY+ +  I E+LQP++ +DIP  L +R   EK  E  +RKE+  A+LY  V ++ ++ F G QG +L+D EK +F R  +  + + + EL + +A  +      IR W I Y++NQ    P  I  DA        L  + NP  ++++T+  D + D LP  D +  +L+F K ++P+   I +     + I A  K++  +L KRA      +L L+EE +  +V +I    E    P   +            L ++ +GD   FQ +  N    +    KD+  DL+ ++EV F +K+            N     + LS K  Y  I +A VA   GT+   +Q +K      G      PG+P+R T+EGTL DL            L   KP Q                          K++Y+Q L I I+E+E+ +QF CI+V+   +E+ E+ +   + GC +D+L EARK   L+ + +   RL EV  ++I S     + L       ++   IE IP+E+L I    E L+  +H Q +    FG+PF +K+   E    +++RI+ +++ P KEFEKY+ A+                           R    E N    N+  D   Q  +      +PWL ++H     KR+R N  EK IKIHN
Sbjct:  164 DEARSEATFRFVVPEFSRLKE-------SLLSP-PTYVRNLPWKIMVMPRTNTGNDRQPTKSLGFFLQCNGESESSTWSCNATAELRIISQKEGVDN--FVRKIQHLFYGKENDWGFSHFMTWNDVLDPEKGFI-VDDTIILEVWVCADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYQMPTESDDSSKSVALALQRVFYELQFSDRPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLFEGKMISFIKCKHVDYASRRMEPFYDIQLNVKGKKNIHESFQDYCATESLDGDNKYDAGEYGLQEAEKGIIFACLPPVVHLHLLRFQYDHVTDNNIKINDRFEFPERLNLSEFLTEGGANAGSPATYTLHAVLVHSGDNHGGHYVVFINPRGDGRWCKFDDDVVSRCTKQEAIDHNFGGTEDDVAVSRHCTNAYMLVYIRDSAINEVLQPVTENDIPEQLVERLQEEKRQEALRRKERNEAHLYMGVQVLTEDSFAGHQGNDLYDPEKANF-RNFKVKKLATLRELLELVAEQMGYPLQGIRPWAITYRSNQT-FRPSAIDLDADLNKTVIDLSENSNPWTLFMETISPDQNMDRLPDFDKETDVLLFFKMYDPRLKQIAYCGHAYLPIVAKAKELLPLLNKRAGFPADTELVLYEEVKPNIVDRI----EDLELPLEKV------------LEELMDGDIIVFQKLDLNVDEYELPTVKDYFRDLFYRVEVTFCDKM----------IPNDPGFTMELSLKMNYDQIARA-VAQRLGTDPYLLQFFKVQSYREG------PGNPLRCTYEGTLKDL------------LVFFKPRQP-------------------------KKIYYQQLSIRINELESKKQFKCIWVNNKFKEEKELVLYPNKNGCVSDLLEEARKQVDLSEDGSGKLRLMEVISYKIFSIQREDVPLDNLNQANSKTYRIEEIPREDL-IVADNEILIPCAHFQKEIFSTFGVPFMLKIKHGEPFTKVKDRIQKKLDVPDKEFEKYKFAIVVMG-----------------------RAQFIEDNEYVVNLP-DFMAQAPQGAAMHPRPWLGIEHVNKAPKRSRYNYLEKAIKIHN 1208          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:103024319])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 462/1133 (40.78%), Postives = 663/1133 (58.52%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GFV  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+         YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V +V ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+   +   RL E+  ++II     +  L    P  +R   IE IP +++ ++++ E L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   86 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFV-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDVKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSVTEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDMDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVKY-TIFKVLKSSTLAEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQGTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDASELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSDKGSEKLRLLEIVSYKIIGVHQEEELLECLSPAASRTFRIEEIPLDQVDLDKENEMLIPVAHFHKEVFGTFGIPFLLKIRQAEPFREVMRRIQSMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDDYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1115          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:103024319])

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 462/1133 (40.78%), Postives = 663/1133 (58.52%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSH-NSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSAD--SLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GFV  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+         YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V +V ++ F G QG +++D EK  +    +  + S ++E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+  + +A   +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+   +   RL E+  ++II     +  L    P  +R   IE IP +++ ++++ E L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   97 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFV-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKPDVKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSVTEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDMDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVKY-TIFKVLKSSTLAEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQGTSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDASELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSDKGSEKLRLLEIVSYKIIGVHQEEELLECLSPAASRTFRIEEIPLDQVDLDKENEMLIPVAHFHKEVFGTFGIPFLLKIRQAEPFREVMRRIQSMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDDYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1126          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 214.542 bits (545), Expect = 8.533e-56
Identity = 142/413 (34.38%), Postives = 208/413 (50.36%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY--LENSHNSKTK---------------------------------------------------YILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   ES R + + DI L ++  G S  +    EA   +I  ETLDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S +  LE+  + +T+                                                   + L +V+VHSG   GGHY A +    + +WY F+D  VS+ S+ E         ++ +     TNAYML+Y  + D     + +  +D P ++ +    EK  E+Q+++++
Sbjct:  180 KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHYYACIKSFSDGQWYSFNDQHVSKVSQIE--------TNDLLYFNSSTNAYMLIYRLK-DPSRNAKYLDVEDFPEHIKRLVQTEKESEEQEKRQR 583          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 212.616 bits (540), Expect = 3.113e-55
Identity = 142/417 (34.05%), Postives = 208/417 (49.88%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY--LENSHNSKTK---------------------------------------------------YILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCS----RREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   ES R + + DI L ++  G S  +    EA   +I  ETLDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S +  LE+  + +T+                                                   + L +V+VHSG   GGHY A +    + +WY F+D  VS+ +    R+    S+        +    TNAYML+Y  + D     + +  +D P ++ +    EK  E+Q+++++
Sbjct:  186 KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHYYACIKSFSDGQWYSFNDQHVSKITQDDIRKTYGGSSGSRGYYSSAFASSTNAYMLIYRLK-DPSRNAKYLDVEDFPEHIKRLVQTEKESEEQEKRQR 601          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 212.231 bits (539), Expect = 4.077e-55
Identity = 142/417 (34.05%), Postives = 208/417 (49.88%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQ--RSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIY----EAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY--LENSHNSKTK---------------------------------------------------YILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCS----RREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEK 2157
            K  TG+VGL NQ  TCY+NSLLQ LF T + R A+Y    E  +E    S+   LQR+F  LQ  +K A+ T  +T+SFGW++ + + QHD QELCRV+ D LE K K T   D I  L+ GK+  ++RC++   ES R + + DI L ++  G S  +    EA   +I  ETLDG N+Y       + DA KG+ FL FP +L LQL RF +DY T   IK+NDR  FP  LD+S +  LE+  + +T+                                                   + L +V+VHSG   GGHY A +    + +WY F+D  VS+ +    R+    S+        +    TNAYML+Y  + D     + +  +D P ++ +    EK  E+Q+++++
Sbjct:  166 KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHYYACIKSFSDGQWYSFNDQHVSKITQDDIRKTYGGSSGSRGYYSSAFASSTNAYMLIYRLK-DPSRNAKYLDVEDFPEHIKRLVQTEKESEEQEKRQR 581          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Match: usp7 (ubiquitin specific peptidase 7 (herpes virus-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-3656])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 423/999 (42.34%), Postives = 604/999 (60.46%), Query Frame = 1
Query:  748 FVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLE--NSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPADNSA--DSLPPIDS-KQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRV---VTQITNC-GESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKV 3693
            +VR LPWKI+ M RT     +Q+ +GFFLQCN  SEST W C+A+A L+++  +     +   + I H FF++ENDWGYSSFI + D+ +P+KGF+  DD +   V V ADAPHGV WDSKK+TG+VGLKNQGATCYMNSLLQ L+FTN+LRKAVY +PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QEL RVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +IYE+F++Y+ +E LDGDNKYDAGE+G+Q+AEKG+ FL FPPVL+LQLMRF YD +TD NIKINDRFEFP  L L  +L+  ++ +S T YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC+++EAI  NYGG D+D S++ CTNAYMLVY+ E  +  +LQ +   DIP  L  R   EK +E QKRKE+  A+LY  + IV ++ F G QG +++D EK  +    +  +   + E  + ++ ++    +++RLW +  + N  +   M+  +         L  ++NP  I+++T+ A+  A   +LPP D  + +++F K ++P+T ++++   I   I   I+D+  V+ +RA   +   L L+EE +  +   + +I  C  ++     +G II+++ +                D  + + +P    A+D+ HDLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R T+EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F C+++  +  E+ E+ +   + GC  D+L E +K   L+  ++   RL E+  ++II        L       +R   IE  P +++ I ++ E LV V+H   +    FGIPF +++
Sbjct:   70 YVRNLPWKIMVMPRTHQERPNQKTLGFFLQCNAESESTSWSCNAQAVLKVINVKD--EEKSFTRKISHLFFHKENDWGYSSFIPFNDIVDPEKGFI-EDDKVTFEVAVQADAPHGVAWDSKKYTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYQMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELSRVLLDNVENKMKGTCVEGTIPKLFGGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIYESFNDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLSFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPERLILDDFLQKLDAEDSAT-YILHAVLVHSGDNHGGHYVVYLNPMGDGKWCKFDDDVVSRCTKKEAIEHNYGGLDDDFSVRHCTNAYMLVYIRESKLDYVLQMVKDTDIPMQLVDRLQEEKRVEAQKRKERQEAHLYMQLQIVTEDQFCGHQGNDMYDEEKVKY-AIFKVLKNCTLYEFMQTLSQTMGYSTEQMRLWPMQARRNGTRRPAMQDYETENGRHMIELSENENPWTIFLETVDAETVATGGALPPFDKDRDVMLFLKMYDPKTKTLNYCGHIYTPITCKIRDLLPVMCERAGFPQGTNLILYEEVKPNLTERIQEIDFCLDKALDELMDGDIIVFQKD----------------DPDNTSELP---TARDYFHDLYHRVDVTFCDK----------TIPNDPGFVVTLSNRMTYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHTYEGTLRDL------------LQYFKPRQP-------------------------KKLYYQQLKMKITDFENKKNFKCVWLKSNFVEE-EITLYPDKHGCVQDLLEECKKTVTLSETSSGKLRLLEIVSYKIIGMRQEDELLECINSATSRTYRIEETPVDQVDIEKEREMLVPVAHFHKEVFGTFGIPFLLRI 989          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005124.1 (pep scaffold:Pmarinus_7.0:GL490092:2610:6304:1 gene:ENSPMAG00000004660.1 transcript:ENSPMAT00000005124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 9.015e-40
Identity = 92/251 (36.65%), Postives = 129/251 (51.39%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLL-PTETDD---------EQRSVALALQRVFYELQY-GEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDE-YITIETLDGDNKYDAGEYG-MQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKT 1821
            ++ T   G++N GATCY+NSLLQ LF T ++R+A++ L P E  D         + R + L LQR+F +L    ++AV T  LT SFGW   +   QHD QEL R+L   LE  + GT   D I  L+ G +V+ I C      ++REE F D+ + V GN  + EA    Y   E ++GDN+Y   E   +  A K       P +L   L+RF +D+      K   RF FP  LD+  Y E   + K 
Sbjct:   35 RELTCLCGIQNLGATCYLNSLLQTLFHTPEMREAIFSLKPEELGDLADKDKPGAKVRVIPLQLQRLFAQLLLLDQQAVSTAALTDSFGWTHTEEGHQHDVQELSRILFGALECSLVGTMGHDLISRLYHGTVVNQITCRDCGRRNEREETFQDLTMAVHGNRGLEEALSSYYCESEEMEGDNRYCCDECARLVCATKSAKLRTLPTILTFSLLRFSFDFVKCERYKETGRFTFPRLLDMRPYCEVQASPKA 285          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001446.1 (pep scaffold:Pmarinus_7.0:GL476913:23272:104531:1 gene:ENSPMAG00000001292.1 transcript:ENSPMAT00000001446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 4.192e-31
Identity = 103/370 (27.84%), Postives = 166/370 (44.86%), Query Frame = 1
Query: 1072 NADAPHGVDW----DSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVF-YELQYGEKAVGTKRLTKSFGWET--LDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKT----------------------KYILHTVLVHSGDNHGGHYVAY----LNPSG--ENEWYKFDD---------DVVSRCSRREAILSNYGGNDE---DMSIKQCTNAYMLVY 2037
             + AP+  D+    D +     VGL N GATCYM S +Q L+   + R+AV+      D + ++    LQ++F Y ++   KA   +   K++  +   L+T  Q D  E    L+  +E       +++T+  LF G + + +  +     S+  E FY ++ +V    +IYE+ DE    +TL+GDN Y   + G +  AEK   F K P +L    MR+ ++  T    K+N  F FP  LD++ Y E     ++                      +Y L  V VH+G   GGHY ++    +NP+    N+WY F+D          + S C   E     Y    +   D S ++  +AYML Y
Sbjct: 1932 TSHAPYKWDYWPHDDVRADCRLVGLTNLGATCYMASTIQQLYMIPQARQAVFTAKYTDDMKHKTTLFELQKMFTYLMESERKAYNPRSFCKNYMMDKLPLNTGEQKDMTEFFTDLITKIEE--MSPELKNTVKTLFGGVITNNVVSLDCDHVSQTVEEFYTVRCQVADMKNIYESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTERWLMGRSDRAEGLKVEEGAGGVAKAEESYEYDLIGVTVHTGTADGGHYYSFIRDIINPAAYRNNKWYLFNDAEVKPFDSTQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFY 2299          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Match: usp12a (ubiquitin specific peptidase 12a [Source:NCBI gene;Acc:565736])

HSP 1 Score: 103.219 bits (256), Expect = 1.319e-23
Identity = 99/346 (28.61%), Postives = 152/346 (43.93%), Query Frame = 1
Query: 1123 FVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGT-------KRLTKSFGWETLDTFMQHDAQELCRVLLDNLE-------------SKMK--------------GTRVEDT-IPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDE--YITIETLDGDNKYDAGEY-GMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDN-HGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMS 2043
            + GL N G TCY NS+LQAL+F    R+ V     +   ++ ++   L  +F+ +   +K VG         RL K    E  D +MQ DA E    LL+ +               K+K               T+ E T + ++F G + +  RC+     S ++E F D+ + V+ N+ I        +   ETL  + KY   +    Q+A+K +   K P +L L L RF+Y  +     K++ R  FP  L L     ++ N    Y L  V+VH G   + GHY+  +   G   W  FDDD+V +    +AI   YG    D+S K   + Y+L Y S
Sbjct:   34 YFGLVNFGNTCYCNSVLQALYFCKPFREKVLDYKVQPKKKE-NLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKE--NELFDNYMQQDAHEFLNYLLNTIADILQEEKKQERQNGKLKNGVAAAAAAADGDDSTKTEPTWVHDIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLSPRGFSNTETLCSEYKYYCEQCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYITIVKSHG--FWLLFDDDIVEKID-PQAIEEFYGLTT-DVS-KNSESGYILFYQS 371          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008243.1 (pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 gene:ENSPMAG00000007452.1 transcript:ENSPMAT00000008243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 4.540e-20
Identity = 89/319 (27.90%), Postives = 131/319 (41.07%), Query Frame = 1
Query: 1120 GFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQR----------VFYELQYGEKAVGTKRLTKSFGWETLDTFM---QHDAQELCRVLLDNLE---SKMKGTRV-------------------------EDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSD----IYEAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVV 1938
               GL+N G TCYMNS++Q L  T  L  A Y L ++  +   S    L R          +   L  G+    T R  K       D F    QHD+QEL   LLD L    ++ K  RV                         E  +  LF G+  S I+C+     S+  E F ++ L +  ++     + +    +   E +   N+Y       + ++ K +   K PPVL + L RF Y       ++ N  F    SLD+  Y+ N  N  ++Y L+ V  H G   GGHY AY + +  + W+KFDD  V
Sbjct:   94 ALTGLRNLGNTCYMNSVVQCLSNTTSL--AEYFLTSQYVNNINSRNNPLGRKGQVVEEFAVIVRALWSGQYRSITPRDFKFMIGRLNDQFCGTEQHDSQELLIFLLDGLHEDLNQAKRVRVKEEKTEHLSDSMAAQLAWDAYKHINESILVTLFHGQFRSTIKCLTCQKVSRTFEVFMNLTLHLPSDTTSKCTLQDCLQMFSKPEKMTDANRYLCSHCKQRRESVKTMEIWKLPPVLIIHLKRFSYSGRWKQKLQTNVGFPLT-SLDMKPYIINKDNRYSEYNLYAVSNHYGSLDGGHYTAYTHNTVRDSWFKFDDHEV 409          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Match: UBP15 (Ubiquitin-specific protease involved in protein deubiquitination; forms a complex with AAA peroxins Pex1p and Pex6p; deubiquitinates mono- and polyubiquitinated forms of Pex5p; deubiquitinates Clb5p, counteracting APC activity, and facilitating both Clb5p accumulation and S phase entry; physically interacts with anaphase-promoting complex/cyclosome (APC/C) activator, Cdh1p; catalytic activity regulated by an N-terminal TRAF-like domain and and C-terminal sequences [Source:SGD;Acc:S000004920])

HSP 1 Score: 377.481 bits (968), Expect = 7.564e-111
Identity = 208/555 (37.48%), Postives = 323/555 (58.20%), Query Frame = 1
Query:  865 WHCHAKAELRLVCQRKNPSNQDIVKNI---EHNFFYRENDWGYSSFITWTDLTNPDKG----FVGSDD-SLLLRVKVNADAPHGVDW------DSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYL-----------ENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYG--------------GNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRR-----------LRFPRKSNVSELTKAIANSLHEKPDR-IRLWCIIYKNN 2376
            W+C A+  + +      P N D +  I    H F   + DWG+++ I   +L +P KG    F+     ++   V++  D P GV W      DSKK TG+VG +NQGATCY+NSLLQ+ FFT   RK VY +PTE +    SV LALQR FY+LQ  +  + T  LT+SFGW+T ++F QHD QEL R+L+D LE+ MKGT VE  +  +F GKM S+I+C+ V  ES R E F+D+QL VK   ++ E+FD YI +E ++G+N+Y A +YG+QDA+KG++F  FPPVL+LQL RF+YD+  D  +K+ND++EFP ++DLS ++           EN   +   Y LH VLVHSGD   GHY   + P  E++WY+FDD+ V R ++++    N+G              G  ++  I++ T+AYMLVY+ +   ++LL+P+   D+P ++  R   E    + K KE   A+LY ++ +   ++F  ++G++ F  +    +             L+  R + +S++  +I  +++   +R ++ W + Y+ N
Sbjct:  109 WYCCAQFAIGI----SRPGNGDTINLINKSHHRFNALDTDWGFANLIDLNNLKHPSKGRPLSFLNEGTLNITAYVRILKD-PTGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARVEDFWDLQLNVKNFKNLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDLLRPVLESDVPKHVITRVREEIKERETKEKEIREAHLYVTLRLHSIKEFIHYEGFDYFAHDGFRLFAEELNDSGLQQINLKVLRTTKLSDIFASIKETMNIPQERDVKYWKMDYRRN 658          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 108.612 bits (270), Expect = 4.554e-25
Identity = 90/325 (27.69%), Postives = 145/325 (44.62%), Query Frame = 1
Query: 1120 GFVGLKNQGATCYMNSLLQAL----FFTNKLRKAVYLLPTETDDEQRSVALALQRVFYEL-------QYGEKAVGTKRLTK-----SFGW---ETLDTFMQHDAQELCRVLLDNLE-------------SKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKRE-EAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEY-GMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYL------ENSHNSKTKYILH---TVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAI 1965
            G  GL N G+TC+M+S+LQ L    +F       ++    +     +  + AL ++ +EL       Q    +  T R T      +  W   + L  + Q DA E  + +++ +              S+    + E  +  +F G + S I C      SK   + F D+ L +K    +YE  D +   E L  D  Y  GE    QDA K +   K P VL LQL RF++     +N K++D  EFP  L++  Y       ++S N K   I++    ++ H G  + GHY+A+   SG  +W+KF+D +VS  S+ E +
Sbjct:  135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLK-DFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEH-LLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISG-GQWFKFNDSMVSSISQEEVL 456          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Match: UBP9 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP9 has a paralog, UBP13, that arose from the whole genome duplication [Source:SGD;Acc:S000000900])

HSP 1 Score: 96.2857 bits (238), Expect = 1.564e-20
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 1
Query: 1348 LDTFMQHDAQELCRVLLDNLESKMK--------GTRVEDT-----IPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGN--SDIYEAFDEYITIETLDGDNKYDAGE-YGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVH--SGDNHGGHYVAYLNPSGENE---WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIK-----ELLQPISRDDIPT--NLHQRFTNEKHIEDQKRKEKAN 2163
             +T MQ DA E    LL++    ++        G +  D      I +LF G + + I+C+     + R+E F D  ++V+G+  +DI +    Y   E L+G NK+   + YG+Q+AE+ +   + P +L L L RF+Y  E  +NIK+ ++  +P +LD+S     S     KY L  V++H  SG  H GHYV        NE   W  +DD+ V   S +E  +  + G+  D      T AY+L Y      K     E +   S+D + T  N+ Q    +  + D+K +  AN
Sbjct:  428 FNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDNFITDLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQKMLKSYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTS--VYKKYELSGVVIHMGSGPQH-GHYVCIC----RNEKFGWLLYDDETVE--SIKEETVLQFTGHPGDQ-----TTAYVLFYKETQADKTENQNENIDTSSQDQMQTDNNIEQLIKCDDWLRDRKLRAAAN 713          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Match: UBP13 (Ubiquitin-specific protease that cleaves Ub-protein fusions; UBP13 has a paralog, UBP9, that arose from the whole genome duplication [Source:SGD;Acc:S000000163])

HSP 1 Score: 88.9669 bits (219), Expect = 2.325e-18
Identity = 75/252 (29.76%), Postives = 122/252 (48.41%), Query Frame = 1
Query: 1348 LDTFMQHDAQELCRVLLDNLE----------------SKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGN--SDIYEAFDEYITIETLDGDNKYDAGEY-GMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKT--KYILHTVLVH-SGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVY 2037
             +T M  DA E    LL+ L                 S  + ++ ++ I +LF G + + I+C+     + R+E F D  ++V+G+  +DI E    Y   E L+G NK+   E  G+Q+AE+ +   + P  L L L RF+Y  + + NIK+ +   +P +L++     +S NSK   KY L  ++VH  G    GHYV+ L    +  W  FDD+ V    + E +L  + G   +M+      AY+L Y
Sbjct:  426 FNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDSEPSKSKNFISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQEILKSYHQREMLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVC----SSINSKVCQKYELAGIVVHMGGGPQHGHYVS-LCKHEKFGWLLFDDETV-EAVKEETVLE-FTGESPNMAT-----AYVLFY 665          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Match: UBP5 (Putative ubiquitin-specific protease; concentrates at the bud neck; UBP5 has a paralog, DOA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000946])

HSP 1 Score: 76.2554 bits (186), Expect = 2.357e-14
Identity = 87/343 (25.36%), Postives = 128/343 (37.32%), Query Frame = 1
Query: 1123 FVGLKNQGATCYMNSLLQALFFTNKLRKA----VYLLPTETDDEQRSVALALQR------------VFYELQYGEKAVGTKRLTKSFGW--ETLDTFMQHDAQELCRVLLDNL-------------------ESKM-------KGTRVE---------DTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVK--GNSDIYEAFDEYITIETLDGDNKYDAGE-YGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRF-EFPYSLDLSKYLENSHNSKT---------------KYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDV 1935
             VGL+N G  CYMN +LQ L  T+ L +      YL     D  + S  L  +              F         V T +  K  G         MQ D QE C+ LLD L                   E +M       K + +E           I +LF G+  S ++C      S   + F  + + V      +I + F E+   E L  D ++   +    Q + K +   + P  L + L RF      D  +  N+ F ++PYSLDL+ Y     N +                +Y L+ V  HSG  +GGHY +Y+    +  WY FDD +
Sbjct:  445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKTCNILDCFREFTKCERLGVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRF------DNQMNKNNVFVQYPYSLDLTPYWARDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSL 781          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Match: EDO34745 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SNG8])

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 455/1151 (39.53%), Postives = 663/1151 (57.60%), Query Frame = 1
Query:  634 ENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQ-RCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDALPSSDNPV---------MIWVQTLPADNSADSLPPIDSK-QILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTI---NAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            E D ARP GT+   +PN SK        +  ILS +PI+VR LPW+I+ M R  +    + + +GFFLQCN  +E+  W C A A L LV Q++    +D  + I H FF +ENDWG+S F+ W+D+ +P KG++ S DS+ + V V+ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ L+FT  LRKAVY +PTE DD  +SVA ALQRVFYELQ+ +KAVGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+ESKMKGT VE TIP L  GK+ S+I+C KV   S R E FYDIQL VKG  +I+++F EY   E LDGDNKYDAGE+G+Q+A+KG+MF KFPPVL+LQLMRFQYD   DAN+KINDR+EF   +DL +YL+   ++   Y LH VLVHSGDNHGGHYV Y+NP G+  W KFDDDVVS  +++EAI +N+GG ++D+++K CTNAYMLVY+ +  I E+L+ ++ ++IP  L  R   E+ +E Q+RKE+  A+LY +V +V ++ F G  G +LFD EK    +  +  +   + E+ + +A+ +    D+IR W +  ++N    +   + D     D P+         +I+++T+  +N    LP  D K  +L+F KY++P    +  +  + V +     ++   L ++A L +   L ++EE +     QI +   +                    + ++ +GD     RS+  + +T       ++  DL+ ++EV F  K          N+ +     + LSQ+  Y  + KA+  ++   +  K+Q +K      G      PG+ +R TFEGTL DL+            PRG                              K+L++Q+L IPI+++E  +QF CI+++   +EQ E+ +   +     D+L EA+  S ++  +    RL E+   ++ + I   + L        R+  IE IP +E+ + +  E L+ V+H   +    FG PF ++V D ES ++LR+R++ +++   KEF+K +LA+         + G  +  +L +E    I I  F+   +           NS+    I +PWL LDH     KR R N  E+PIKIHN
Sbjct:   43 EEDTARPEGTIRFTLPNFSK-------MDKTILS-DPIYVRNLPWRIMLMPRYSSHGHERVKSLGFFLQCNPETETLSWSCQASARLTLVSQKEGV--EDFSRKISHLFFAKENDWGFSHFVAWSDVLDPSKGYI-SKDSITVEVYVSADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTCALRKAVYQMPTENDDLGKSVAFALQRVFYELQHSDKAVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLLEGKLFSYIKCTKVDYVSTRLEPFYDIQLNVKGKKNIHDSFKEYCASELLDGDNKYDAGEHGLQEAKKGVMFKKFPPVLHLQLMRFQYDPVADANVKINDRYEFYDKIDLDRYLQELEDTPAVYTLHAVLVHSGDNHGGHYVVYINPKGDGRWCKFDDDVVSLATKQEAIDNNFGGYEDDVTVKHCTNAYMLVYIRDSHINEILEEVTNNEIPDTLVSRLQEERRLEVQRRKERTEAHLYITVEVVTEDQFCGHHGSDLFDFEKVKT-KHFKVLKSLKMQEVLQVLADGIGYPVDQIRPWPLQQRSNGT--TRPAVFDMESDIDKPIGQLVDASSWVIFLETVDPENGTAPLPSYDKKGDVLLFFKYYDPAQRVLALVGHLYVPLVTKFSELMPYLCEKAGLPQGTPLFMFEEVKINYAEQIRDTSLTI----------------EHGVEELMDGDIICYQRSDNELLETSELPTVIEYFRDLHHRVEVLFCNK----------NQPDDPGFTVVLSQRMNYTQVAKAVATHLE-VDPMKLQFFK------GQIYRDAPGNALRCTFEGTLRDLLIYYK--------PRGP-----------------------------KKLFYQILSIPINQLENKRQFKCIWLNDSKEEQ-ELVLWPNKEATVGDLLEEAK--SHVDCTSTGKLRLLEIISAKVFNTINNDVPLEHLVSQGQRIFRIEEIPSDEIDL-KTDEILIPVAHFNKEVYQTFGTPFLVRVSDGESISNLRDRVKAKVDIIDKEFDKIKLAIV--------HMGRVN--YLPDELDKVISIKDFQPQIT----------TNSQ---QIGKPWLGLDHVNKAPKRTRYNYLERPIKIHN 1082          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Match: EDO43853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI5])

HSP 1 Score: 148.673 bits (374), Expect = 8.515e-40
Identity = 92/258 (35.66%), Postives = 136/258 (52.71%), Query Frame = 1
Query: 1063 VKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDD-----------EQRSVALALQRVFYELQYGEK-AVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFD-EYITIETLDGDNKYDAGEYGMQDAEKGIMFLK-FPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY 1794
            +   +D+        +  TGF GL+NQG TCY+NSL+Q LF T +  + +  L  E D+           + R + L LQ+VF +L   E+ +  T+ LT+SFGW T  +  QHD QEL R+L   +ES + GT  E  I +L+ G  V+ + C +    S+REE F D+Q+ V G+  + ++    Y+  E L G N+Y  G       +K    L+  PPVL   L+RF YD +T   IK   +F FP  LD+S +
Sbjct:   23 ISKTSDSTSNSPARERGSTGFCGLQNQGGTCYLNSLIQTLFLTPEFTENI--LKLEKDELLANDQSKLGVKTRVIPLQLQKVFAKLLLLEQESTSTQDLTESFGWSTAQSGQQHDVQELNRILFSAIESSLIGTSGEHLIRSLYHGTCVTQVVCQECQTISEREEDFLDLQMVVSGSGSLEQSLKFSYLDAEILSGSNQYRCGH-----CDKLFSRLRALPPVLTFSLLRFTYDIKTFDRIKDTRKFTFPMLLDMSPF 273          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Match: EDO35056 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SMM5])

HSP 1 Score: 130.954 bits (328), Expect = 2.286e-30
Identity = 123/456 (26.97%), Postives = 175/456 (38.38%), Query Frame = 1
Query: 1108 KKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYL-------------------------LPTETDDEQRSVALALQ----------------RVFYELQYGEKAVGTKRL----------TKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLE----------------------NSHNS-----KTKYILHTVLVHSGDNHGGHYVAY-------LNPSGENEWYKFDDDVVSRCS-------RREAILSNYGGNDEDMSIKQCT--------NAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEK---HIEDQKRKEKAN 2163
            + + G+VGLKN GATCYMNS++Q LF   +LRK V                           + T    E+ S  L  Q                 V  ++QY    +   +L          T  F  E ++   QHDA E    LLDNL+  MK    E     +  G       C   P    RE  F  + + ++ +  ++++ ++++  + L+G N Y   +   + D  K +   K P V+ +QL RF YD+E +  +K ND FEFP  +D+  Y E                        H+       T Y L  +LVHSG   GGHY  Y       L     + WYKFDD  VS C        + +     Y G   D  +K+ +        NAY+L Y  E  I     P S      NL   F   K    IE   RK+  +
Sbjct: 1556 RPYMGYVGLKNAGATCYMNSVIQQLFMIPELRKGVLAVEGAAAEEEEDPSVELEEKSESESTIDTGYHSEESSKDLETQGGEARDKAQEQKNYQVNVLRQIQYIFGHLSQSQLQFHIPKGFWKTFKFLGEPVNLREQHDALEFFNNLLDNLDEGMKVLGNEPIFSKVLGGSFADQKICKGCPHRYSREAPFIALNVDIRNHQSLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTVKRMCISKLPRVMAIQLKRFDYDWERECAVKFNDYFEFPREIDMEPYTELGLAKAEGKALDQIPPELVAESEKHDPPPQALSTHYRLRGILVHSGQASGGHYYCYILQRYCILLSDDSHRWYKFDDGDVSECKMEDDEEMKAQCFGGEYMGEVFDHMLKRMSYRRQKRWWNAYILFYEREDIIDTSNTPESVQGTSANLFCCFAALKMPPSIERAVRKQNVH 2011          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Match: EDO44319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVY4])

HSP 1 Score: 120.939 bits (302), Expect = 2.280e-27
Identity = 97/326 (29.75%), Postives = 146/326 (44.79%), Query Frame = 1
Query: 1123 FVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVF-----YELQYGEKAVGTKRLTKSFG-W-ETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLK-FPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY------------------------------LENSHN--------SKTKYILHTVLVHSGDNHGGHYVAYLNP--SGE------NEWYKFDDDVV 1938
            FVGLKN GATCYMNS+LQ L+    +R        E       V   +Q +F      +LQY       ++  K F  W + ++   Q DA E    L D L+  +K  + +      FCG       C +     +REEAFY + + VK N ++ ++ ++++  E L+GDN Y   +   +      M +K  PPVL +QL RF YD+E    +K +D FEFP++LD+  Y                              L + H+        S+  Y L   +VHSG  + GHY +Y+    SG        +W+KF+D +V
Sbjct: 1555 FVGLKNAGATCYMNSVLQQLYMQPGIR--------EVRKPHPCVFYQIQSLFGCLMDSKLQY----FAPEQFWKCFKLWGQPVNVREQQDAFEFFCNLTDQLDEHLKSKKQDQLFKKTFCGMFADQKICKECNHRYEREEAFYSLPVTVK-NHNLQDSLEQFVNGEILEGDNAYFCEKCNKRRTTVKRMCIKTLPPVLVIQLKRFGYDWEAGRALKFDDYFEFPWTLDMEPYTSDGVARREQANASPDTDSDNGSVTSSSQSLNSIHSNSSVTVTPSEITYDLVGAIVHSGQANAGHYYSYIKDRRSGAEGAETYGKWFKFNDTIV 1867          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Match: EDO36756 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SHS4])

HSP 1 Score: 114.775 bits (286), Expect = 1.529e-25
Identity = 106/419 (25.30%), Postives = 169/419 (40.33%), Query Frame = 1
Query: 1051 LLLRVKVNADAPHGVDW------DSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLEN---------------------SHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSG---ENEWYKFDD---------DVVSRCSRREAILSNYGGNDE---DMSIKQCTNAYMLVY----------MSEGDIK---ELLQPISRDDIPTNLHQRFTNEKHIED 2139
            LL+     A   H   W      + +   G VG+ N GATCYM S +Q LF   + R ++            +  ++ ++ +    +       K+L        ++T  Q D  E    L+  LE      R  D +  LFCG + + +  +     SK +E FY ++  V    ++YE+ DE    +TLDGDN Y   + G +  AEK   F   P +L    MR+ ++  T    K+N  F FP  L+++ Y E                        +    Y L  V+VH+G   GGHY +++       +++W+ F+D          +   C   E     Y    E   D+S ++  +AYML Y            E D+    +L   I RD+I      +F ++KHI D
Sbjct:   86 LLMTHHRPASKKHSYGWHYWPNDNERAPCGLVGIINLGATCYMASCIQQLFLMPQARCSIL-----------NAKMSERKAYNPRSFCRTYTMDKQL--------INTGEQKDMTEFFTDLISKLEEMSPSLR--DLVRELFCGVITNNVVSLDCSHVSKTKEEFYSVRCTVADMKNLYESLDEVTVKDTLDGDNMYTCSQCGKKVRAEKRACFTVLPRILCFNTMRYTFNMVTMMKEKVNTHFSFPLQLNMAPYSEEYLMGDKVDEVPNYSYSVVADAEKDPNYWYNLIGVVVHTGTAEGGHYYSFIRNRSYPQQDKWFLFNDAEVKPFDPSQIAGECFGGEMTTKTYDVVSEKFMDLSFEKTHSAYMLFYERCDSSQPAESQEPDVSLSPDLADWIWRDNI------QFLHDKHIFD 477          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 464/1133 (40.95%), Postives = 664/1133 (58.61%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPAD--NSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+  E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ + +     YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V IV+++ F G QG +++D EK  +    +  + S + E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+     +S  +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+ N++   RL E+  ++II        L    P  +R   IE IP +++ +++ TE L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:  198 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFI-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSAKEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEKRVEAQKRKERQEAHLYMQVQIVMEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPGLADSVATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQENSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSENSSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDTEILIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMRRIQTMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1227          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 464/1133 (40.95%), Postives = 664/1133 (58.61%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPAD--NSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+  E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ + +     YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V IV+++ F G QG +++D EK  +    +  + S + E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+     +S  +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+ N++   RL E+  ++II        L    P  +R   IE IP +++ +++ TE L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   63 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFI-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSAKEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEKRVEAQKRKERQEAHLYMQVQIVMEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPGLADSVATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQENSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSENSSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDTEILIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMRRIQTMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1092          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 464/1133 (40.95%), Postives = 664/1133 (58.61%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPAD--NSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+  E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ + +     YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V IV+++ F G QG +++D EK  +    +  + S + E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+     +S  +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+ N++   RL E+  ++II        L    P  +R   IE IP +++ +++ TE L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   80 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFI-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSAKEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEKRVEAQKRKERQEAHLYMQVQIVMEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPGLADSVATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQENSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSENSSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDTEILIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMRRIQTMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1109          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 464/1133 (40.95%), Postives = 664/1133 (58.61%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENE-------WYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPAD--NSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGD--TFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+  E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ + +     YILH VLVHSGDNHGGHYV YLNP G+ +       W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V IV+++ F G QG +++D EK  +    +  + S + E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+     +S  +LP  D    +++F K ++P+T S+++   I   I   I+D+  V+ +RA   +   L L+EE +  +  +I +               Y+ ++ + +L ++ +GD   FQ         +   AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E+ E+ +   + GC  D+L E +K  +L+ N++   RL E+  ++II        L    P  +R   IE IP +++ +++ TE L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   57 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFI-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSAKEPIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEKRVEAQKRKERQEAHLYMQVQIVMEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPGLADSVATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFQQENSLILYEEVKPNLTERIQD---------------YDVSLDK-ALDELMDGDIIVFQKDDPENDNSELPTAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFREE-EITLYPDKHGCVRDLLEECKKAVELSENSSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDTEILIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMRRIQTMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1086          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 458/1124 (40.75%), Postives = 652/1124 (58.01%), Query Frame = 1
Query:  712 RQETKILSPEPIFVRCLPWKILFMLRTQNPDR-SQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSK-TKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDA--------LPSSDNPVMIWVQTLPAD--NSADSLPPIDSKQ-ILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            R    +LSP   FVR LPWKI+ M R   PDR  Q+ +GFFLQCN  S+ST W CHA+A L+++  + +   +   + I H FF++ENDWG+S+F++W+D+T+P++GF+  DD +   V V ADAPHGV WDSKKHTG+VGLKNQGATCYMNSLLQ LFFTN+LR+AVY++PTE DD  +SV LALQRVFYELQ+ +K VGTK+LTKSFGWETLD+FMQHD QELCRVLLDN+E+KMKGT VE TIP LF GKMVS+I+C  V   S+R E +YDIQL +KG  +I+E+F +Y+  E LDGDNKYDAGE+G+Q+AEKG+ FL FPP+L+LQLMRF YD +TD NIKINDRFEFP  L L ++L+ + +     YILH VLVHSGDNHGGHYV YLNP G+ +W KFDDDVVSRC++ EAI  NYGG+D+D+S++ CTNAYMLVY+ E  + E+LQP++  DIP  L +R   EK +E QKRKE+  A+LY  V IV+++ F G QG +++D EK  +    +  + S + E  + ++ ++    D++RLW +  ++N  +   M   +A        L  ++NP  I+++T+     +S  +LP  D    +++F K ++P+T S+++   I   I   I  I      + +L+E +Q                +  ++     +G II+++ +                    N+ +P    AKD+  DLY +++V F +K             N    V+ LS +  Y  + K  VA    T+   +Q +K    S G ++   PG+P+R  +EGTL DL            L   KP Q                          K+LY+Q LK+ I + E  + F  I+++   +E  E+ +   + GC  D+L E +K  +L+ N++   RL E+  ++II        L    P  +R   IE IP +++ +++ TE L+ V+H   +    FGIPF +K+   E   ++  RI+  ++   KEFEK++ A+      +  N           E+  ++ +  FE                S P     +PWL LDH     KR R    EK IKIHN
Sbjct:   80 RLSESVLSPS-CFVRNLPWKIMVMPRFY-PDRPHQKSVGFFLQCNAESDSTSWSCHAQAMLKIINYKDD--EKSFSRRISHLFFHKENDWGFSNFMSWSDVTDPERGFI-EDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEKRVEAQKRKERQEAHLYMQVQIVMEDQFCGHQGNDMYDEEKVKY-TVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLSDNENPWTIFLETVDPGLADSVATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKISKI------KPNLTERIQ------------DYDVSLDKALDELMDGDIIVFQKDDPE---------------NDNSELP---TAKDYFRDLYHRVDVIFCDK----------TIHNDPGFVVTLSNRMNYFQVAKT-VAQRLNTDPMLLQFFK----SQGYRDG--PGNPLRHNYEGTLRDL------------LQFFKPRQP-------------------------KKLYYQQLKMKITDFENRRSFKSIWLNSQFRE--EITLYPDKHGCVRDLLEECKKAVELSENSSEKLRLLEIVSYKIIGVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDTEILIPVAHFHKEVFGTFGIPFLLKIRQGEPFREVMRRIQTMLDIQEKEFEKFKFAIVMMGRHQYIN-----------EDEYEVNLKDFEPQPG----------NMSHP-----RPWLGLDHFNKAPKRGRYTYLEKAIKIHN 1079          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Match: SMESG000050890.1 (SMESG000050890.1)

HSP 1 Score: 2426.74 bits (6288), Expect = 0.000e+0
Identity = 1226/1228 (99.84%), Postives = 1227/1228 (99.92%), Query Frame = 1
Query:  361 MKKSVISNDKTDMSSKSSITNGNVTMNSSPERTTTDXXXXXXXXXXXXXXFQHNPNNKTDDSTEEFERIXXXXXXXXXXXXXXXXXXXXXXENDPARPTGTLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDALPSSDNPVMIWVQTLPADNSADSLPPIDSKQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIIXXXXXXXXXXXXXXXXXXXXYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 4044
            MKKSVISNDKTDMSSKSS+TNGNVTMNSSPERTTTDNKKKKKHLSNNKSLFQHNPNNKTDDSTEEFERIRNSSNNRSDDSKYYDDLDDFYSENDPARPTGTLELRI NISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDALPSSDNPVMIWVQTLPADNSADSLPPIDSKQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIINSNHQNLSNFSNNSLSVSSNYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN
Sbjct:    1 MKKSVISNDKTDMSSKSSVTNGNVTMNSSPERTTTDNKKKKKHLSNNKSLFQHNPNNKTDDSTEEFERIRNSSNNRSDDSKYYDDLDDFYSENDPARPTGTLELRISNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRSQRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFFYRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDALPSSDNPVMIWVQTLPADNSADSLPPIDSKQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNISRMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGELTSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTLPSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPIINSNHQNLSNFSNNSLSVSSNYKRLYFQMLKIPIHEVETMQQFCCIFVDPHCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRIISQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSKIFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKPSNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQPWLCLDHKMPVVKRNRCNISEKPIKIHN 1228          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Match: SMESG000001751.1 (SMESG000001751.1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 278/534 (52.06%), Postives = 383/534 (71.72%), Query Frame = 1
Query: 1219 LPTETDDEQRSVALALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYL-ENSHNSKTKYILHTVLVHSGDNHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQCTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKANAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKAIANSLHEKPDRIRLWCIIYKNNQ-IQLSPMEIKDALPSSDNPVMIWVQTLPADN---------------SADSLPPID-SKQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHVLRKRAHLSESVQLTLWEERERRVVTQ------ITNCGESFTSPYNGLIIIYE 2748
            +PT +D+   SV LALQRVFYELQ+ +K+VGTK+LT+SFGWETLD+FMQHDAQELCRVL+DN+ESKMKGT VE+TIP LFCGKM+S+I+C  VP+ES REE FYDIQLKVKGN +IY+AF +YI++ETL+ DNKYDAGEYG+Q+AEKG++FLKFPPVLYLQLMRFQ+D+ T+ N+KINDRFEF   +DLSKYL EN  +  +KY LH VLVHSGDNHGGHYV Y+NP G+N+WYKFDDDVVSRCS +EA+  N+GG +ED+ ++QCTNAYMLVYM E    ++L  +   DIP  L +RF  E  +E QKR+EKA ++L++ V ++L+EDFYGWQG++L +  +    RR+R  + S + ELT  I  +L + P+ IRLW +  + NQ  +++ ++ KD     D   ++WV+++P +                + D++ P D +  +LIF KY++ +T SIHF   I ++I + +  I   + +RA+L  + +L ++EER+ + + Q      I  C E      +G II+++
Sbjct:    1 MPTYSDEPSVSVPLALQRVFYELQFSDKSVGTKKLTRSFGWETLDSFMQHDAQELCRVLMDNVESKMKGTSVENTIPTLFCGKMMSYIKCKHVPMESTREENFYDIQLKVKGNRNIYDAFQDYISVETLENDNKYDAGEYGLQEAEKGVIFLKFPPVLYLQLMRFQFDFATETNVKINDRFEFYPKIDLSKYLKENKPDIPSKYFLHAVLVHSGDNHGGHYVVYINPRGDNKWYKFDDDVVSRCSIKEAVQMNFGGYEEDLGVRQCTNAYMLVYMDENAKDDILCSVMEADIPHPLLERFAKEHLLEAQKRREKAESHLFTCVHLLLEEDFYGWQGFDLCNPNEAPM-RRIRVSKSSTLDELTSLICETLKQPPNNIRLWQMKARKNQTTRITVLDFKDNFLKQDAAFVLWVESVPINKLMEISSQESENVPPCTIDTVSPFDINNDLLIFLKYYDYRTKSIHFCGHIFIRIQSQLSVILPEMWRRANLPVNTKLLIFEERKPQNIEQLNSDAKIEQCVEILM---DGNIIVFQ 530          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Match: SMESG000041514.1 (SMESG000041514.1)

HSP 1 Score: 131.724 bits (330), Expect = 2.399e-30
Identity = 105/396 (26.52%), Postives = 162/396 (40.91%), Query Frame = 1
Query: 1096 DWD------SKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLL----PTETDDEQRSVALALQR---------------VFYELQ--YGEKAVGTKR-LTKSFGW-------ETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYG-MQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY---------------------------------LENSHN--SKTKYILHTVLVHSGDNHGGHYVAYLNPSGENE--------------------------WYKFDDDVVSRCSRREAILSN--YGGN 1986
            +WD      S+  TGFVGLKN GATCYMNS++Q LF    +R A+  +    P   DD + ++   +++               +  E+Q  +G  A    +  T S  W       + ++   QHDA E    L+D ++  +    +      +  G       C   P   + EE F  + + ++ + ++ E+ ++Y+  + L+GDN Y        +D  K +   K P +L +QL RF YD+E D ++K ND FEFP  LD++ Y                                  E S N  S T+Y L  V+VH G   GGHY +Y+      E                          WY+FDD  VS C      + N  +GG+
Sbjct: 1630 EWDYKPLFVSRSATGFVGLKNAGATCYMNSIIQQLFMIAPIRNALLAVDAGPPAVRDDYEDNILYNVRKDCSKKTVDSKTIKLDILREVQMIFGNLAFSQNQYFTPSGFWKHFKLWGDEVNLREQHDALEFFNCLVDTVDEGLHAIGMAKIFEEVLGGTFADQKICKGCPHRYECEEKFSTLSVDIRHHENLIESLEQYVKGDLLEGDNAYYCESCKEKRDTVKRMCIKKLPLILAIQLKRFDYDWERDTSVKFNDYFEFPIELDMAPYTVAGTSKRDHLNSINEIVRSPSLSSSDSDCPDISECSQNQESSTRYTLKGVVVHGGQASGGHYYSYIKEKRRCEGGTPYNCSDSCSSVNNGIESDDSNYCWYRFDDTEVSECKMDSEEMKNQWFGGD 2025          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Match: SMESG000041514.1 (SMESG000041514.1)

HSP 1 Score: 131.724 bits (330), Expect = 2.588e-30
Identity = 105/396 (26.52%), Postives = 162/396 (40.91%), Query Frame = 1
Query: 1096 DWD------SKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLL----PTETDDEQRSVALALQR---------------VFYELQ--YGEKAVGTKR-LTKSFGW-------ETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYG-MQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKY---------------------------------LENSHN--SKTKYILHTVLVHSGDNHGGHYVAYLNPSGENE--------------------------WYKFDDDVVSRCSRREAILSN--YGGN 1986
            +WD      S+  TGFVGLKN GATCYMNS++Q LF    +R A+  +    P   DD + ++   +++               +  E+Q  +G  A    +  T S  W       + ++   QHDA E    L+D ++  +    +      +  G       C   P   + EE F  + + ++ + ++ E+ ++Y+  + L+GDN Y        +D  K +   K P +L +QL RF YD+E D ++K ND FEFP  LD++ Y                                  E S N  S T+Y L  V+VH G   GGHY +Y+      E                          WY+FDD  VS C      + N  +GG+
Sbjct: 1629 EWDYKPLFVSRSATGFVGLKNAGATCYMNSIIQQLFMIAPIRNALLAVDAGPPAVRDDYEDNILYNVRKDCSKKTVDSKTIKLDILREVQMIFGNLAFSQNQYFTPSGFWKHFKLWGDEVNLREQHDALEFFNCLVDTVDEGLHAIGMAKIFEEVLGGTFADQKICKGCPHRYECEEKFSTLSVDIRHHENLIESLEQYVKGDLLEGDNAYYCESCKEKRDTVKRMCIKKLPLILAIQLKRFDYDWERDTSVKFNDYFEFPIELDMAPYTVAGTSKRDHLNSINEIVRSPSLSSSDSDCPDISECSQNQESSTRYTLKGVVVHGGQASGGHYYSYIKEKRRCEGGTPYNCSDSCSSVNNGIESDDSNYCWYRFDDTEVSECKMDSEEMKNQWFGGD 2024          
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Match: SMESG000031961.1 (SMESG000031961.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.449e-29
Identity = 103/358 (28.77%), Postives = 168/358 (46.93%), Query Frame = 1
Query: 1102 DSKKHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYGEKA-VGTKRLTKSFGW--ETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEY-GMQDAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHNS---------KTKYILHTVLVHSGDNHGGHYVAYLNP-------------SGENEWYKFDDDVVSRCSRREAILSN-YGG---NDEDMSIKQ---------CTNAYMLVY--MSEGD 2052
            D ++ TGF G+ N GATCY+ + LQ LF   + RK +     E  +        LQ +F  LQ+ E++ +  K     +    + ++T  Q D  E    L+  LE+      +++ I NLF G+  S+I  +  P +S+  E FY + L V   + + ++F  ++  + LDG+NKY   +   +  AEK     K P +L L +MR+ +D  T    K+N+ FEFP  LD+  ++++S  +           KY L  + VHSG +  GHY +++               S  ++W+ F+D  + +C     I S  +GG   N  ++   Q           NAYML Y  +S GD
Sbjct: 1924 DLREETGFCGIINLGATCYLATTLQHLFMIPECRKLIL----ECTESGLKWFNKLQSIFSFLQFSERSGLNPKAFCDVYEMNKQVINTGEQKDMSEFFGDLIGKLETV--SLILKNGIKNLFGGESSSYIVSLDCPHQSRIPEEFYFLSLNVNNMTSLQQSFAHFVEKDILDGNNKYRCSDCDSLVRAEKRTCLTKLPTILCLNIMRYYFDVNTLRREKLNNFFEFPMQLDVEPFMKHSLMAGEPEIGVAGNCKYRLIGITVHSGTSESGHYYSFIKDRSDGKTLYWNDQNSASDKWFCFNDSKI-KCFDPTNIPSECFGGLNVNKRNIETSQLFLGTSEYKTNNAYMLFYERVSIGD 2274          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP70.000e+041.47ubiquitin specific peptidase 7 [Source:HGNC Symbol... [more]
USP70.000e+041.47ubiquitin specific peptidase 7 [Source:HGNC Symbol... [more]
USP70.000e+041.39ubiquitin specific peptidase 7 [Source:HGNC Symbol... [more]
USP70.000e+043.14ubiquitin specific peptidase 7 [Source:HGNC Symbol... [more]
USP70.000e+063.56ubiquitin specific peptidase 7 [Source:HGNC Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
math-331.257e-13643.47Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-331.431e-13643.47Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-331.444e-13643.47Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-331.462e-13643.47Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-331.646e-13643.47Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp70.000e+036.42gene:FBgn0030366 transcript:FBtr0073641[more]
Usp70.000e+036.25gene:FBgn0030366 transcript:FBtr0342732[more]
Usp476.290e-5239.86gene:FBgn0016756 transcript:FBtr0077096[more]
Usp476.290e-5239.86gene:FBgn0016756 transcript:FBtr0077095[more]
Usp477.282e-5239.86gene:FBgn0016756 transcript:FBtr0306259[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp70.000e+040.94ubiquitin specific peptidase 7 (herpes virus-assoc... [more]
usp70.000e+040.69ubiquitin specific peptidase 7 (herpes virus-assoc... [more]
usp476.586e-5132.85ubiquitin specific peptidase 47 [Source:ZFIN;Acc:Z... [more]
usp482.392e-4432.53ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp484.223e-4232.53ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syp0.000e+041.30synaptophysin [Source:Xenbase;Acc:XB-GENE-943861][more]
syp0.000e+041.30synaptophysin [Source:Xenbase;Acc:XB-GENE-943861][more]
syp0.000e+041.30synaptophysin [Source:Xenbase;Acc:XB-GENE-943861][more]
syp0.000e+041.01synaptophysin [Source:Xenbase;Acc:XB-GENE-943861][more]
syp0.000e+040.19synaptophysin [Source:Xenbase;Acc:XB-GENE-943861][more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp70.000e+041.39ubiquitin specific peptidase 7 [Source:MGI Symbol;... [more]
Usp70.000e+041.39ubiquitin specific peptidase 7 [Source:MGI Symbol;... [more]
Usp71.521e-13067.26ubiquitin specific peptidase 7 [Source:MGI Symbol;... [more]
Usp479.924e-5433.49ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
Usp471.163e-5333.49ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93009|UBP7_HUMAN0.000e+041.47Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sa... [more]
sp|Q4VSI4|UBP7_RAT0.000e+041.39Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus ... [more]
sp|Q6A4J8|UBP7_MOUSE0.000e+041.39Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus mus... [more]
sp|Q6U7I1|UBP7_CHICK0.000e+041.05Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus ... [more]
sp|Q9VYQ8|UBP7_DROME0.000e+036.42Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosoph... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A384WIE70.000e+042.00Ubiquitin OS=Onchidium struma nom. nud. OX=643549 ... [more]
A0A2R5LCL60.000e+041.44Putative ubiquitin carboxyl-terminal hydrolase pos... [more]
A0A293MIZ30.000e+041.62Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A067RK910.000e+042.15Ubiquitin carboxyl-terminal hydrolase 7 OS=Zooterm... [more]
A0A1E1XR420.000e+042.24Putative ubiquitin carboxyl-terminal hydrolase (Fr... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp70.000e+040.78ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp70.000e+040.78ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp478.533e-5634.38ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp473.113e-5534.05ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp474.077e-5534.05ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp70.000e+042.34ubiquitin specific peptidase 7 (herpes virus-assoc... [more]
ENSPMAT00000005124.19.015e-4036.65pep scaffold:Pmarinus_7.0:GL490092:2610:6304:1 gen... [more]
ENSPMAT00000001446.14.192e-3127.84pep scaffold:Pmarinus_7.0:GL476913:23272:104531:1 ... [more]
usp12a1.319e-2328.61ubiquitin specific peptidase 12a [Source:NCBI gene... [more]
ENSPMAT00000008243.14.540e-2027.90pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 ... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBP157.564e-11137.48Ubiquitin-specific protease involved in protein de... [more]
UBP84.554e-2527.69Ubiquitin-specific protease component of the SAGA ... [more]
UBP91.564e-2029.67Ubiquitin-specific protease that cleaves ubiquitin... [more]
UBP132.325e-1829.76Ubiquitin-specific protease that cleaves Ub-protei... [more]
UBP52.357e-1425.36Putative ubiquitin-specific protease; concentrates... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347450.000e+039.53Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO438538.515e-4035.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350562.286e-3026.97Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO443192.280e-2729.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367561.529e-2525.30Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp70.000e+040.95ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp70.000e+040.95ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp70.000e+040.95ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp70.000e+040.95ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp70.000e+040.75ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050890.10.000e+099.84SMESG000050890.1[more]
SMESG000001751.10.000e+052.06SMESG000001751.1[more]
SMESG000041514.12.399e-3026.52SMESG000041514.1[more]
SMESG000041514.12.588e-3026.52SMESG000041514.1[more]
SMESG000031961.11.449e-2928.77SMESG000031961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030425 ID=SMED30030425|Name=Ubiquitin carboxyl-terminal hydrolase 7|organism=Schmidtea mediterranea sexual|type=transcript|length=4140bp
AATTATATTAGTATATATTATTGATTTCATAAATTTTTAAATAATACTGA
ATGATAAAGTTAATTATTTAACAACTCTTTCTATTAAAATCAAAATAATT
TATTAATTTTTATTTATTTAAAAGTAAATATTGGGCGAGTACCGAGCAAA
CACGCTAAAAATACGTTAGGTTCTTCAGAATTAAAAGCAAAAAATTCTAA
TAAAACGAAATTAATTACTAATAAAGGCGACATTTCAGACCAAACTACTC
CTGGCACACGTCATTCTTTTGATGTGTCGCTGGGAACCGAACGAGAAGAA
ACTGAATCAATACGTCGTTCACAATCTGAGCAAAGAAATAATGACAATGA
TGATATAAACATGAAAAAAAGCGTCATTTCTAATGATAAAACTGATATGT
CTTCAAAAAGTTCAATAACTAATGGGAATGTTACCATGAATAGCTCACCA
GAAAGAACAACAACAGATAACAAAAAAAAGAAAAAGCATCTTTCGAACAA
CAAGTCACTTTTTCAACATAATCCAAACAATAAAACCGATGATTCTACTG
AGGAATTTGAAAGAATACGTAATTCTTCAAACAATAGAAGTGATGATTCG
AAATATTATGATGATCTTGATGACTTCTATTCTGAAAACGATCCAGCCCG
GCCAACCGGAACGTTAGAGCTCAGAATTCCAAATATCAGCAAATACAAAG
ATGTGGATTTCCGCCAGGAAACTAAGATTCTAAGTCCAGAACCAATATTC
GTTCGATGTTTACCATGGAAAATACTTTTTATGTTGCGAACTCAAAATCC
CGATCGTTCTCAACGATGCATGGGATTTTTCCTCCAATGCAACAATACAT
CTGAATCGACAATATGGCATTGTCACGCCAAAGCTGAATTAAGATTAGTA
TGTCAGCGGAAAAATCCAAGCAATCAGGACATCGTTAAAAATATTGAACA
CAATTTTTTCTATCGTGAAAACGATTGGGGATATTCTAGCTTTATTACTT
GGACAGATCTTACCAATCCCGATAAAGGCTTTGTTGGTTCCGATGATAGT
CTTTTGCTTCGTGTGAAAGTAAACGCCGATGCACCACATGGCGTAGACTG
GGATTCTAAGAAGCACACCGGGTTTGTTGGTCTCAAGAATCAAGGAGCTA
CATGCTATATGAATTCTTTACTTCAAGCATTGTTTTTTACAAATAAACTG
AGAAAGGCTGTTTATCTATTACCAACTGAAACTGATGATGAACAAAGATC
TGTTGCTCTTGCTCTACAACGAGTATTTTATGAATTACAATATGGAGAAA
AAGCGGTTGGAACTAAGAGATTAACTAAAAGTTTTGGATGGGAAACATTA
GATACTTTTATGCAACATGATGCTCAAGAATTGTGTCGAGTTCTTTTAGA
CAATCTAGAGAGTAAAATGAAAGGTACTCGAGTTGAAGATACTATTCCAA
ATCTATTCTGTGGAAAAATGGTGTCATTTATTCGTTGTGTAAAAGTACCA
GTCGAATCCAAAAGAGAAGAAGCTTTTTATGATATACAATTGAAAGTGAA
AGGAAATAGTGATATTTATGAAGCATTTGATGAATATATCACTATTGAAA
CTTTGGACGGTGATAATAAATATGACGCTGGAGAATATGGAATGCAAGAT
GCCGAAAAAGGCATCATGTTTTTAAAATTTCCACCAGTTTTGTATTTACA
ATTAATGCGTTTTCAATACGATTATGAAACAGATGCAAATATTAAGATCA
ATGATCGATTTGAGTTCCCTTATTCTTTGGATTTGAGTAAATACCTAGAA
AATTCTCACAACTCTAAAACTAAATATATTTTACATACTGTTCTGGTTCA
TTCTGGTGACAATCATGGGGGTCATTATGTTGCCTATCTGAATCCATCTG
GAGAAAATGAGTGGTATAAGTTTGATGATGATGTTGTCAGTCGATGTTCT
AGAAGAGAGGCTATTCTTTCTAATTATGGAGGTAATGATGAGGATATGTC
AATCAAGCAATGCACTAATGCTTATATGCTTGTATATATGAGTGAGGGAG
ATATTAAAGAGTTGCTTCAACCAATCAGTCGCGATGATATACCTACTAAT
TTACATCAAAGATTTACAAATGAAAAACATATAGAAGACCAAAAACGAAA
AGAAAAAGCCAATGCATATCTCTACTCATCGGTGATAATAGTATTAGATG
AAGATTTTTACGGTTGGCAAGGTTATGAATTATTTGACGTGGAAAAGTGT
TCATTTTGGCGTCGCCTGAGATTTCCTCGAAAATCCAATGTTAGTGAATT
AACAAAAGCCATTGCAAATTCTCTGCATGAAAAGCCCGACAGAATTCGAC
TTTGGTGTATTATTTACAAGAATAATCAAATCCAGTTGTCTCCAATGGAA
ATCAAAGATGCTCTTCCATCGAGTGATAATCCTGTTATGATTTGGGTTCA
GACACTTCCTGCTGATAACTCAGCAGATTCTCTTCCACCAATTGATTCCA
AACAGATTTTAATATTTTGTAAATATTTTAACCCTCAAACCAACTCTATT
CATTTTATGAGTTGGATTAATGTTAAAATCGGTGCACCTATCAAAGATAT
TTTTCATGTATTACGAAAAAGAGCGCATTTATCAGAATCTGTTCAACTGA
CTCTTTGGGAAGAACGCGAAAGACGAGTAGTGACACAAATAACGAATTGT
GGTGAAAGTTTTACGTCTCCCTATAATGGTTTGATTATCATTTATGAGCC
CAACATCAGTCGAATGTCATTACGCAAAATTGGAAACGGTGATACCTTTC
AAGATATACGCTCTAATACATTTGTACCACAAACTATTAATGCAAAAGAT
TTTCTTCATGATTTATATCAGAAAATTGAAGTGGAATTTATAGAAAAAAT
TGGCGAGTTGACATCAAGAGATATTACCAATAAATCAAATCCTAGTAGTG
CGGTTATTCGATTGTCCCAGAAAGCTCGATATATCGATATAATGAAAGCG
TTAGTTGCTAATATTCCAGGAACGGAAATTGGTAAAATTCAACTCTATAA
GCCCACTTTGCCTTCTCACGGCTCGAAAAATGAACTTTTACCCGGTGATC
CTGTTCGGACAACGTTTGAAGGAACATTAGCTGATTTGATTAGTTCACAA
GCACAATCGCAAATTAATGCCACTCTTCCTAGAGGAAAGCCAACTCAAAG
TGTACCGATAATAAATTCAAATCATCAAAATCTGTCCAATTTCTCCAACA
ATTCACTCTCAGTATCATCTAATTATAAACGGCTGTATTTTCAAATGCTA
AAAATTCCAATTCATGAAGTGGAAACCATGCAGCAATTTTGTTGTATTTT
TGTCGATCCTCATTGTCAAGAACAAGTAGAAGTACAAGTCACGCTTCCTA
GGACTGGCTGTGCAGCTGATATTCTTGCGGAAGCTAGAAAACTTTCCAAG
TTGAATACCAACAATGCAACTGGTTATCGATTGTTTGAAGTATTTGATCA
TAGAATCATAAGTCAAATTCCTTTGAAAATGAAATTATCAGAATTTCAGC
CAAATCCCAATCGCGTGATTTATATAGAAAGCATTCCCCAAGAAGAACTT
AAAATCAATAGAAAGACCGAAGCGCTTGTTTCTGTATCTCATTGTCAACT
TGATTCCAAAATATTCTTCGGTATTCCATTCACCATTAAAGTCGTTGACA
AAGAATCCACAAATGACCTGAGAAATCGAATTCGTCTCCGGATCGAATGT
CCAACTAAAGAATTTGAAAAATATCAATTAGCTCTCTGTACAAATAATCT
GGAAAAGCCATCGAATCGTGGAGCTTTCTCGCCGAGATTTCTAACCGAAG
AAAACACTTCTCAGATACGTATTAGTATGTTTGAATCGAATTCGAGTTTT
TGCAATGTAGCTTTCGACAGTTGCGATCAGAATTCTGAACCATTAATAAC
CATCGATCAGCCTTGGTTGTGTCTTGATCATAAAATGCCTGTTGTCAAGC
GAAACAGATGCAATATTTCCGAGAAACCTATTAAAATTCATAATTGATAT
TTAGATTAATTAAATATGCATATTTGAATAATATTTGTTGACTGAATATT
TTCATTTTACAATTTAGATGGAGAACCTGATGACGAAAAT
back to top

protein sequence of SMED30030425-orf-1

>SMED30030425-orf-1 ID=SMED30030425-orf-1|Name=SMED30030425-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1229bp
MKKSVISNDKTDMSSKSSITNGNVTMNSSPERTTTDNKKKKKHLSNNKSL
FQHNPNNKTDDSTEEFERIRNSSNNRSDDSKYYDDLDDFYSENDPARPTG
TLELRIPNISKYKDVDFRQETKILSPEPIFVRCLPWKILFMLRTQNPDRS
QRCMGFFLQCNNTSESTIWHCHAKAELRLVCQRKNPSNQDIVKNIEHNFF
YRENDWGYSSFITWTDLTNPDKGFVGSDDSLLLRVKVNADAPHGVDWDSK
KHTGFVGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVAL
ALQRVFYELQYGEKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLE
SKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNS
DIYEAFDEYITIETLDGDNKYDAGEYGMQDAEKGIMFLKFPPVLYLQLMR
FQYDYETDANIKINDRFEFPYSLDLSKYLENSHNSKTKYILHTVLVHSGD
NHGGHYVAYLNPSGENEWYKFDDDVVSRCSRREAILSNYGGNDEDMSIKQ
CTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQRFTNEKHIEDQKRKEKA
NAYLYSSVIIVLDEDFYGWQGYELFDVEKCSFWRRLRFPRKSNVSELTKA
IANSLHEKPDRIRLWCIIYKNNQIQLSPMEIKDALPSSDNPVMIWVQTLP
ADNSADSLPPIDSKQILIFCKYFNPQTNSIHFMSWINVKIGAPIKDIFHV
LRKRAHLSESVQLTLWEERERRVVTQITNCGESFTSPYNGLIIIYEPNIS
RMSLRKIGNGDTFQDIRSNTFVPQTINAKDFLHDLYQKIEVEFIEKIGEL
TSRDITNKSNPSSAVIRLSQKARYIDIMKALVANIPGTEIGKIQLYKPTL
PSHGSKNELLPGDPVRTTFEGTLADLISSQAQSQINATLPRGKPTQSVPI
INSNHQNLSNFSNNSLSVSSNYKRLYFQMLKIPIHEVETMQQFCCIFVDP
HCQEQVEVQVTLPRTGCAADILAEARKLSKLNTNNATGYRLFEVFDHRII
SQIPLKMKLSEFQPNPNRVIYIESIPQEELKINRKTEALVSVSHCQLDSK
IFFGIPFTIKVVDKESTNDLRNRIRLRIECPTKEFEKYQLALCTNNLEKP
SNRGAFSPRFLTEENTSQIRISMFESNSSFCNVAFDSCDQNSEPLITIDQ
PWLCLDHKMPVVKRNRCNISEKPIKIHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR002083MATH/TRAF_dom
IPR001394Peptidase_C19_UCH
IPR029346USP_C
IPR024729USP7_ICP0-binding_dom
IPR018200USP_CS
IPR028889USP_dom
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 107..217
e-value: 2.0E-9
score: 47.3
IPR002083MATH/TRAF domainPFAMPF00917MATHcoord: 123..219
e-value: 3.2E-9
score: 36.9
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 99..237
score: 17.45
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 709..815
e-value: 2.0E-11
score: 45.9
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 576..698
e-value: 4.6E-20
score: 73.9
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 253..563
e-value: 1.6E-88
score: 298.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 58..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..78
NoneNo IPR availablePANTHERPTHR24006FAMILY NOT NAMEDcoord: 120..847
coord: 946..1106
NoneNo IPR availablePANTHERPTHR24006:SF761UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7coord: 120..847
coord: 946..1106
NoneNo IPR availableCDDcd02659peptidase_C19Ccoord: 254..559
e-value: 5.11226E-147
score: 444.393
IPR029346Ubiquitin carboxyl-terminal hydrolase, C-terminalPFAMPF14533USP7_C2coord: 974..1207
e-value: 4.1E-39
score: 134.4
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 256..559
e-value: 4.1E-51
score: 174.0
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 96..252
e-value: 2.3E-34
score: 120.5
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 98..239
IPR024729Ubiquitin carboxyl-terminal hydrolase 7, ICP0-binding domainPFAMPF12436USP7_ICP0_bdgcoord: 680..926
e-value: 3.3E-24
score: 85.5
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00972USP_1coord: 257..272
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 256..562
score: 41.005
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 251..590