Bifunctional glutamate/proline--tRNA ligase

Overview
NameBifunctional glutamate/proline--tRNA ligase
Smed IDSMED30030404
Length (bp)3867
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bifunctional glutamate/proline--tRNA ligase (SMED30030404) t-SNE clustered cells

Violin plots show distribution of expression levels for Bifunctional glutamate/proline--tRNA ligase (SMED30030404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bifunctional glutamate/proline--tRNA ligase (SMED30030404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bifunctional glutamate/proline--tRNA ligase (SMED30030404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030404

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030404h1SMcG0011027 Contig49604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030404h1SMcG0011027 Contig49604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30030404h1SMcG0011027 dd_Smed_v4_2488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030404h1SMcG0011027 dd_Smed_v4_2488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030404h1SMcG0011027 dd_Smed_v4_2488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030404h1SMcG0011027 dd_Smed_v4_2488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030404h1SMcG0011027 dd_Smed_v6_2488_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030404h1SMcG0011027 dd_Smed_v6_2488_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030404h1SMcG0011027 dd_Smed_v4_2488_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Match: EPRS1 (glutamyl-prolyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:3418])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 358/665 (53.83%), Postives = 469/665 (70.53%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D    ++N LN  ++ RTYLV +SLS AD  ++ TL  N  +Q  LK    P++V R++  L+     +++ T  + S  K  V  EK              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++  SK R   +E+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + ++ V + +  E +++ V +HPKN  +G K VW++P VF+E  DA  F+E   VTFINWGN+ ITKIHKN++  I S+DAKLNL ++D+KKT KVTW+     +      IPV  + Y++LITK VLGKD+DFK ++N++SK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + K+ P VLI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVIPVNVPEAQEEMKE-VAKHPKNPEVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWL----AETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVE 722          

HSP 2 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 296/507 (58.38%), Postives = 372/507 (73.37%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRD--GKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+Y+DI GCYIL P    IWE I++  +  I+  GV+ C FP F+S+S+L KEK H+ADF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A EEV QILDLYA VYE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQG TSHHLGQNFSKMF+I FE     G+++F +QNSWG+TTRTIG++ MVHGD+ GLVLPPRVA  QVVI+PCG+T   +E++ EA++ KC     RL +  IRV ADL  + SPG+KFN+WELKGVPIR+E+GP+++ +   V   R  G K ++ +   E  ++  LE I   +F +A  +L  H  VA TMED    L+   ++  PFCG+  CED IK  +A +  +E GAPSMGAKSLCIPF+  C L  G KC+   C   P KY+T+FGRSY
Sbjct: 1009 KKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCV---CGKNPAKYYTLFGRSY 1512          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Match: EPRS1 (glutamyl-prolyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:3418])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 358/672 (53.27%), Postives = 469/672 (69.79%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFN-------KKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D    ++N LN  ++ RTYLV +SLS AD  ++ TL  N  +Q  LK    P++V R++  L+     +++ T  + S  K  V  EK              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++  SK R   +E+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFN       KKVIDP+APRY AL    + ++ V + +  E +++ V +HPKN  +G K VW++P VF+E  DA  F+E   VTFINWGN+ ITKIHKN++  I S+DAKLNL ++D+KKT KVTW+     +      IPV  + Y++LITK VLGKD+DFK ++N++SK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + K+ P VLI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKLRALCKKVIDPVAPRYVAL--LKKEVIPVNVPEAQEEMKE-VAKHPKNPEVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWL----AETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVE 729          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Match: QARS1 (glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9751])

HSP 1 Score: 213.772 bits (543), Expect = 7.999e-58
Identity = 165/530 (31.13%), Postives = 245/530 (46.23%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTF--INWGN----------ILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKR-EECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKE-----NCSITGKQYP 1979
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  LG +    +Y+SD+FD L  +  ELI+   AY  +    ++K        S  R++ +EE+L  +  M+ G     +  +R+K+ M   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   A   ME   L A  + V++  APR  A+  S R  V++      + ++  V   P +E  G   V F P VF+ER    DF E     F  + WG           I +  + K     + S++     +D   K    + W+  PL    R+ +         + +   ++       F + LN  S    +  + D  +   K  D  Q +R GYF  D +  +     N ++T K+ P
Sbjct:  115 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGH--NTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVME--DGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLR--VIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIER---TDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYER-------LFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDP 627          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Match: QARS1 (glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9751])

HSP 1 Score: 213.772 bits (543), Expect = 3.811e-57
Identity = 161/512 (31.45%), Postives = 237/512 (46.29%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTF--INWGN----------ILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKR-EECLIGDVELKNLKKGDIIQLQRKGYFICDEE 1940
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  LG +    +Y+SD+FD L  +  ELI+   AY  +    ++K        S  R++ +EE+L  +  M+ G     +  +R+K+ M   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   A   ME   L A  + V++  APR  A+  S R  V++      + ++  V   P +E  G   V F P VF+ER    DF E     F  + WG           I +  + K     + S++     +D   K    + W+  PL    R+ +         + +   ++       F + LN  S    +  + D  +   K  D  Q +R GYF  D +
Sbjct:  204 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGH--NTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVME--DGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLR--VIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIER---TDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYER-------LFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPD 698          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Match: QARS1 (glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9751])

HSP 1 Score: 214.157 bits (544), Expect = 5.260e-57
Identity = 165/530 (31.13%), Postives = 245/530 (46.23%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTF--INWGN----------ILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKR-EECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKE-----NCSITGKQYP 1979
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  LG +    +Y+SD+FD L  +  ELI+   AY  +    ++K        S  R++ +EE+L  +  M+ G     +  +R+K+ M   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   A   ME   L A  + V++  APR  A+  S R  V++      + ++  V   P +E  G   V F P VF+ER    DF E     F  + WG           I +  + K     + S++     +D   K    + W+  PL    R+ +         + +   ++       F + LN  S    +  + D  +   K  D  Q +R GYF  D +  +     N ++T K+ P
Sbjct:  260 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGH--NTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVME--DGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLR--VIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIER---TDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYER-------LFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDP 772          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Match: ears-1 (Glutamyl(E) Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q23315])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 294/532 (55.26%), Postives = 387/532 (72.74%), Query Frame = 3
Query:  429 FVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERA 2024
            FV L    KG VVVRFPPEASGYLHIGHAKAAL+NQ+Y+  + G+LIMRFDDTNPAKE   FE +I ED+  L +  D +++SSDHF++L+  CE+L+K   A+ D+TD   M+ ERE++  S+ R+ T E+NL+ W  MK G+ +GL  C+R+K+DM SNNG MRDPTIYRCKPE HVRTG KYKVYPTYDFTCPIVDS+EGVTH LRT+EY+DR++Q++ I D L LR+P I +Y+RL + NTV+SKRKLT+ V+EG+V+GWDDPR+PTVRG++R G+T+EGLK+F++AQG  R+ V+MEWDK+WAFNKKVIDP+APRYTAL  S   LV + + D +     +V  HPKN  IG K V     + +E+ DA    E   VTF+NWGNI I KI K    VIT I A L L + D+KKT KVTW  LG         IPV    YD++I+K ++GKD+D+K F+N DS     ++G+  +KN+KKGDIIQ+QRKG++I D+ Y     ++G + PL+LI IP+G++ + A
Sbjct:  183 FVELPGAEKGKVVVRFPPEASGYLHIGHAKAALLNQYYQQAFEGQLIMRFDDTNPAKENAHFEHVIKEDLSMLNIVPDRWTHSSDHFEMLLTMCEKLLKEGKAFVDDTDTETMRNEREQRQDSRNRSNTPEKNLQLWEEMKKGSPKGLTCCVRMKIDMKSNNGAMRDPTIYRCKPEEHVRTGLKYKVYPTYDFTCPIVDSVEGVTHALRTTEYHDRDDQYYFICDALGLRRPHIWEYARLNMTNTVMSKRKLTWFVDEGHVEGWDDPRLPTVRGVMRRGLTVEGLKQFIVAQGGSRSVVMMEWDKIWAFNKKVIDPVAPRYTALD-STSPLVSIELTDSISDDTSNVSLHPKNAEIGSKDVHKGKKLLLEQVDAAALKEGEIVTFVNWGNIKIGKIEKKGA-VITKISATLQLDNTDYKKTTKVTW--LGDVKAEAGKTIPVVTADYDHIISKAIIGKDEDWKQFINFDSVHYTKMVGEPAIKNVKKGDIIQIQRKGFYIVDQPYNPKSELSGVETPLLLIAIPDGHTGKEA 710          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Match: ears-1 (Glutamyl(E) Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q23315])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 294/532 (55.26%), Postives = 387/532 (72.74%), Query Frame = 3
Query:  429 FVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERA 2024
            FV L    KG VVVRFPPEASGYLHIGHAKAAL+NQ+Y+  + G+LIMRFDDTNPAKE   FE +I ED+  L +  D +++SSDHF++L+  CE+L+K   A+ D+TD   M+ ERE++  S+ R+ T E+NL+ W  MK G+ +GL  C+R+K+DM SNNG MRDPTIYRCKPE HVRTG KYKVYPTYDFTCPIVDS+EGVTH LRT+EY+DR++Q++ I D L LR+P I +Y+RL + NTV+SKRKLT+ V+EG+V+GWDDPR+PTVRG++R G+T+EGLK+F++AQG  R+ V+MEWDK+WAFNKKVIDP+APRYTAL  S   LV + + D +     +V  HPKN  IG K V     + +E+ DA    E   VTF+NWGNI I KI K    VIT I A L L + D+KKT KVTW  LG         IPV    YD++I+K ++GKD+D+K F+N DS     ++G+  +KN+KKGDIIQ+QRKG++I D+ Y     ++G + PL+LI IP+G++ + A
Sbjct:  183 FVELPGAEKGKVVVRFPPEASGYLHIGHAKAALLNQYYQQAFEGQLIMRFDDTNPAKENAHFEHVIKEDLSMLNIVPDRWTHSSDHFEMLLTMCEKLLKEGKAFVDDTDTETMRNEREQRQDSRNRSNTPEKNLQLWEEMKKGSPKGLTCCVRMKIDMKSNNGAMRDPTIYRCKPEEHVRTGLKYKVYPTYDFTCPIVDSVEGVTHALRTTEYHDRDDQYYFICDALGLRRPHIWEYARLNMTNTVMSKRKLTWFVDEGHVEGWDDPRLPTVRGVMRRGLTVEGLKQFIVAQGGSRSVVMMEWDKIWAFNKKVIDPVAPRYTALD-STSPLVSIELTDSISDDTSNVSLHPKNAEIGSKDVHKGKKLLLEQVDAAALKEGEIVTFVNWGNIKIGKIEKKGA-VITKISATLQLDNTDYKKTTKVTW--LGDVKAEAGKTIPVVTADYDHIISKAIIGKDEDWKQFINFDSVHYTKMVGEPAIKNVKKGDIIQIQRKGFYIVDQPYNPKSELSGVETPLLLIAIPDGHTGKEA 710          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Match: pars-1 (Prolyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZK5])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 278/505 (55.05%), Postives = 357/505 (70.69%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCN-LGDKCINSECSMKPKYFTMFGRSY 3758
            KK T LG+   K+DN+SEWY +VITK E+I+YYD+ GCY+L P +  +WE IQ   ++ I+  GVK C FP F+S ++L +EK HIADF+PEVAWVT AG+  + EPIAIRPTSET MYP Y K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++N  DA +EV QILDLYA VY DLLAIPVVKGRK+EKEKFAG DFTTT E Y+  +GR IQGATSHHLGQNFSKMFDI +E  +++G++ F +QNSWG++TRTIG +VM+HGDD+GLVLPPRVA  QV++VP G       +  +++ +   K+   L    ++   DL  + + G+KFN+WELKGVPIR E+GP +LA N V    R+NG K+ +  E L + V+  L+ IH AM+ K   + D+H      +E+    L+ K +I +PFCG   CE+ IK  S  E    EGA  MGAK+LCIP +QP   L  KC+   C+   K F +FGRSY
Sbjct:   84 KKQTLLGVGTKKDDNYSEWYSEVITKAEMIEYYDVSGCYVLRPWSFAVWESIQEWFDSGIKKLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVTRAGNSEMAEPIAIRPTSETVMYPSYKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTREFLWQEGHTAFANPADAEKEVFQILDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTVEAYVACNGRGIQGATSHHLGQNFSKMFDISYEDPAKEGERAFAWQNSWGLSTRTIGAMVMIHGDDKGLVLPPRVAAVQVIVVPVGFKT----ENKQSLFDAVDKVTKDLVADGVKAEHDLRENYNAGWKFNHWELKGVPIRFEVGPNDLAKNQVTAVIRHNGEKKQLSLEGLSKTVKSLLDEIHTAMYNKVLAQRDSHLKSTTCIEEFKKLLDEKCIILSPFCGRPDCEEEIKKASTRED--GEGA-QMGAKTLCIPLDQPKQELPSKCLFPSCTYNAKAFALFGRSY 581          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Match: pars-1 (Prolyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZK5])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 278/505 (55.05%), Postives = 357/505 (70.69%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCN-LGDKCINSECSMKPKYFTMFGRSY 3758
            KK T LG+   K+DN+SEWY +VITK E+I+YYD+ GCY+L P +  +WE IQ   ++ I+  GVK C FP F+S ++L +EK HIADF+PEVAWVT AG+  + EPIAIRPTSET MYP Y K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++N  DA +EV QILDLYA VY DLLAIPVVKGRK+EKEKFAG DFTTT E Y+  +GR IQGATSHHLGQNFSKMFDI +E  +++G++ F +QNSWG++TRTIG +VM+HGDD+GLVLPPRVA  QV++VP G       +  +++ +   K+   L    ++   DL  + + G+KFN+WELKGVPIR E+GP +LA N V    R+NG K+ +  E L + V+  L+ IH AM+ K   + D+H      +E+    L+ K +I +PFCG   CE+ IK  S  E    EGA  MGAK+LCIP +QP   L  KC+   C+   K F +FGRSY
Sbjct:   84 KKQTLLGVGTKKDDNYSEWYSEVITKAEMIEYYDVSGCYVLRPWSFAVWESIQEWFDSGIKKLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVTRAGNSEMAEPIAIRPTSETVMYPSYKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTREFLWQEGHTAFANPADAEKEVFQILDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTVEAYVACNGRGIQGATSHHLGQNFSKMFDISYEDPAKEGERAFAWQNSWGLSTRTIGAMVMIHGDDKGLVLPPRVAAVQVIVVPVGFKT----ENKQSLFDAVDKVTKDLVADGVKAEHDLRENYNAGWKFNHWELKGVPIRFEVGPNDLAKNQVTAVIRHNGEKKQLSLEGLSKTVKSLLDEIHTAMYNKVLAQRDSHLKSTTCIEEFKKLLDEKCIILSPFCGRPDCEEEIKKASTRED--GEGA-QMGAKTLCIPLDQPKQELPSKCLFPSCTYNAKAFALFGRSY 581          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Match: pars-1 (Prolyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZK5])

HSP 1 Score: 495.352 bits (1274), Expect = 3.807e-163
Identity = 224/369 (60.70%), Postives = 283/369 (76.69%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANN 3353
            KK T LG+   K+DN+SEWY +VITK E+I+YYD+ GCY+L P +  +WE IQ   ++ I+  GVK C FP F+S ++L +EK HIADF+PEVAWVT AG+  + EPIAIRPTSET MYP Y K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++N  DA +EV QILDLYA VY DLLAIPVVKGRK+EKEKFAG DFTTT E Y+  +GR IQGATSHHLGQNFSKMFDI +E  +++G++ F +QNSWG++TRTIG +VM+HGDD+GLVLPPRVA  QV++VP G       +  +++ +   K+   L    ++   DL  + + G+KFN+WELKGVPIR E+GP +LA N
Sbjct:   84 KKQTLLGVGTKKDDNYSEWYSEVITKAEMIEYYDVSGCYVLRPWSFAVWESIQEWFDSGIKKLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVTRAGNSEMAEPIAIRPTSETVMYPSYKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTREFLWQEGHTAFANPADAEKEVFQILDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTVEAYVACNGRGIQGATSHHLGQNFSKMFDISYEDPAKEGERAFAWQNSWGLSTRTIGAMVMIHGDDKGLVLPPRVAAVQVIVVPVGFKT----ENKQSLFDAVDKVTKDLVADGVKAEHDLRENYNAGWKFNHWELKGVPIRFEVGPNDLAKN 448          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Fly
Match: GluProRS (gene:FBgn0005674 transcript:FBtr0084511)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 335/658 (50.91%), Postives = 451/658 (68.54%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMK 2039
            I +W +FS  +   +D+  +L++L+ SIA  TYLV + L+ AD  ++  +++   F   L A  +P +V R+Y+ +     I+ +L       K   VK      KE+      + ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQ+Y   + G LIMRFDDTNPAKET EFE +IL D++ L +  D F+++S++FDL++ YC  LIK   AY D+T   QMK ERE++  S  R+ +VE+NL  W  M  G+E+G +YC+R K+DM+S NGCMRDPTIYRCK E H RTG KYKVYPTYDF CPIVD+IE VTHTLRT+EY+DR++QF+  +D L LRKP I  YSRL + NTVLSKRKLT+ V+ G VDGWDDPR PTVRGI+R GMT+EGLKEF++AQG  ++ V M WDK+WAFNKKVIDPIAPRYTAL    R +V V    ++E ++ SV  HPK+E++G+K+V   P ++++  DA    E  N TFINWGNILI K++K++   ITS+DA LNL ++DFKKT K+TW+ +  +      + P   +++DN+I+K VLGKD+DFK F+   ++ E  ++GD ELK  KKGDIIQLQR+G+F  D  Y      T    P+VL +IP+G++K+  T G+K
Sbjct:   80 IDHWLSFS--LTCEDDISWALSFLDKSIAPVTYLVANKLTIADFALFNEMHSRYEF---LAAKGIPQHVQRWYDLITAQPLIQKVLQSLPEDAK---VKRSPQSSKEQTPAKTGERKQEGKFVDLPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQYYALAFQGTLIMRFDDTNPAKETVEFENVILGDLEQLQIKPDVFTHTSNYFDLMLDYCVRLIKESKAYVDDTPPEQMKLEREQRVESANRSNSVEKNLSLWEEMVKGSEKGQKYCVRAKIDMSSPNGCMRDPTIYRCKNEPHPRTGTKYKVYPTYDFACPIVDAIENVTHTLRTTEYHDRDDQFYWFIDALKLRKPYIWSYSRLNMTNTVLSKRKLTWFVDSGLVDGWDDPRFPTVRGIIRRGMTVEGLKEFIIAQGSSKSVVFMNWDKIWAFNKKVIDPIAPRYTALEKEKRVIVNVAGA-KVERIQVSV--HPKDESLGKKTVLLGPRIYIDYVDAEALKEGENATFINWGNILIRKVNKDASGNITSVDAALNLENKDFKKTLKLTWLAVEDD---PSAYPPTFCVYFDNIISKAVLGKDEDFKQFIGHKTRDEVPMLGDPELKKCKKGDIIQLQRRGFFKVDVAYAPPSGYTNVPSPIVLFSIPDGHTKDVPTSGLK 723          

HSP 2 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 288/520 (55.38%), Postives = 375/520 (72.12%), Query Frame = 3
Query: 2208 KTVENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQ-EFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLG--DKCINSECSMKPKYFTMFGRSY 3758
            K V+ +  A     +KK TRLGLE +KEDN  +WY QVITKGE+I+YYD+ GCYIL   +  IW+ I+   +  I   GVK C FP F+SK+ L KEK HIADF+PEVAWVT +GD +L EPIA+RPTSET MYP Y+K ++S+RDLP++ NQW +VVRWEFK P PFLR+REFLWQEGHTA+++K +A +EV  ILDLYA VY  LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I +E  + +Q ++V+QNSWG+TTRTIG+++MVH D++GLVLPP VA  Q ++VPCG+T+   + E   +++ C+ L  RL    +R   D   + SPG+KFN+WELKGVP+R+E+GPK+L    +V   R    K +I    +E+ +   LE IHE+M  KA+ ++ +H        D    L +K ++ APFCG+ +CED+IK  SA     E GAP+MGAKSLCIPF+QP  +   DKCIN  C+ KPK++T+FGRSY
Sbjct: 1195 KPVKKEPAADASGAVKKQTRLGLEATKEDNLPDWYSQVITKGEMIEYYDVSGCYILRQWSFAIWKAIKTWFDAEITRMGVKECYFPIFVSKAVLEKEKTHIADFAPEVAWVTKSGDSDLAEPIAVRPTSETVMYPAYAKWVQSYRDLPIRLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAFADKEEAAKEVLDILDLYALVYTHLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVYEDPETQQKKYVYQNSWGITTRTIGVMIMVHADNQGLVLPPHVACIQAIVVPCGITVNTKDDERAQLLDACKALEKRLVGGGVRCEGDYRDNYSPGWKFNHWELKGVPLRLEVGPKDLKAQQLVAVRRDTVEKITIPLADVEKKIPALLETIHESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAEPGAPAMGAKSLCIPFDQPAPIAASDKCINPSCTNKPKFYTLFGRSY 1714          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Fly
Match: GluProRS (gene:FBgn0005674 transcript:FBtr0084512)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 288/520 (55.38%), Postives = 375/520 (72.12%), Query Frame = 3
Query: 2208 KTVENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQ-EFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLG--DKCINSECSMKPKYFTMFGRSY 3758
            K V+ +  A     +KK TRLGLE +KEDN  +WY QVITKGE+I+YYD+ GCYIL   +  IW+ I+   +  I   GVK C FP F+SK+ L KEK HIADF+PEVAWVT +GD +L EPIA+RPTSET MYP Y+K ++S+RDLP++ NQW +VVRWEFK P PFLR+REFLWQEGHTA+++K +A +EV  ILDLYA VY  LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I +E  + +Q ++V+QNSWG+TTRTIG+++MVH D++GLVLPP VA  Q ++VPCG+T+   + E   +++ C+ L  RL    +R   D   + SPG+KFN+WELKGVP+R+E+GPK+L    +V   R    K +I    +E+ +   LE IHE+M  KA+ ++ +H        D    L +K ++ APFCG+ +CED+IK  SA     E GAP+MGAKSLCIPF+QP  +   DKCIN  C+ KPK++T+FGRSY
Sbjct:  477 KPVKKEPAADASGAVKKQTRLGLEATKEDNLPDWYSQVITKGEMIEYYDVSGCYILRQWSFAIWKAIKTWFDAEITRMGVKECYFPIFVSKAVLEKEKTHIADFAPEVAWVTKSGDSDLAEPIAVRPTSETVMYPAYAKWVQSYRDLPIRLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAFADKEEAAKEVLDILDLYALVYTHLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVYEDPETQQKKYVYQNSWGITTRTIGVMIMVHADNQGLVLPPHVACIQAIVVPCGITVNTKDDERAQLLDACKALEKRLVGGGVRCEGDYRDNYSPGWKFNHWELKGVPLRLEVGPKDLKAQQLVAVRRDTVEKITIPLADVEKKIPALLETIHESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAEPGAPAMGAKSLCIPFDQPAPIAASDKCINPSCTNKPKFYTLFGRSY 996          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Fly
Match: GlnRS (gene:FBgn0027090 transcript:FBtr0084866)

HSP 1 Score: 187.963 bits (476), Expect = 8.383e-49
Identity = 121/365 (33.15%), Postives = 185/365 (50.68%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNG-TEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDD 1547
            G V  RFPPE +G LHIGHAKA  IN  Y   + G   +R+DDTNP KE E+F   I E V+ LG      +YSSD+F  L ++   LI    AY  +  A ++K    +   S  R + +EE+L+ +  MK G  +EG      ++M +    G M DP  YR K   H RTG  + +YPTYD+T  + DS+E +TH+L T E+  R   ++ + + L +  P   +Y RL +   ++SKRK+  ++ E  V  WDDPR+ T+  + R G   E +  F    G   A + ++   L A  + V++  APR   +    +  V ++       V+  V   P+N   G   +     +++E+ D
Sbjct:  265 GKVHTRFPPEPNGILHIGHAKAININFGYAAAHDGVCYLRYDDTNPEKEEEKFFLAIKEMVEWLGYKPFKITYSSDNFQQLYEWAVVLINKGLAYVCHQKAEELKGFNPKP--SPWRERPIEESLRLFEDMKRGKIDEG---AATLRMKVTLEEGKM-DPVAYRIKFISHHRTGSDWCIYPTYDYTHCLCDSLEDITHSLCTKEFQSRRSSYYWLCNALGIYCPVQWEYGRLNMNYALVSKRKIAKLITEQIVHDWDDPRLFTLTALRRRGFPAEAINNFCAQMGVTGAQIAVDPAMLEAAVRDVLNVTAPRRLVVLEPLK--VTIKNFPHAAPVQLEVPDFPQNPQQGTHKITLDKVIYIEQGD 621          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Fly
Match: GluRS-m (gene:FBgn0036629 transcript:FBtr0075411)

HSP 1 Score: 71.633 bits (174), Expect = 2.775e-12
Identity = 69/279 (24.73%), Postives = 109/279 (39.07%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFS---------YSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTIS--------KCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKM-----------------DMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLA-LQNTVLSKRK 1181
            +   V VRF P  +GYLH+G  + AL N  Y  H  GK ++R +DT+  +      + ++ED+   G+  D              S   ++  K  EEL+ +  AY       ++   R+E   +        KCR+ T  E     +L+  GT     YCIR K+                 +++ N G   DP +             K   +PTY F   + D + G+TH LR  E+     +   +      + P+      L     T LSKR+
Sbjct:   17 AHSQVRVRFAPSPTGYLHLGGLRTALYNFLYARHLGGKFLLRIEDTDQTRLVPGASERLVEDLLWAGIEIDEGPGFGGQLGPYVQSQRTEIYSKAIEELLHNGTAYRCFCTERRLDLLRKEALRTRQVPRYDNKCRHLTTSE---VDSLLAKGTP----YCIRFKLTDHEEPLDDLIYGKVHHNVSDNEG---DPVV------------MKSDQFPTYHFANVVDDHLMGITHVLRGVEWQISTTKHLLLYKAFGWQPPKFGHLPLLVNADGTKLSKRQ 273          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-638])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 347/677 (51.26%), Postives = 466/677 (68.83%), Query Frame = 3
Query:   42 LMDQASILILNWKNFS-KNILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQT---LDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKP 2060
            +M+Q  +   +W  FS + +   +DL  +L  L+ ++A RT+LV  S++ AD  I+  L  N   Q   K  S P ++ R+++ L +      + +    K S+ K  +V+ +K              ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF  +++  E+L++   AY D+T    MK+ERE++  S+ RN +VE+N++ W  MK GTE G   C+R K+DMNSNNGC+RDP ++RCK   H RTG  YKVYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ +++ L LRKP I +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT++GLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APR+TAL  S    V+   V + +     V +HPKN ++G K VW+ P VF+E  DA  F E   VTFINWGNI+ITKIH++S   I S+D  LNL + D+KKT K+TW  L  + R    F+P   + Y +LITK VLGKDDDFK+++N++SK EE +IGD  LK+LKKGDIIQLQR+G++ICD+ Y+     + ++ P VL+ IP+G++KE  T G K KS+++P
Sbjct:   71 MMEQTEVD--HWLEFSARRLCGQSDLSSALADLDKALALRTFLVGRSVTLADLCIWAALKGNGESQ--AKPSSHP-HLCRWFSFLSSQVPFSSVGSKWASKVSASKAASVEKDKK-------------QDLGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIKPDQFTYTSDHFPTILRMGEKLLQEGKAYIDDTPPDIMKQEREQRAESRNRNNSVEKNMQMWEEMKKGTEFGQTCCMRAKIDMNSNNGCLRDPALFRCKNAAHPRTGTTYKVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVIEALGLRKPYIWEYARLNLNNTVLSKRKLTWFVDKGYVDGWDDPRFPTVRGVLRRGMTVDGLKQFIAAQGGSRSVVNMEWDKIWAFNKKVIDPVAPRFTALLSSQ---VIPVCVSEAKETMKEVPKHPKNADVGLKQVWYGPKVFIEGADAETFTEGEIVTFINWGNIIITKIHRDSSGAILSLDGHLNLENTDYKKTTKITW--LAESSRAS--FVPTVCVNYQHLITKPVLGKDDDFKDYINKNSKIEEKMIGDPCLKDLKKGDIIQLQRRGFYICDQPYEPISPHSCRESPCVLLYIPDGHTKEMPTAGSKDKSKSQP 722          

HSP 2 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 290/506 (57.31%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IW+ I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA VYE+L+AIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFS+MF+I FE   + G+++  +QNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QV+I+PCG+T    E E + ++++C K   RL+ A+IRV ADL  + SPG+KFN+WELKGVPIR E+GPK+L     V   R  G K ++ +   E+ +   LE I   +F +A ++L+ H  VA TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF+   NL  G  C++ +     +Y+T+FGRSY
Sbjct: 1180 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWDAIKEFFDREIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVLQILDLYARVYEELMAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSRMFEIVFEDPKKPGEKQLAYQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACLQVIIIPCGITATLPEAEKDLLLDQCSKYLSRLQKADIRVKADLRDNYSPGWKFNHWELKGVPIRFEVGPKDLKQGQFVAVRRDTGEKITVKEADAEKKIPNLLEEIQNNLFKRASDDLNKHMVVADTMEQFQKDLDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFKPLKNLQAGQMCVSGKEPA--QYYTLFGRSY 1683          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-638])

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 346/677 (51.11%), Postives = 465/677 (68.69%), Query Frame = 3
Query:   42 LMDQASILILNWKNFS-KNILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQT---LDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKP 2060
            +M+Q  +   +W  FS + +   +DL  +L  L+ ++A RT+LV  S++ AD  I+  L  N   Q   K  S P ++ R+++ L +      + +    K S+ K  +V+ +K              ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF  +++  E+L++   AY D+T    MK+ERE++  S+ RN +VE+N++ W  MK GTE G   C+R K+DMNSNNGC+RDP ++RCK   H RTG  YKVYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ +++ L LRKP I +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT++GLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APR+TAL  S    V+   V + +     V +HPKN ++G K VW+ P VF+E  DA  F E   VTFINWGNI+ITKIH++S   I S+D  LNL + D+KKT K+TW+   S       F+P   + Y +LITK VLGKDDDFK+++N++SK EE +IGD  LK+LKKGDIIQLQR+G++ICD+ Y+     + ++ P VL+ IP+G++KE  T G K KS+++P
Sbjct:   71 MMEQTEVD--HWLEFSARRLCGQSDLSSALADLDKALALRTFLVGRSVTLADLCIWAALKGNGESQ--AKPSSHP-HLCRWFSFLSSQVPFSSVGSKWASKVSASKAASVEKDKK-------------QDLGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIKPDQFTYTSDHFPTILRMGEKLLQEGKAYIDDTPPDIMKQEREQRAESRNRNNSVEKNMQMWEEMKKGTEFGQTCCMRAKIDMNSNNGCLRDPALFRCKNAAHPRTGTTYKVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVIEALGLRKPYIWEYARLNLNNTVLSKRKLTWFVDKGYVDGWDDPRFPTVRGVLRRGMTVDGLKQFIAAQGGSRSVVNMEWDKIWAFNKKVIDPVAPRFTALLSSQ---VIPVCVSEAKETMKEVPKHPKNADVGLKQVWYGPKVFIEGADAETFTEGEIVTFINWGNIIITKIHRDSSGAILSLDGHLNLENTDYKKTTKITWLAESSRAS----FVPTVCVNYQHLITKPVLGKDDDFKDYINKNSKIEEKMIGDPCLKDLKKGDIIQLQRRGFYICDQPYEPISPHSCRESPCVLLYIPDGHTKEMPTAGSKDKSKSQP 722          

HSP 2 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 290/506 (57.31%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IW+ I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA VYE+L+AIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFS+MF+I FE   + G+++  +QNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QV+I+PCG+T    E E + ++++C K   RL+ A+IRV ADL  + SPG+KFN+WELKGVPIR E+GPK+L     V   R  G K ++ +   E+ +   LE I   +F +A ++L+ H  VA TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF+   NL  G  C++ +     +Y+T+FGRSY
Sbjct: 1095 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWDAIKEFFDREIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVLQILDLYARVYEELMAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSRMFEIVFEDPKKPGEKQLAYQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACLQVIIIPCGITATLPEAEKDLLLDQCSKYLSRLQKADIRVKADLRDNYSPGWKFNHWELKGVPIRFEVGPKDLKQGQFVAVRRDTGEKITVKEADAEKKIPNLLEEIQNNLFKRASDDLNKHMVVADTMEQFQKDLDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFKPLKNLQAGQMCVSGKEPA--QYYTLFGRSY 1598          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1011])

HSP 1 Score: 194.897 bits (494), Expect = 7.091e-51
Identity = 129/365 (35.34%), Postives = 188/365 (51.51%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTA-LSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDD 1547
            G V  RFPPE +G LHIGHAKA   N  +     G   +R+DDTNP KE E++   I + V+ LG      +++SD+F  L     +LI+  +AY  +    ++K        S  R + VEE+L  +  M+ G     +  +R+KM M   +G M DP  YR K   H RTG  + +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L  TV+SKRK+  +V  G V  WDDPR+ T+  + R G   + +  F    G   A   ME   L A  ++V++  APR  A L     +++ +    Q E+    V   P NE  G   V F+ T+F+E+ D
Sbjct:  261 GQVRTRFPPEPNGILHIGHAKAINFNFGFAKANNGICFLRYDDTNPEKEEEKYFTAIKDMVEWLGYEPYAVTHASDNFQRLYNLAVDLIRRGHAYVCHQRGEELKGHNVPS--SPWRERPVEESLVLFEHMRKGMFAEGEATLRMKMVME--DGKM-DPVAYRIKYTPHHRTGDTWCIYPTYDYTHCLCDSIENITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLTYTVVSKRKIIKLVETGVVRDWDDPRLFTLTALRRRGFPPQAINNFCARVGVTVAQTTMEPHLLEACVREVLNDTAPRAMAILEPLKVTIINLPTNAQKEL---RVPDFPANEARGSHVVPFSKTIFIEQSD 617          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1011])

HSP 1 Score: 96.6709 bits (239), Expect = 3.145e-20
Identity = 66/186 (35.48%), Postives = 95/186 (51.08%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTC 1013
            G V  RFPPE +G LHIGHAKA   N  +     G   +R+DDTNP KE E++   I + V+ LG      +++SD+F  L     +LI+  +AY  +    ++K        S  R + VEE+L  +  M+ G     +  +R+KM M   +G M DP  YR K   H RTG  +++   YD T 
Sbjct:  261 GQVRTRFPPEPNGILHIGHAKAINFNFGFAKANNGICFLRYDDTNPEKEEEKYFTAIKDMVEWLGYEPYAVTHASDNFQRLYNLAVDLIRRGHAYVCHQRGEELKGHNVPS--SPWRERPVEESLVLFEHMRKGMFAEGEATLRMKMVM--EDGKM-DPVAYRIKYTPHHRTGDTWRIQERYDQTS 441          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1011])

HSP 1 Score: 55.0694 bits (131), Expect = 1.324e-7
Identity = 28/61 (45.90%), Postives = 38/61 (62.30%), Query Frame = 3
Query:  888 IKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYN 1070
            +K +M   +G M DP  YR K   H RTG  + +YPTYD+T  + DSIE +TH+L T E+ 
Sbjct:  164 VKNEMVMEDGKM-DPVAYRIKYTPHHRTGDTWCIYPTYDYTHCLCDSIENITHSLCTKEFQ 223          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Match: slc12a9 (solute carrier family 12, member 9 [Source:Xenbase;Acc:XB-GENE-5943241])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 356/666 (53.45%), Postives = 467/666 (70.12%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYSALLKSQ--AVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 764          

HSP 2 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1194 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1708          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Match: slc12a9 (solute carrier family 12, member 9 [Source:Xenbase;Acc:XB-GENE-5943241])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 356/666 (53.45%), Postives = 467/666 (70.12%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYSALLKSQ--AVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 764          

HSP 2 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1119 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1633          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Match: slc12a9 (solute carrier family 12, member 9 [Source:Xenbase;Acc:XB-GENE-5943241])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 356/666 (53.45%), Postives = 467/666 (70.12%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYSALLKSQ--AVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 764          

HSP 2 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1152 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1666          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Match: slc12a9 (solute carrier family 12, member 9 [Source:Xenbase;Acc:XB-GENE-5943241])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 356/673 (52.90%), Postives = 467/673 (69.39%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFN-------KKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFN       KKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKLRAICKKVIDPVAPRYSALLKS--QAVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 771          

HSP 2 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1201 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1715          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Match: slc12a9 (solute carrier family 12, member 9 [Source:Xenbase;Acc:XB-GENE-5943241])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 356/673 (52.90%), Postives = 467/673 (69.39%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFN-------KKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFN       KKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKLRAICKKVIDPVAPRYSALLKS--QAVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 771          

HSP 2 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1201 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1715          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Match: Eprs (glutamyl-prolyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:97838])

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 360/665 (54.14%), Postives = 476/665 (71.58%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D L  ++N LN  ++ RTYLV +SL+ AD  ++ TL  +  +Q  LK +   ++V R++  L+     +++ T  + SG + TV  +K              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++T SK R  +VE+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + +V V ++D  E +++ V RHPKN ++G K VW++P VF+E  DA  F+E   VTFINWGNI ITKIHKN++  ITS+DAKLNL ++D+KKT K+TW+     +      IP   + Y++LITK VLGKD+DFK ++N+DSK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + ++ P +LI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDRLTSAINELNHCLSLRTYLVGNSLTLADLCVWATLKGSAAWQEHLKQNKTLVHVKRWFGFLEAQQAFRSVGTKWDVSGNRATVAPDKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRTESKHRKNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVVPVNVLDAQEEMKE-VARHPKNPDVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNINITKIHKNADGKITSLDAKLNLENKDYKKTTKITWL----AESTHALSIPAVCVTYEHLITKPVLGKDEDFKQYINKDSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCREAPCILIYIPDGHTKEMPTSGSKEKTKVE 722          

HSP 2 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 290/507 (57.20%), Postives = 373/507 (73.57%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N +EWY QVITK E+I+YYD+ GCYIL P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK+HI DF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP++ NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A +EV QIL+LYA VYE+LLAIPVV+GRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKM +I FE     G+++F +Q SWG+TTRTIG++VMVHGD+ GLVLPPRVA  QVV++PCG+T   +E++ EA+M KC +   RL  A IRV  DL  + SPG+KFN+WELKGVP+R+E+GP+++ +   V   R  G K +I ++  E  +E+ LE I   +F +A  +L  H  V+ T+ED    L+   +   PFCG+  CED IK ++A +  VE GAPSMGAKSLCIPF   C L  G  C+   C   P K++T+FGRSY
Sbjct: 1009 KKQTRLGLEAKKEENLAEWYSQVITKSEMIEYYDVSGCYILRPWSYSIWESIKDFFDAEIKKLGVENCYFPIFVSQAALEKEKNHIEDFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPVRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAADEVLQILELYARVYEELLAIPVVRGRKTEKEKFAGGDYTTTIEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPKTPGEKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDREALMAKCNEYRRRLLGANIRVRVDLRDNYSPGWKFNHWELKGVPVRLEVGPRDMKSCQFVAVRRDTGEKLTIAEKEAEAKLEKVLEDIQLNLFTRASEDLKTHMVVSNTLEDFQKVLDAGKVAQIPFCGEIDCEDWIKKMTARDQDVEPGAPSMGAKSLCIPFNPLCELQPGAMCV---CGKNPAKFYTLFGRSY 1512          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Match: Qars (glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1915851])

HSP 1 Score: 205.297 bits (521), Expect = 2.125e-54
Identity = 161/527 (30.55%), Postives = 245/527 (46.49%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVD--------FAENTNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDS-KREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKE-----NCSITGKQYP 1979
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  LG +    +Y+SD+FD L  +  ELI    AY  +    ++K        S  R++  EE+L  +  M+ G     +  +R+K+ M   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   A   ME   L A  + V++  APR  A++  +   V++      + ++  V   P +E  G   V F  TVF+ER D  +         A    V   + G ++ +  I + S   +  ++     +D   K    + W+  PL    R+ +         + +   ++ +     F + LN  S +  E  + D  +   K  D  Q +R GYF  D +  +     N ++T K+ P
Sbjct:  236 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYASDYFDQLYAWAVELIHGGLAYVCHQRVEELKGH--NPLPSPWRDRPKEESLLLFEAMRKGKFAEGEATLRMKLVME--DGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDAAPR--AMAVLEPLQVVITNFPAPKPLDIRVPNFPADETKGFHQVPFASTVFIERSDFKEESEPGYKRLASGQPVGLRHTGYVIELQNIVRGSSGCVERLEVTCRRADAGEKPKAFIHWVSQPLVCEIRLYE-------CLFQHKNPEDPVEVPGGFLSDLNPASLQVVEGALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGQIVFNRTVTLKEDP 748          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Match: Qars (glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1915851])

HSP 1 Score: 204.912 bits (520), Expect = 3.406e-54
Identity = 161/527 (30.55%), Postives = 245/527 (46.49%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVD--------FAENTNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDS-KREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKE-----NCSITGKQYP 1979
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  LG +    +Y+SD+FD L  +  ELI    AY  +    ++K        S  R++  EE+L  +  M+ G     +  +R+K+ M   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   A   ME   L A  + V++  APR  A++  +   V++      + ++  V   P +E  G   V F  TVF+ER D  +         A    V   + G ++ +  I + S   +  ++     +D   K    + W+  PL    R+ +         + +   ++ +     F + LN  S +  E  + D  +   K  D  Q +R GYF  D +  +     N ++T K+ P
Sbjct:  260 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYASDYFDQLYAWAVELIHGGLAYVCHQRVEELKGH--NPLPSPWRDRPKEESLLLFEAMRKGKFAEGEATLRMKLVME--DGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDAAPR--AMAVLEPLQVVITNFPAPKPLDIRVPNFPADETKGFHQVPFASTVFIERSDFKEESEPGYKRLASGQPVGLRHTGYVIELQNIVRGSSGCVERLEVTCRRADAGEKPKAFIHWVSQPLVCEIRLYE-------CLFQHKNPEDPVEVPGGFLSDLNPASLQVVEGALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGQIVFNRTVTLKEDP 772          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Match: Qars (glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1915851])

HSP 1 Score: 102.064 bits (253), Expect = 1.455e-24
Identity = 54/133 (40.60%), Postives = 75/133 (56.39%), Query Frame = 3
Query:  894 MDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEF 1292
            M +   +G M DP  YR K   H RTG K+ +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L   V+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F
Sbjct:    2 MKLVMEDGKM-DPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLFTLTALRRRGFPPEAINNF 133          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Match: Qars (glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1915851])

HSP 1 Score: 60.077 bits (144), Expect = 3.333e-10
Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSL 647
            G V  RFPPE +G LHIGHAKA   N  Y     G   +RFDDTNP KE  +F   I + V  L
Sbjct:   52 GQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVIHL 115          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q8CGC7|SYEP_MOUSE (Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus OX=10090 GN=Eprs1 PE=1 SV=4)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 360/665 (54.14%), Postives = 476/665 (71.58%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D L  ++N LN  ++ RTYLV +SL+ AD  ++ TL  +  +Q  LK +   ++V R++  L+     +++ T  + SG + TV  +K              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++T SK R  +VE+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + +V V ++D  E +++ V RHPKN ++G K VW++P VF+E  DA  F+E   VTFINWGNI ITKIHKN++  ITS+DAKLNL ++D+KKT K+TW+     +      IP   + Y++LITK VLGKD+DFK ++N+DSK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + ++ P +LI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDRLTSAINELNHCLSLRTYLVGNSLTLADLCVWATLKGSAAWQEHLKQNKTLVHVKRWFGFLEAQQAFRSVGTKWDVSGNRATVAPDKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRTESKHRKNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVVPVNVLDAQEEMKE-VARHPKNPDVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNINITKIHKNADGKITSLDAKLNLENKDYKKTTKITWL----AESTHALSIPAVCVTYEHLITKPVLGKDEDFKQYINKDSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCREAPCILIYIPDGHTKEMPTSGSKEKTKVE 722          

HSP 2 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 290/507 (57.20%), Postives = 373/507 (73.57%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N +EWY QVITK E+I+YYD+ GCYIL P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK+HI DF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP++ NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A +EV QIL+LYA VYE+LLAIPVV+GRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKM +I FE     G+++F +Q SWG+TTRTIG++VMVHGD+ GLVLPPRVA  QVV++PCG+T   +E++ EA+M KC +   RL  A IRV  DL  + SPG+KFN+WELKGVP+R+E+GP+++ +   V   R  G K +I ++  E  +E+ LE I   +F +A  +L  H  V+ T+ED    L+   +   PFCG+  CED IK ++A +  VE GAPSMGAKSLCIPF   C L  G  C+   C   P K++T+FGRSY
Sbjct: 1009 KKQTRLGLEAKKEENLAEWYSQVITKSEMIEYYDVSGCYILRPWSYSIWESIKDFFDAEIKKLGVENCYFPIFVSQAALEKEKNHIEDFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPVRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAADEVLQILELYARVYEELLAIPVVRGRKTEKEKFAGGDYTTTIEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPKTPGEKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDREALMAKCNEYRRRLLGANIRVRVDLRDNYSPGWKFNHWELKGVPVRLEVGPRDMKSCQFVAVRRDTGEKLTIAEKEAEAKLEKVLEDIQLNLFTRASEDLKTHMVVSNTLEDFQKVLDAGKVAQIPFCGEIDCEDWIKKMTARDQDVEPGAPSMGAKSLCIPFNPLCELQPGAMCV---CGKNPAKFYTLFGRSY 1512          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q7SIA2|SYEP_CRIGR (Bifunctional glutamate/proline--tRNA ligase OS=Cricetulus griseus OX=10029 GN=EPRS1 PE=1 SV=3)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 358/666 (53.75%), Postives = 470/666 (70.57%), Query Frame = 3
Query:   66 ILNWKNFSKNILKN-NDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKP 2060
            I +W  FS   L +   L  +L  LN  ++ RTYLV +SL+ AD  ++ TL  N  +Q  L+ +   ++V R++  L+     +++ T  + S  K  V  +K              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++  SK R  +VE+NL+ W  MK G+  G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + +V V + +  E +++ V RHPKN ++G K VW++P VF+E  DA  F+E   VTFINWGNI ITKIHKN++  ITS+DAKLNL ++D+KKT K+TW+     +      IP   + Y++LITK VLGKD+DFK ++N+DSK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + K+ P +LI IP+G++KE  T G K+K++ +P
Sbjct:   78 IDHWLEFSATKLSSCAALTSALTELNHCLSLRTYLVGNSLTLADLCVWATLKGNAAWQEQLEQNKTLVHVKRWFGFLEAQQAFRSVGTKWDVSENKARVVPDKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRAESKHRQNSVEKNLQMWEEMKKGSPFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVVPVNVPEAQEEMKE-VARHPKNPDVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNINITKIHKNADGKITSLDAKLNLENKDYKKTTKITWL----AETTHALPIPAICVTYEHLITKPVLGKDEDFKQYVNKDSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCILIYIPDGHTKEMPTSGSKEKTKAEP 723          

HSP 2 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 290/507 (57.20%), Postives = 371/507 (73.18%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N +EWY QVITK E+I+YYD+ GCYIL P +  IWE I++  +T I+  GV+ C FP F+S+++L KEK HI DF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP++ NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A +EV QIL+LYA VYE+LLAIPVV+GRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKM +I FE     G+++F FQ SWG+TTRTIG+++MVHGD+ GLVLPPRVA  QVV++PCG+T   +E++ EA+M KC +   RL    IRV  DL  + SPG+KFN+WELKGVP+R+E+GP+++ +   V   R  G K +I ++  E  ++E LE I   +F +A  +L  H  V+ T+ED    L+   +   PFCG+  CED IK  +A +  VE GAPSMGAKSLCIPF   C L  G  C+   C   P K++T+FGRSY
Sbjct: 1008 KKQTRLGLEAKKEENLAEWYSQVITKSEMIEYYDVSGCYILRPWSYSIWESIKDFFDTEIKKLGVENCYFPIFVSQAALEKEKSHIEDFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAADEVMQILELYARVYEELLAIPVVRGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPKTPGEKQFAFQCSWGLTTRTIGVMIMVHGDNMGLVLPPRVACVQVVVIPCGITNALSEEDREALMAKCNEYRKRLLGVNIRVRVDLRDNYSPGWKFNHWELKGVPVRLEVGPRDMKSCQFVAVRRDTGEKLTIAEKEAESKLQEILEDIQLNLFTRASEDLKTHMVVSNTLEDFQKVLDSGKIAQIPFCGEIDCEDWIKKTTARDQDVEPGAPSMGAKSLCIPFTPLCELQPGAMCV---CGKNPAKFYTLFGRSY 1511          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Match: sp|P07814|SYEP_HUMAN (Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 358/665 (53.83%), Postives = 469/665 (70.53%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D    ++N LN  ++ RTYLV +SLS AD  ++ TL  N  +Q  LK    P++V R++  L+     +++ T  + S  K  V  EK              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++  SK R   +E+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + ++ V + +  E +++ V +HPKN  +G K VW++P VF+E  DA  F+E   VTFINWGN+ ITKIHKN++  I S+DAKLNL ++D+KKT KVTW+     +      IPV  + Y++LITK VLGKD+DFK ++N++SK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + K+ P VLI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVIPVNVPEAQEEMKE-VAKHPKNPEVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWL----AETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVE 722          

HSP 2 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 296/507 (58.38%), Postives = 372/507 (73.37%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRD--GKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+Y+DI GCYIL P    IWE I++  +  I+  GV+ C FP F+S+S+L KEK H+ADF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A EEV QILDLYA VYE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQG TSHHLGQNFSKMF+I FE     G+++F +QNSWG+TTRTIG++ MVHGD+ GLVLPPRVA  QVVI+PCG+T   +E++ EA++ KC     RL +  IRV ADL  + SPG+KFN+WELKGVPIR+E+GP+++ +   V   R  G K ++ +   E  ++  LE I   +F +A  +L  H  VA TMED    L+   ++  PFCG+  CED IK  +A +  +E GAPSMGAKSLCIPF+  C L  G KC+   C   P KY+T+FGRSY
Sbjct: 1009 KKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCV---CGKNPAKYYTLFGRSY 1512          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Match: sp|P28668|SYEP_DROME (Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GluProRS PE=1 SV=2)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 335/658 (50.91%), Postives = 451/658 (68.54%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMK 2039
            I +W +FS  +   +D+  +L++L+ SIA  TYLV + L+ AD  ++  +++   F   L A  +P +V R+Y+ +     I+ +L       K   VK      KE+      + ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQ+Y   + G LIMRFDDTNPAKET EFE +IL D++ L +  D F+++S++FDL++ YC  LIK   AY D+T   QMK ERE++  S  R+ +VE+NL  W  M  G+E+G +YC+R K+DM+S NGCMRDPTIYRCK E H RTG KYKVYPTYDF CPIVD+IE VTHTLRT+EY+DR++QF+  +D L LRKP I  YSRL + NTVLSKRKLT+ V+ G VDGWDDPR PTVRGI+R GMT+EGLKEF++AQG  ++ V M WDK+WAFNKKVIDPIAPRYTAL    R +V V    ++E ++ SV  HPK+E++G+K+V   P ++++  DA    E  N TFINWGNILI K++K++   ITS+DA LNL ++DFKKT K+TW+ +  +      + P   +++DN+I+K VLGKD+DFK F+   ++ E  ++GD ELK  KKGDIIQLQR+G+F  D  Y      T    P+VL +IP+G++K+  T G+K
Sbjct:   80 IDHWLSFS--LTCEDDISWALSFLDKSIAPVTYLVANKLTIADFALFNEMHSRYEF---LAAKGIPQHVQRWYDLITAQPLIQKVLQSLPEDAK---VKRSPQSSKEQTPAKTGERKQEGKFVDLPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQYYALAFQGTLIMRFDDTNPAKETVEFENVILGDLEQLQIKPDVFTHTSNYFDLMLDYCVRLIKESKAYVDDTPPEQMKLEREQRVESANRSNSVEKNLSLWEEMVKGSEKGQKYCVRAKIDMSSPNGCMRDPTIYRCKNEPHPRTGTKYKVYPTYDFACPIVDAIENVTHTLRTTEYHDRDDQFYWFIDALKLRKPYIWSYSRLNMTNTVLSKRKLTWFVDSGLVDGWDDPRFPTVRGIIRRGMTVEGLKEFIIAQGSSKSVVFMNWDKIWAFNKKVIDPIAPRYTALEKEKRVIVNVAGA-KVERIQVSV--HPKDESLGKKTVLLGPRIYIDYVDAEALKEGENATFINWGNILIRKVNKDASGNITSVDAALNLENKDFKKTLKLTWLAVEDD---PSAYPPTFCVYFDNIISKAVLGKDEDFKQFIGHKTRDEVPMLGDPELKKCKKGDIIQLQRRGFFKVDVAYAPPSGYTNVPSPIVLFSIPDGHTKDVPTSGLK 723          

HSP 2 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 288/520 (55.38%), Postives = 375/520 (72.12%), Query Frame = 3
Query: 2208 KTVENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQ-EFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLG--DKCINSECSMKPKYFTMFGRSY 3758
            K V+ +  A     +KK TRLGLE +KEDN  +WY QVITKGE+I+YYD+ GCYIL   +  IW+ I+   +  I   GVK C FP F+SK+ L KEK HIADF+PEVAWVT +GD +L EPIA+RPTSET MYP Y+K ++S+RDLP++ NQW +VVRWEFK P PFLR+REFLWQEGHTA+++K +A +EV  ILDLYA VY  LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I +E  + +Q ++V+QNSWG+TTRTIG+++MVH D++GLVLPP VA  Q ++VPCG+T+   + E   +++ C+ L  RL    +R   D   + SPG+KFN+WELKGVP+R+E+GPK+L    +V   R    K +I    +E+ +   LE IHE+M  KA+ ++ +H        D    L +K ++ APFCG+ +CED+IK  SA     E GAP+MGAKSLCIPF+QP  +   DKCIN  C+ KPK++T+FGRSY
Sbjct: 1195 KPVKKEPAADASGAVKKQTRLGLEATKEDNLPDWYSQVITKGEMIEYYDVSGCYILRQWSFAIWKAIKTWFDAEITRMGVKECYFPIFVSKAVLEKEKTHIADFAPEVAWVTKSGDSDLAEPIAVRPTSETVMYPAYAKWVQSYRDLPIRLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAFADKEEAAKEVLDILDLYALVYTHLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVYEDPETQQKKYVYQNSWGITTRTIGVMIMVHADNQGLVLPPHVACIQAIVVPCGITVNTKDDERAQLLDACKALEKRLVGGGVRCEGDYRDNYSPGWKFNHWELKGVPLRLEVGPKDLKAQQLVAVRRDTVEKITIPLADVEKKIPALLETIHESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAEPGAPAMGAKSLCIPFDQPAPIAASDKCINPSCTNKPKFYTLFGRSY 1714          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Match: sp|P38708|YHI0_YEAST (Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR020W PE=1 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 276/512 (53.91%), Postives = 355/512 (69.34%), Query Frame = 3
Query: 2250 LKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFES---RDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEG-----APSMGAKSLCIPFEQPC-NLGDKCINSECSMKPKYFTMFGRSY 3758
            L+    +G+ V K  +F  WY Q++TKGE++DYYD+ GCYIL P +  IWE IQ   +  I+A GV+   FP F+S   L KEKDH+  F+PEVAWVT AG   LEEPIAIRPTSET MYP+Y+K ++S+RDLPLK NQW SVVRWEFKHP PFLR+REFLWQEGHTA+    DA EEV QILD YA VYE+LLA+PVVKGRKTEKEKFAG DFTTT E YI  +GR IQGATSHHLGQNFSKMF++  E+    D  + F +QNSWG++TR IG++VM+H D++GLV+PPRV++ Q V++P G+T K +E++ + + E  + +  RLK   IR + D + + +PG+KF+ +ELKG+PIRIE+GPK++  N VV+  R +  K  +  + LE  + E LE +   +F KAK   D HR +       +  LN+K +I AP+CG   CE+ IK  SA +   EE      APSMGAKSLCIPF+QP  N G KCI  +C      + MFGRSY
Sbjct:  179 LEDAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRPTSETVMYPYYAKWVQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTAKDAEEEVLQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFSKMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQFQSVVIPVGITKKTSEEQRKHIHETARSVESRLKKVGIRAFGDYNDNYTPGWKFSQYELKGIPIRIELGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPEILEEMQGDLFKKAKELFDTHRVIVNEWSGFVPALNKKNVILAPWCGVMECEEDIKESSAKKDDGEEFEEDDKAPSMGAKSLCIPFDQPVLNEGQKCI--KCERIAVNYCMFGRSY 688          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Match: J9JM24 (E3 ubiquitin-protein ligase OS=Acyrthosiphon pisum OX=7029 PE=3 SV=2)

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 568/1179 (48.18%), Postives = 755/1179 (64.04%), Query Frame = 3
Query:  414 EEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEE-LIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSL------RKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTA--LSGSDRSLVLVRIVDQLEIVE--------DSVGRHPKNENIGQKS-VWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKN-SENVITSIDAKLNLSDRDFKKTQKVTWMP---LGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREEC-LIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQNENKTVENQSEASKKTELKKVTRLGLEVSK-EDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAK--GVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDG-KQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLK---------------------TAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIM----------DERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKI-VSAGEAVVEEGAPSMGAKSLCIPFEQP-----CNLGDKCINSECSMKPKYFTMFGRSY 3758
            ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + G+LI+RFDDTNPAKE E+FEK+ILED+  L +  D F+Y+SDHFD ++  CE  ++K   AY D+T+  +++ ERE+K  S  RN ++E+NL+ W  M  GTE GL+ C+R K+DM S NGC+RDPTIYRCKPE H RTG KYKVYPTYDF CPIVDS EGVTH LRT+EY DR+ Q++   D L L       +P +  YSRL + NTVLSKRKLT+ V +G+VDGWDDPRMPTVRG+ R GM +E LK+F++AQG  R    M+WDK+W+ N+ ++D IAPR+TA  LS S++   ++       +VE        D+V +HPKN  +G K+ VW  P + ++  DA         TFINWGN+LI +I +N + N I  I A  +L + DFK T KVTW+P      ++ +    +P+  +++D+LI+K VL KDDDFK +LN ++ R E  +IGD ELK+LKKGD+IQLQR+GYFICD  Y+     +GK+  LVL NIP+G+ K   T+ +   +                                            +K   + EN  V   S  + K    KVT+LGLEV K  +N  EWY QV+ KGE+I+YYD+ GCY+L P    IWE IQ   +  I+ K   ++ C FP F+S+ +L +EK+HIADF+PEVAWVT +G+ +L EPIAIRPTSET MYP ++K I+S+RDLPLK NQW SVVRWEFKHP PFLR+REFLWQEGH AY+ + +A  +V   L  Y  VY+++LA+PV+KG+KTEKEKFAG  FTTT E Y+ SSGRAIQGATSH+LG NF+KMFD+ FE  D  K+ FV Q S+GMTTRTIG++VMVHGDDRGLVLPPR+A  QV+IVPCG+ +K + +  + +   C  + +RLK                     +  IR   DL  + SPG+KFN+WELKGVP+R+E+GPK+L+ N ++   R NG K +I           ++++   + E L  I + M+ KA+ E+  +  +     +    L  K L+  PFCG   CED IK   +  +   + GA +MGAKSLC+PFEQP         D+CI+ +C      FT+FGRSY
Sbjct:    9 KQQGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQLAFNGRLILRFDDTNPAKEKEDFEKVILEDIDMLKIKPDTFTYTSDHFDQMLDICENGMLKEGLAYVDDTNGDEIRLEREKKIESINRNNSIEKNLELWKQMVLGTEIGLKCCVRAKIDMQSANGCLRDPTIYRCKPEHHPRTGDKYKVYPTYDFACPIVDSFEGVTHCLRTTEYTDRDAQYYWFCDALKLGTRSNETRPYVWSYSRLNMTNTVLSKRKLTWFVEQGHVDGWDDPRMPTVRGVFRRGMQVEALKQFIVAQGSSRTVTAMQWDKIWSLNRSIVDSIAPRHTALLLSNSNKENAVLSYPPVEVVVENVEKPYKIDNVPKHPKNVQLGLKNCVWAAPKILIDYSDAELLEAGRRATFINWGNLLINRIERNQNNNNIERIYAVSDLENTDFKSTVKVTWLPKIDYSESEEVLPILVPIVCVYFDHLISKAVLAKDDDFKQYLNTENSRWELQMIGDSELKDLKKGDVIQLQRRGYFICDSTYQPYSIHSGKEMSLVLFNIPDGHRKSITTIPLPISTSN----------------------------------------IKDKKLKKKENIAVATDSSINAK----KVTKLGLEVQKVSENLGEWYSQVLVKGEMIEYYDVSGCYVLRPWAYRIWELIQEWFDARIKRKPLNIQNCYFPMFVSQGALEREKEHIADFAPEVAWVTKSGETDLAEPIAIRPTSETGMYPAFAKWIQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHNAYATREEAERDVLITLGYYEYVYKNMLAVPVIKGKKTEKEKFAGGIFTTTCEAYVASSGRAIQGATSHYLGTNFAKMFDVHFEHPDTHKKSFVHQISFGMTTRTIGVMVMVHGDDRGLVLPPRIASIQVIIVPCGVGVKTSNEVKDNLTRTCLDVCNRLKGDSLIESDDENDNSVIQHRNSSLIIRADTDLRDNYSPGWKFNHWELKGVPLRLEIGPKDLSRNQIIAVRRDNGDKLTIPLEGRPKDDGGNDKMVIRITELLNQIQQDMYNKAEQEMKENVVICRKWSECAAHLAAKHLLLIPFCGRPICEDNIKQDTTLDDGTADLGASTMGAKSLCVPFEQPKGADILKSNDQCIHPKCGHPAGSFTLFGRSY 1143          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Match: A0A0C2N0W9 (Bifunctional glutamate/proline--tRNA ligase OS=Thelohanellus kitauei OX=669202 GN=RF11_09824 PE=3 SV=1)

HSP 1 Score: 1057.74 bits (2734), Expect = 0.000e+0
Identity = 549/1125 (48.80%), Postives = 738/1125 (65.60%), Query Frame = 3
Query:  411 FEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQNENKTVENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE-SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAG--EAVVEEG----APSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
             E+GG+FV L    KG+VVVRFPPEASGYLHIGHAKAAL+NQ Y+D Y GKLI+RFDDTNP KE   FE+IILEDVK L L+ D +S +SD+FD L+ Y E +IK   AY DNT   +M++ R +K  S  R+ +V+ NL  W  +K G E    +C+R K+D  S NGC+RDPTIYR  P+ H  +G KY VYPTYDF CPIVDSIEGVTH LRTSEY+DR+ Q+   LD L+LRKP I +YSRL+ Q TVLSKRKLT +V+   VDGWDDPRMPT+RG++R G+T+  LKEF+LAQGF ++ V M+ DKLWAFNK+ ++PI+PR   L G D  LV   I   +      +   PK+E  G ++++F   + +E  D+    +   VT INWGN  +     + E     I   L   + D+  T K++W  L +   +E+  IP+  + Y NL+ K+VL  +DDF+ ++N++SK     +G+    NLK+G+I+Q+ RKG++  D ++       GK   L L+ +P G    +           KP+ +      K+ K  K       +++  K  +    + K+ K+   +  + +  + +  KKT+L      GL VSKE +FS+WY +VITK ELIDYY I GCY++ P    IWE +Q   +  ++  G++ C FP F+ +S+L KEKDHI DF+PEVAWVT AG  +L EPIAIRPTSET +YP  +K I+SHRDLPLK NQWC+VVRWEFKHP PF+R+REFLWQEGHT Y+++ DAV+EV+QILDLY  +Y +LLAIPVVKG K+E EKFAGA+FTTT E YI + GR +QGATSHHLGQNFSKMFDI FE S   +++FVFQNS+G++TR +G LVMVHGDD+GLVLPPRVA  QVVI+PCG++   TE+    + E  Q LA  LK  ++RV+ D   + +PG+K+N+WE+KGVP+R+E+GPK+L+ +TV +  R  G K S+  E   + + E LE I  +M+ KA  +L  +  +    +  IN LN K +I +PFCGDK CE+ ++  S    E V E+G      SMGAK+LCIP  QP  L  G+KCI   C    K + +FGRS+
Sbjct:  169 LEDGGRFVELPGAVKGSVVVRFPPEASGYLHIGHAKAALLNQFYRDRYEGKLILRFDDTNPVKEKCHFEEIILEDVKLLELTPDMYSKTSDYFDSLLNYAEVMIKRGLAYCDNTPTDEMRQLRTQKAPSMYRDTSVDMNLARWEQLKAGKET--DWCLRAKIDYASENGCLRDPTIYRYCPDPHPTSGQKYHVYPTYDFACPIVDSIEGVTHALRTSEYHDRDPQYLWFLDQLTLRKPVIFEYSRLSFQYTVLSKRKLTKVVDSHIVDGWDDPRMPTIRGLIRRGLTLGALKEFILAQGFSKSVVNMQTDKLWAFNKRFLEPISPRLIGLIGDD--LVKAEITSDIPNTSKEISLVPKDETKGGRTIYFGRHILIEGSDSRLLKDGDIVTLINWGNAKVNIAADSKE-----IQLVLMPKNNDYSNTLKISW--LNNESDVEN--IPLQIVTYQNLLNKSVLTPEDDFELYINKNSKSVTKGVGEPYFMNLKRGNIVQIMRKGFYRVDNDF-------GKDKILFLVELPSGTENIK-----------KPDVNVVKKTEKEVKKEKNANVHSKDSREVKKTEKTKSSNKTTKIADVSSGQKLACKPDKMKKTKL------GLSVSKEIDFSQWYTEVITKSELIDYYTISGCYVIRPHAFSIWEAVQTFFDAEMKKLGIQNCYFPIFVPESALTKEKDHINDFAPEVAWVTRAGSTDLAEPIAIRPTSETVIYPTIAKWIQSHRDLPLKLNQWCNVVRWEFKHPTPFIRTREFLWQEGHTVYADREDAVKEVYQILDLYERIYTELLAIPVVKGTKSEAEKFAGAEFTTTVEGYISACGRGLQGATSHHLGQNFSKMFDIGFEDSATCERKFVFQNSFGISTRVVGALVMVHGDDKGLVLPPRVAPIQVVIIPCGISATTTEEMKLKIYEFSQSLALNLKKRDVRVFLDNRENVTPGWKYNHWEMKGVPLRVEVGPKDLSTSTVTIARRDTGEKTSVSIEIFGKSISETLEQIQISMYGKALQDLSNNTVICEDWDSFINNLNSKKVIYSPFCGDKLCEEEVRKTSTSTHEEVNEKGETVTVVSMGAKTLCIPSFQPKKLQPGEKCIRKNCKNDAKCYALFGRSF 1256          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Match: B9EIU1 (Glutamyl-prolyl-tRNA synthetase OS=Mus musculus OX=10090 GN=Eprs PE=2 SV=1)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 360/665 (54.14%), Postives = 476/665 (71.58%), Query Frame = 3
Query:   66 ILNWKNFSKNILKNND-LKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            I +W  FS   L + D L  ++N LN  ++ RTYLV +SL+ AD  ++ TL  +  +Q  LK +   ++V R++  L+     +++ T  + SG + TV  +K              ++ GKFV L     G V VRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF+ ++KY E+LI+   AY D+T A QMK ERE++T SK R  +VE+NL+ W  MK G++ G   C+R K+DM+SNNGCMRDPT+YRCK + H RTG KY VYPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ I++ L +RKP I +YSRL L NTVLSKRKLT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY AL    + +V V ++D  E +++ V RHPKN ++G K VW++P VF+E  DA  F+E   VTFINWGNI ITKIHKN++  ITS+DAKLNL ++D+KKT K+TW+     +      IP   + Y++LITK VLGKD+DFK ++N+DSK EE ++GD  LK+LKKGDIIQLQR+G+FICD+ Y+     + ++ P +LI IP+G++KE  T G K+K++ +
Sbjct:   78 IDHWLEFSATKLSSCDGLTSAINELNHCLSLRTYLVGNSLTLADLCVWATLKGSAAWQEHLKQNKTLVHVKRWFGFLEAQQAFRSVGTKWDVSGSRATVAPDKK-------------QDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMKAEREQRTESKHRKNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVAL--LKKEVVPVNVLDAQEEMKE-VARHPKNPDVGLKPVWYSPKVFIEGADAETFSEGEMVTFINWGNINITKIHKNADGKITSLDAKLNLENKDYKKTTKITWL----AESTHALPIPAVCVTYEHLITKPVLGKDEDFKQYINKDSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCREAPCILIYIPDGHTKEMPTSGSKEKTKVE 722          

HSP 2 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 290/507 (57.20%), Postives = 373/507 (73.57%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKP-KYFTMFGRSY 3758
            KK TRLGLE  KE+N +EWY QVITK E+I+YYD+ GCYIL P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK+HI DF+PEVAWVT +G   L EPIAIRPTSET MYP Y+K ++SHRDLP++ NQWC+VVRWEFKHP PFLR+REFLWQEGH+A++   +A +EV QIL+LYA VYE+LLAIPVV+GRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKM +I FE     G+++F +Q SWG+TTRTIG++VMVHGD+ GLVLPPRVA  QVV++PCG+T   +E++ EA+M KC +   RL  A IRV  DL  + SPG+KFN+WELKGVP+R+E+GP+++ +   V   R  G K +I ++  E  +E+ LE I   +F +A  +L  H  V+ T+ED    L+   +   PFCG+  CED IK ++A +  VE GAPSMGAKSLCIPF   C L  G  C+   C   P K++T+FGRSY
Sbjct: 1009 KKQTRLGLEAKKEENLAEWYSQVITKSEMIEYYDVSGCYILRPWSYSIWESIKDFFDAEIKKLGVENCYFPIFVSQAALEKEKNHIEDFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPVRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAADEVLQILELYARVYEELLAIPVVRGRKTEKEKFAGGDYTTTIEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPKTPGEKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDREALMAKCNEYRRRLLGANIRVRVDLRDNYSPGWKFNHWELKGVPVRLEVGPRDMKSCQFVAVRRDTGEKLTIAEKEAEAKLEKVLEDIQLNLFTRASEDLKTHMVVSNTLEDFQKVLDAGKVAQIPFCGEIDCEDWIKKMTARDQDVEPGAPSMGAKSLCIPFNPLCELQPGAMCV---CGKNPAKFYTLFGRSY 1512          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Match: A0A5G3KY01 (Solute carrier family 12, member 9 OS=Xenopus tropicalis OX=8364 GN=slc12a9 PE=3 SV=1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 356/666 (53.45%), Postives = 467/666 (70.12%), Query Frame = 3
Query:   66 ILNWKNFSKN-ILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLE-IVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            + +W  FS+  +++  +    L  LN  ++ RTYLV ++L+ AD  ++  L  +  +Q L++    P+NV R+Y+ L+      +   +K  S KK                     ++ GKFV L     G V+VRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHFD ++KY E+LI+   AY D+T A QMK ERE++  SK R+ TV +N++ W  MK GTE G   C+R K+DMNSNNGCMRDPT++RCK + H RTG KY +YPTYDF CPIVDS+EGVTH LRT+EY+DR+EQF+ I+D L +RKP I +YSRL L NTVLSKR+LT+ VNEG VDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APRY+AL  S    V V I D  E +VE  V +HPKN  +GQK VW+ P V +E  DA   +E   VTFINWGN++ITKIH++    I S+DAKLNL ++D+KKT K+TW+     +  +  FIP S + YD+LITK VLGK++DFK ++NR SK+EE ++GD  LK+LKKGD+IQLQR+G++ICDE Y+     + K+ P VLI IP+G++KE  T G K+KS+T+
Sbjct:  128 VSHWMEFSQTKLMQKGEFSTGLQELNHCLSLRTYLVGNALTLADICVFSALEASSEWQALVQKGQTPVNVRRWYSFLEPQLGFWSRTNNKVPSEKK---------------------QDVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVSMLQIKPDQFTYTSDHFDTIMKYAEKLIQEGKAYVDDTPAEQMKSEREQRIESKHRSNTVAKNMEMWEDMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLFRCKNQPHPRTGSKYNIYPTYDFACPIVDSVEGVTHALRTTEYHDRDEQFYWIIDALGIRKPYIWEYSRLNLNNTVLSKRRLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYSALLKSQ--AVAVNIPDAKEGMVE--VAKHPKNAEVGQKPVWYGPKVLIEGADAETLSEGETVTFINWGNLIITKIHRDQSGKIQSLDAKLNLENKDYKKTTKITWL----AETPKAPFIPTSCVNYDHLITKPVLGKEEDFKQYVNRSSKQEEVMLGDPCLKDLKKGDLIQLQRRGFYICDEPYEPISPHSCKEAPCVLIYIPDGHTKEMPTSGSKEKSKTE 764          

HSP 2 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 288/517 (55.71%), Postives = 379/517 (73.31%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            + S A +    KK TRLGLE  KE+N  +WY QVITK E+I+YYD+ GCY+L P    IWE I+   +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++   +A EEV QILDLYA VYEDLLAIPVVKGRKTEKEKFAG D+TTT E +I +S RAIQGATSHHLGQNFSKMF+I FE     G +++ +QNSWG++TRTIG + MVH D+ G+VLPPRVA  QV+I+PCG+T   +E++ +A+++KC +   RL   ++R  AD+  + SPG+KFN+WELKGVPIR+E+GP+++ N   V   R NG K++I +++ E  ++E LE IH  ++ +A ++L ++  VA TMED    L +  ++  PFCG+  CED IK V+A +  +E GAPSMGAKSLCIPF+    L    KC+  + +   K++T+FGRSY
Sbjct: 1194 DNSAAGESQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASSRAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLSTRTIGAMTMVHADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTNLYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECEDWIKKVTARDQDLEPGAPSMGAKSLCIPFKPLSELQPSAKCVCEKNAA--KFYTLFGRSY 1708          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Match: A0A4E0RXE3 (Glutamyl tRNA synthetase cytoplasmic OS=Fasciola hepatica OX=6192 GN=D915_002574 PE=3 SV=1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 363/693 (52.38%), Postives = 466/693 (67.24%), Query Frame = 3
Query:   57 SILILNWKNFSKNILKNNDLKV-SLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKAD--SVP--LNVLRYYNHLQTLDEIKTI---LTHKNSSGKKDXXXX-------XXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTAL----------SGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGN-SKERATVGMKQKSQTK 2057
            S+ +LNW  F    L N+  +  ++  L  S+AH T+LV D  S AD  +   L  +E FQ L+ ++  + P    V RYYNHL +++++K +   L+ +     K    +        ++    +   ++++FE GGKF  L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+D + G+LI+RFDDTNP+KE   FE+ IL D+  +G+ +D  S++SDHFDLLI  CE++++   AY DNTD   M+ ERE +  S CR  T ++NL +W  MK GTE GL+ C+R K+DMNSNNG MRDPTIYRCKPE HVRTG KY VYP YDF CP+VDS+EGVTH LRTSEYNDRN+Q+     +L LR P + DYSRLALQNT+LSKRKLT+ V EG VDGWDDPRMPTV GILR GMT EGL++F+LAQG  R++  MEWDK+WAFNKKVIDPIAPR+T L            +   LV VRI  Q EI E SV  HPKNE++G + +  +P V+VE  DA  F E  NVTFINWGN  I KIH+ SE  IT++D +LNL D D+KKT K+TW+P    +       PV+ + YD+L+TK +LGKD+DFK ++NR+SK E+CL+GD +L+NLKKG+IIQLQR+GY+I D  Y+  C  TG + P VLI IPEG  SK          SQ K
Sbjct:   37 SVHVLNWVRFVPAYLMNSKKRSWAMEQLEKSLAHATFLVGDDFSVADLAVLCFLECDEEFQKLVVSEEWNSPKFCQVRRYYNHLSSMEQLKELKAKLSERPKLAVKPAEALEGTCGDNAEADISGKTVAADMRFEMGGKFGELPGAKVGEVVVRFPPEASGYLHIGHAKAALLNQHYRDTFKGRLILRFDDTNPSKEKANFEESILCDLPRIGVKWDVRSHTSDHFDLLINLCEQMLREGKAYVDNTDTETMRTERENRKPSACRENTTQQNLAWWEEMKKGTEFGLKCCVRAKIDMNSNNGAMRDPTIYRCKPESHVRTGTKYNVYPIYDFACPVVDSVEGVTHALRTSEYNDRNDQYAWFCQVLGLRCPMVIDYSRLALQNTILSKRKLTWFVEEGLVDGWDDPRMPTVSGILRRGMTAEGLRQFILAQGSSRSSAQMEWDKIWAFNKKVIDPIAPRFTGLLLDPSVPQPSPSTPIGLVPVRIHGQSEIQEKSVAVHPKNESLGHRKIMVSPLVYVEHADATCFKEGENVTFINWGNCRIVKIHR-SEAYITAVDGELNLQDTDYKKTLKITWLP--ELEGKSPALCPVTCLIYDHLLTKGILGKDEDFKPYVNRNSKVEQCLLGDPDLRNLKKGEIIQLQRRGYYIVDVPYEAKCKATGFESPCVLIQIPEGTMSKTTTDTAGSATSQAK 726          

HSP 2 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 291/526 (55.32%), Postives = 380/526 (72.24%), Query Frame = 3
Query: 2220 NQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESR-DGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLK--TAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCN---------LGDKCINS-ECSMKPKYFTMFGRSY 3758
            +Q E SKK   KK TRL LE +KE  FSEWY Q+ITK EL++YYDI GCYI+ P    +W+ IQ  ++  + A GV+   FP F+SK +L +EK+H++DF+PEVAWVT +GD +L EP+A+RPTSET MYP ++K I+SHRDLPL+ NQW +VVRWEFKHP PFLR+REFLWQEGHTAY+ K DA  EV  IL+LYA VY+DLLA+PV+KGRKTE+EKFAGAD+TTT E YI  +GRAIQGATSHHLGQNFS+MF++ ++    GK  FV+QNSWG+TTRT+G+LVMVHGD +GLVLPPR+A HQ+V+VPCG+T K+++++ E ++     +   LK  +++ RV+ D   H SPG+KFN+WE+KGVP+R+E+GP+E+A  +  L  R+NG+K ++    +   + + LE IH  +F KA  EL AH     +++ L + L+ K L  APFCGD  CE+ I+  SA   VVE GAPSMGAKSLCIPF  P N          G KC N   CS     +T+FGRSY
Sbjct:  838 DQVELSKKEGAKKQTRLALEATKESEFSEWYSQLITKAELLEYYDISGCYIIRPWAYSLWQTIQRFLDERLHAMGVENAYFPMFVSKGALEREKNHVSDFAPEVAWVTKSGDSDLAEPVAVRPTSETIMYPAFAKWIQSHRDLPLRLNQWSNVVRWEFKHPQPFLRTREFLWQEGHTAYAEKPDAEAEVLAILNLYAQVYQDLLAVPVIKGRKTEREKFAGADYTTTIEAYISGTGRAIQGATSHHLGQNFSRMFEVTYDHPVTGKPAFVYQNSWGLTTRTLGVLVMVHGDSKGLVLPPRIAPHQIVVVPCGITNKSSQEDRENLLSYALLVTRTLKKDSSQFRVHCDDRTHVSPGWKFNHWEMKGVPVRLEVGPQEMAKQSTCLVLRHNGIKLTVPLADICARMPQILEDIHNDLFRKATGELAAHVVQVGSLDQLCSALDAKSLALAPFCGDSDCEEIIRRESARNVVVEPGAPSMGAKSLCIPFSCPFNDKLVCGSPAAGTKCFNQPHCSRVATAYTLFGRSY 1363          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103039312])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 338/678 (49.85%), Postives = 458/678 (67.55%), Query Frame = 3
Query:   42 LMDQASILILNWKNFSKNILKNN-DLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTI-------LTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQ 2051
            +M+Q  +   +W  FS   L     L  +   L+ ++A RT+LV   L+ AD  ++  L  +  +Q          +V R+Y+ L +      +       +T   +SG+K+                    ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF  + +  E+L++   AY D+T    MK+ERE++  S+ RN +VE+N++ W  MK G+E G   C+R K+DM SNNGCMRDPT+YRCK   H RTG  YK+YPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ +++ L LRKP I +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APR++AL    + +V + I +  E ++++  +HPKN ++G KSVW+ P VFVE  DA  F E   VTFINWGNI+I+KI+K+S   ITS++ +LNL + D+KKT K+TW+     D  +   IP   + Y +LI+K VL KDD+FK+F+N+ SK EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VL+ IP+G++KE  T G K KS+
Sbjct:   71 MMEQTEVD--HWLEFSARRLSGQTGLAPAFGELDAALALRTFLVGRGLTLADLCVWAALKGSGEWQAAQAKPGAFPHVSRWYSFLSSQVPFSEVGSKWASKVTASQTSGEKEKS------------------KDVGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIKPDQFTYTSDHFPTIQRLAEQLLQEGKAYIDDTPPDVMKQEREQRVESRHRNNSVEKNMQMWEEMKAGSEYGQTCCMRAKIDMGSNNGCMRDPTLYRCKNAPHPRTGSTYKIYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVINALRLRKPYIWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWAFNKKVIDPVAPRFSAL--LKQQVVPISIPEAKEEMKEA-AKHPKNADVGMKSVWYGPKVFVEGADAETFTEGETVTFINWGNIIISKINKDSSGAITSLEGRLNLENTDYKKTTKITWL----TDTPKAPLIPTVCVTYQHLISKPVLSKDDNFKDFINKQSKTEEMMLGDPCLKDLKKGDIIQLQRRGFYICDQPYEPISPHSCKESPCVLLYIPDGHTKEMPTAGSKDKSK 721          

HSP 2 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 289/506 (57.11%), Postives = 371/506 (73.32%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KEDN ++WY QVITK E+I+YYD+ GCY+L P    IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA VYE+L+AIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   + G+++F +QNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QV+++PCG+T    E E + ++++C K   RL+  ++RV ADL  + SPG+KFN+WELKGVPIR+E+GPK+L     V   R  G K  +    +E  +++ LE I E +F +A  +L  H   A TM+     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF+    L  G  CI+ +     +++T+FGRSY
Sbjct: 1085 KKQTRLGLEAKKEDNLADWYSQVITKSEMIEYYDVSGCYVLRPWAFSIWESIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKSHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATKEEAAEEVLQILDLYARVYEELMAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIIFEDPKKPGEKQFAYQNSWGLTTRTIGVLTMVHGDNMGLVLPPRVACLQVIVIPCGITASLPESEKDLLLDQCSKYLSRLQKIDVRVKADLRDNYSPGWKFNHWELKGVPIRLEVGPKDLKQGQCVAVRRDTGEKLVLPGGTVETRIKQLLEDIQENLFKRASADLKEHMVAADTMDQFQKDLDQGKIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFQPLKTLKEGQMCISGKEPA--QFYTLFGRSY 1588          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103039312])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 338/679 (49.78%), Postives = 460/679 (67.75%), Query Frame = 3
Query:   42 LMDQASILILNWKNFSKNILKNN-DLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQT---LDEIKT-----ILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQ 2051
            +M+Q  +   +W  FS   L     L  +   L+ ++A RT+LV   L+ AD  ++  L  +  +Q          +V R+Y+ L +     E+ +     +   + +SG+K+                    ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF  + +  E+L++   AY D+T    MK+ERE++  S+ RN +VE+N++ W  MK G+E G   C+R K+DM SNNGCMRDPT+YRCK   H RTG  YK+YPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ +++ L LRKP I +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFNKKVIDP+APR++AL    + +V + I +  E ++++  +HPKN ++G KSVW+ P VFVE  DA  F E   VTFINWGNI+I+KI+K+S   ITS++ +LNL + D+KKT K+TW+     D  +   IP   + Y +LI+K VL KDD+FK+F+N+ SK EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VL+ IP+G++KE  T G K KS+
Sbjct:   71 MMEQTEVD--HWLEFSARRLSGQTGLAPAFGELDAALALRTFLVGRGLTLADLCVWAALKGSGEWQAAQAKPGAFPHVSRWYSFLSSQVPFSEVGSKWASKVTASQTASGEKEKS------------------KDVGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIKPDQFTYTSDHFPTIQRLAEQLLQEGKAYIDDTPPDVMKQEREQRVESRHRNNSVEKNMQMWEEMKAGSEYGQTCCMRAKIDMGSNNGCMRDPTLYRCKNAPHPRTGSTYKIYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVINALRLRKPYIWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWAFNKKVIDPVAPRFSAL--LKQQVVPISIPEAKEEMKEA-AKHPKNADVGMKSVWYGPKVFVEGADAETFTEGETVTFINWGNIIISKINKDSSGAITSLEGRLNLENTDYKKTTKITWL----TDTPKAPLIPTVCVTYQHLISKPVLSKDDNFKDFINKQSKTEEMMLGDPCLKDLKKGDIIQLQRRGFYICDQPYEPISPHSCKESPCVLLYIPDGHTKEMPTAGSKDKSK 722          

HSP 2 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 289/506 (57.11%), Postives = 371/506 (73.32%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KEDN ++WY QVITK E+I+YYD+ GCY+L P    IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA VYE+L+AIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   + G+++F +QNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QV+++PCG+T    E E + ++++C K   RL+  ++RV ADL  + SPG+KFN+WELKGVPIR+E+GPK+L     V   R  G K  +    +E  +++ LE I E +F +A  +L  H   A TM+     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF+    L  G  CI+ +     +++T+FGRSY
Sbjct: 1174 KKQTRLGLEAKKEDNLADWYSQVITKSEMIEYYDVSGCYVLRPWAFSIWESIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKSHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATKEEAAEEVLQILDLYARVYEELMAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIIFEDPKKPGEKQFAYQNSWGLTTRTIGVLTMVHGDNMGLVLPPRVACLQVIVIPCGITASLPESEKDLLLDQCSKYLSRLQKIDVRVKADLRDNYSPGWKFNHWELKGVPIRLEVGPKDLKQGQCVAVRRDTGEKLVLPGGTVETRIKQLLEDIQENLFKRASADLKEHMVAADTMDQFQKDLDQGKIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFQPLKTLKEGQMCISGKEPA--QFYTLFGRSY 1677          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103039312])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 338/686 (49.27%), Postives = 460/686 (67.06%), Query Frame = 3
Query:   42 LMDQASILILNWKNFSKNILKNN-DLKVSLNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQT---LDEIKT-----ILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFN-------KKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQ 2051
            +M+Q  +   +W  FS   L     L  +   L+ ++A RT+LV   L+ AD  ++  L  +  +Q          +V R+Y+ L +     E+ +     +   + +SG+K+                    ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+ ++ GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+Y+SDHF  + +  E+L++   AY D+T    MK+ERE++  S+ RN +VE+N++ W  MK G+E G   C+R K+DM SNNGCMRDPT+YRCK   H RTG  YK+YPTYDF CPIVDSIEGVTH LRT+EY+DR+EQF+ +++ L LRKP I +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+WAFN       KKVIDP+APR++AL    + +V + I +  E ++++  +HPKN ++G KSVW+ P VFVE  DA  F E   VTFINWGNI+I+KI+K+S   ITS++ +LNL + D+KKT K+TW+     D  +   IP   + Y +LI+K VL KDD+FK+F+N+ SK EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VL+ IP+G++KE  T G K KS+
Sbjct:   71 MMEQTEVD--HWLEFSARRLSGQTGLAPAFGELDAALALRTFLVGRGLTLADLCVWAALKGSGEWQAAQAKPGAFPHVSRWYSFLSSQVPFSEVGSKWASKVTASQTASGEKEKS------------------KDVGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIKPDQFTYTSDHFPTIQRLAEQLLQEGKAYIDDTPPDVMKQEREQRVESRHRNNSVEKNMQMWEEMKAGSEYGQTCCMRAKIDMGSNNGCMRDPTLYRCKNAPHPRTGSTYKIYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVINALRLRKPYIWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWAFNKKLPVSCKKVIDPVAPRFSAL--LKQQVVPISIPEAKEEMKEA-AKHPKNADVGMKSVWYGPKVFVEGADAETFTEGETVTFINWGNIIISKINKDSSGAITSLEGRLNLENTDYKKTTKITWL----TDTPKAPLIPTVCVTYQHLISKPVLSKDDNFKDFINKQSKTEEMMLGDPCLKDLKKGDIIQLQRRGFYICDQPYEPISPHSCKESPCVLLYIPDGHTKEMPTAGSKDKSK 729          

HSP 2 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 289/506 (57.11%), Postives = 371/506 (73.32%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KEDN ++WY QVITK E+I+YYD+ GCY+L P    IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC+VVRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA VYE+L+AIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   + G+++F +QNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QV+++PCG+T    E E + ++++C K   RL+  ++RV ADL  + SPG+KFN+WELKGVPIR+E+GPK+L     V   R  G K  +    +E  +++ LE I E +F +A  +L  H   A TM+     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF+    L  G  CI+ +     +++T+FGRSY
Sbjct: 1181 KKQTRLGLEAKKEDNLADWYSQVITKSEMIEYYDVSGCYVLRPWAFSIWESIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKSHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATKEEAAEEVLQILDLYARVYEELMAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIIFEDPKKPGEKQFAYQNSWGLTTRTIGVLTMVHGDNMGLVLPPRVACLQVIVIPCGITASLPESEKDLLLDQCSKYLSRLQKIDVRVKADLRDNYSPGWKFNHWELKGVPIRLEVGPKDLKQGQCVAVRRDTGEKLVLPGGTVETRIKQLLEDIQENLFKRASADLKEHMVAADTMDQFQKDLDQGKIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFQPLKTLKEGQMCISGKEPA--QFYTLFGRSY 1684          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103042996])

HSP 1 Score: 202.216 bits (513), Expect = 1.731e-53
Identity = 157/513 (30.60%), Postives = 245/513 (47.76%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAE--------NTNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNL-ITKNVLGKDDDFKNFL---NRDS-KREECLIGDVELKNLKKGDIIQLQRKGYFICDEE 1940
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +R+DDTNP KE E++   I + V+ LG +    +++SD+F  L +   ELI+  +AY  +    ++K        S  R++ +EE+L  +  MKNG     +  +R+KM M   +G M DP  YR K   H R+G  + +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L  TV+SKRK+  +V  G V  WDDPR+ T+  + R G   + +  F    G   A   ME   L A  ++V++  APR  A+    +  V +  +      E  +   P +E  G   V F+ T+++E+ D  +  E        + +V   + G I+ + ++ K+    +  ++     SD   K    + W+  PL    R+           Y+ L + KN     +    FL   N +S +  E  + D  +   K  D  Q +R GYF  D +
Sbjct:  239 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRYDDTNPEKEEEKYFTAIKDMVEWLGYTPYAITHASDNFQCLYELAVELIRRGHAYICHQRGEELKGHNAPP--SPWRDRPIEESLVLFERMKNGMFAEGEATLRMKMVME--DGKM-DPVAYRIKYTPHHRSGDAWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLTYTVVSKRKIIKLVETGTVRDWDDPRLFTLTALRRRGFPPQAINNFCARVGVTVAQTTMEPHLLEACVREVLNDTAPRIMAVLEPLK--VTITNLPANAQTEVRIPDFPADETKGSHVVPFSKTIYIEQSDFREVMEKGYKRLTPDQSVGLRHAGYIISVQRVIKDGSGKVVELEVTCATSDSAEKPKAFIHWVSQPLKCEVRL-----------YERLFLHKNPEDSAEVPGGFLSDINPNSLQVVESALVDRSVSKAKVFDKFQFERVGYFSVDPD 733          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103042996])

HSP 1 Score: 202.216 bits (513), Expect = 2.626e-53
Identity = 157/513 (30.60%), Postives = 245/513 (47.76%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAE--------NTNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNL-ITKNVLGKDDDFKNFL---NRDS-KREECLIGDVELKNLKKGDIIQLQRKGYFICDEE 1940
            + G V  RFPPE +G LHIGHAKA   N  Y     G   +R+DDTNP KE E++   I + V+ LG +    +++SD+F  L +   ELI+  +AY  +    ++K        S  R++ +EE+L  +  MKNG     +  +R+KM M   +G M DP  YR K   H R+G  + +YPTYD+T  + DSIE +TH+L T E+  R   +F + + L +  P   +Y RL L  TV+SKRK+  +V  G V  WDDPR+ T+  + R G   + +  F    G   A   ME   L A  ++V++  APR  A+    +  V +  +      E  +   P +E  G   V F+ T+++E+ D  +  E        + +V   + G I+ + ++ K+    +  ++     SD   K    + W+  PL    R+           Y+ L + KN     +    FL   N +S +  E  + D  +   K  D  Q +R GYF  D +
Sbjct:  260 TGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRYDDTNPEKEEEKYFTAIKDMVEWLGYTPYAITHASDNFQCLYELAVELIRRGHAYICHQRGEELKGHNAPP--SPWRDRPIEESLVLFERMKNGMFAEGEATLRMKMVME--DGKM-DPVAYRIKYTPHHRSGDAWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLTYTVVSKRKIIKLVETGTVRDWDDPRLFTLTALRRRGFPPQAINNFCARVGVTVAQTTMEPHLLEACVREVLNDTAPRIMAVLEPLK--VTITNLPANAQTEVRIPDFPADETKGSHVVPFSKTIYIEQSDFREVMEKGYKRLTPDQSVGLRHAGYIISVQRVIKDGSGKVVELEVTCATSDSAEKPKAFIHWVSQPLKCEVRL-----------YERLFLHKNPEDSAEVPGGFLSDINPNSLQVVESALVDRSVSKAKVFDKFQFERVGYFSVDPD 754          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000156.1 (pep scaffold:Pmarinus_7.0:GL476617:504787:510854:1 gene:ENSPMAG00000000137.1 transcript:ENSPMAT00000000156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 344.354 bits (882), Expect = 8.299e-109
Identity = 163/250 (65.20%), Postives = 193/250 (77.20%), Query Frame = 3
Query: 2196 QNENKTVENQSEASKKTELKK-VTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETA-MYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQ 2939
            + E K  E + +  KK E KK V  LG+EV K +NFSEWY QVITK EL++YYD+ GCYIL P    IWE IQ   N  I   GV+ C FP  +S+++L +EK HIADF+PEVAWVT +G  +L EP+AIRPTSETA MYP ++K ++SHRDLP+K NQWCSVVRWEFKHP PFLR+REFLWQEGHTAY+N  DA  EV QILDLYA VYE LLAIPVV+G+KTEKEKFAGAD+TTT E +I +SGRAIQ
Sbjct:   71 KQEPKKQEPKKQEPKKQEPKKEVLPLGMEVKKLENFSEWYSQVITKSELVEYYDVSGCYILRPWAYSIWEAIQQFFNAEIMKLGVENCYFPMLVSQAALEREKSHIADFAPEVAWVTRSGKTDLAEPVAIRPTSETAVMYPAFAKWVQSHRDLPIKLNQWCSVVRWEFKHPQPFLRTREFLWQEGHTAYANAKDAKIEVRQILDLYADVYEKLLAIPVVRGQKTEKEKFAGADYTTTVEAFISASGRAIQ 320          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000155.1 (pep scaffold:Pmarinus_7.0:GL476617:490058:495926:1 gene:ENSPMAG00000000136.1 transcript:ENSPMAT00000000155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 2.993e-50
Identity = 91/214 (42.52%), Postives = 134/214 (62.62%), Query Frame = 3
Query: 3129 QVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLGDK----CINSECSMKPKYFTMFGRSY 3758
            QVVI+ CG+T+   E E +A+ EKC++   RL+ A +R  AD   + SPG+KFN+WELKGVP+R+E+GP+++ N   V   R +G K    +E+   F++E LE I  +++ KA  +L +H  VA +M +L   +++  +   PFC +  CED IK ++A +A VE GAPSMGAKSLCIPF     + D     C+   C+   K +T+FGRSY
Sbjct:    1 QVVIISCGVTVNLAEGERKALYEKCEEYLRRLRDAGVRARADTRDNYSPGWKFNHWELKGVPVRVELGPRDVRNCEFVAVRRDSGEKLVRKEEQAVDFIKELLENIQSSLYAKASTDLHSHMVVADSMAELQKAIDQGKVAQVPFCLEMDCEDEIKKITARDADVEPGAPSMGAKSLCIPFNPLKKMDDASKPPCVG--CNKPAKAYTLFGRSY 212          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Yeast
Match: YHR020W_mRNA (Prolyl-tRNA synthetase; N-terminal domain shows weak homology to prokaryotic posttransfer editing domain, but does not possess posttransfer editing activity; may interact with ribosomes, based on co-purification experiments [Source:SGD;Acc:S000001062])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 276/512 (53.91%), Postives = 355/512 (69.34%), Query Frame = 3
Query: 2250 LKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFES---RDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEG-----APSMGAKSLCIPFEQPC-NLGDKCINSECSMKPKYFTMFGRSY 3758
            L+    +G+ V K  +F  WY Q++TKGE++DYYD+ GCYIL P +  IWE IQ   +  I+A GV+   FP F+S   L KEKDH+  F+PEVAWVT AG   LEEPIAIRPTSET MYP+Y+K ++S+RDLPLK NQW SVVRWEFKHP PFLR+REFLWQEGHTA+    DA EEV QILD YA VYE+LLA+PVVKGRKTEKEKFAG DFTTT E YI  +GR IQGATSHHLGQNFSKMF++  E+    D  + F +QNSWG++TR IG++VM+H D++GLV+PPRV++ Q V++P G+T K +E++ + + E  + +  RLK   IR + D + + +PG+KF+ +ELKG+PIRIE+GPK++  N VV+  R +  K  +  + LE  + E LE +   +F KAK   D HR +       +  LN+K +I AP+CG   CE+ IK  SA +   EE      APSMGAKSLCIPF+QP  N G KCI  +C      + MFGRSY
Sbjct:  179 LEDAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRPTSETVMYPYYAKWVQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTAKDAEEEVLQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFSKMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQFQSVVIPVGITKKTSEEQRKHIHETARSVESRLKKVGIRAFGDYNDNYTPGWKFSQYELKGIPIRIELGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPEILEEMQGDLFKKAKELFDTHRVIVNEWSGFVPALNKKNVILAPWCGVMECEEDIKESSAKKDDGEEFEEDDKAPSMGAKSLCIPFDQPVLNEGQKCI--KCERIAVNYCMFGRSY 688          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Yeast
Match: GUS1 (Glutamyl-tRNA synthetase (GluRS); forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003214])

HSP 1 Score: 473.396 bits (1217), Expect = 4.861e-152
Identity = 286/666 (42.94%), Postives = 403/666 (60.51%), Query Frame = 3
Query:   66 ILNWKNFSKN--ILKN-NDLKVSLNYLNDSIAHRTYLVND-SLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEI---------KTILTHKNSS--GKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLK-YWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQ-KVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNS 2012
            +  W N ++   ++KN   L  SL  L+  +  RT+++     S AD   +  L +N    +++K + V +NV R+Y  L+ +D I         K++L  K S+  GKK             K T    FE     + L +   G VV RFPPE SGYLHIGHAKAAL+NQ++   Y GKLI+RFDDTNP+KE EEF+  ILED+  LG+  D  +YSSD+F  +  YC ++IK   AY D+T   +M++ER +   S  R+++VEENL+ +   MKNGTEEGL+ C+R K+D  + N  +RDP IYRC    H RTG  +K+YPTYDF  PIVD+IEGVTH LRT EY DRN Q+  +L  L LRK  I D++R+    T+LSKRKL ++V++  V  WDDPR PTVRG+ R GMT+EGL+ FVL+QG  R  + +EW+ +WAFNKKVIDPIAPR+TA+    +  +      Q   +E    +H KN  +G+K V +   + V++DDA     +  VT ++WGN++ITK  KN +    S+ AKLNL + DFKKT+ K+TW+    +       +PV  + +D+LITK+ L +D+ F++FL   ++     I D+ +K++K GDIIQ +RKGY+  D   K+     GK  P V   IP+G S
Sbjct:   75 VAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADVACWGALRSNGMCGSIIK-NKVDVNVSRWYTLLE-MDPIFGEAHDFLSKSLLELKKSANVGKK-------------KETHKANFE-----IDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIE-MKPKHKKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITK--KNDDG---SMVAKLNL-EGDFKKTKHKLTWLADTKD------VVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDMKIGDIIQFERKGYYRLDALPKD-----GK--PYVFFTIPDGKS 700          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Yeast
Match: GLN4 (Glutamine tRNA synthetase; monomeric class I tRNA synthetase that catalyzes the specific glutaminylation of tRNA(Gln); N-terminal domain proposed to be involved in enzyme-tRNA interactions [Source:SGD;Acc:S000005694])

HSP 1 Score: 230.335 bits (586), Expect = 2.282e-63
Identity = 135/392 (34.44%), Postives = 214/392 (54.59%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKERE---------EKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVED----------SVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTN 1574
            G V  RFPPE +GYLHIGH+KA ++N  Y  ++ G   +RFDDTNP KE  E+ + I   V  LG      +YSSD+FD L +  E LIK+  AY  +  A ++K+ R          E+   K R+Q++E+NL+ +  M++G  +  +  +R+K D+NS +  M D   YR     H RTG K+++YPTYDFT  +VDS+E +TH+L T+E+    E +  + D + + +P   +Y RL +  TVLSKRK+  +V+E +V GWDDPR+ T+  I R G+    +  F+   G   +   ++  +  +  +K ++   PR            L+ ++D +E+V D          ++   P     G+++V FT   ++ER    DF+EN +
Sbjct:  250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRMVSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGERYACKHRDQSIEQNLQEFRDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHPRTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAVRKYLEDTTPR------------LMFVLDPVEVVVDNLSDDYEELATIPYRPGTPEFGERTVPFTNKFYIERS---DFSENVD 626          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Yeast
Match: MSE1 (Mitochondrial glutamyl-tRNA synthetase; predicted to be palmitoylated [Source:SGD;Acc:S000005393])

HSP 1 Score: 52.373 bits (124), Expect = 3.998e-7
Identity = 66/299 (22.07%), Postives = 111/299 (37.12%), Query Frame = 3
Query:  462 VVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLI-KYCEELIKSENAYA---------DNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPT---IYRCKPEFHVRTGYKYKVY-----------PTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTV----LSKRKLTF--------------IVNEGYVDGWDDPR 1232
            V  RF P  +G+LH+G  + AL N     +  G+ ++R +DT+  +  E  E+ I E +K   ++YD          L+  KY + L+ S  AY          D   +    K     +  +C     EE +      K+   +G+ + +R K          R PT   +   +     +  +  K Y           PTY     + D + G+TH +R  E+     +   + +      P+   +  + L  TV    LSKRK                 ++N   + GW  PR
Sbjct:   45 VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILKWCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMASYDRCCAHLGEEEI------KSKLAQGIPFTVRFK-------SPERYPTFTDLLHGQINLQPQVNFNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFGWACPK---FIHIPLLTTVGDKKLSKRKGDMSISDLKRQGVLPEALINFCALFGWSPPR 327          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Nematostella
Match: EDO40014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8N2])

HSP 1 Score: 217.624 bits (553), Expect = 7.558e-59
Identity = 157/515 (30.49%), Postives = 247/515 (47.96%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAEN--------TNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLIT-KNVLGKDDDFKNFLNRDSKREECLIG----DVELKNLKKGDIIQLQRKGYFICDEEYKEN 1952
            +KG V  RFPPE +G LHIGHAKA  IN  Y   + G   +R+DDTNP KE E+F   IL+ VK LG      +++SD+FD L +Y  ELIK  +AY  +    ++K        S  R + +EE+L+ +  MK G  +  Q  +R+K  +        DP  YR K   H R+G K+ +YPTYDFT  + DSIE +TH+L T E+  R   ++ + + L +  P   +Y RL L  TV+SKRK+  ++NEG V  WDDPR+ T+  + R G   E + +F    G   A  V++   L A  +  ++  A R  A+    +  +     D+  ++E  V   P + + G   V F   +++E  D  +  E          +V   + G ++ + K+ KN+   ++ ++    L+    K    + W        +    +P     YD L   KN    ++    F++  +K    +I     D+  K        Q +R+GYF  D +  +N
Sbjct:  260 TKGRVQTRFPPEPNGILHIGHAKAININFGYAKAHNGVCYLRYDDTNPEKEEEKFFTGILDMVKWLGFEPWKITHASDNFDKLYEYAVELIKRGDAYVCHQQYEEIKGYNPPP--SPWRERPIEESLRLFEDMKKGKLDEGQATLRMKTTLEDGKA---DPVAYRIKFTPHHRSGDKWCIYPTYDFTHCLCDSIEDITHSLCTKEFQSRRSSYYWLCNALDIYCPVQWEYGRLNLSYTVVSKRKIGKLINEGIVRNWDDPRLFTLTALRRRGFPAEAINKFCSKVGVTMAQTVIDPLMLEACVRDELNLTATRVMAVLEPLKVTITNFPSDKAMMIE--VPNLPMDASKGNHKVPFDRVLYIESSDFRETMEKGYRRLTPEQSVGLRHAGYVIKVKKVIKNASGEVSELEVTCELTSSTDKPKAFIHW--------VASTAVPCEIRLYDRLFKHKNPEDPEEVPGGFVSDCNKDSLTVIPNALVDITAKGAAPFTKFQFERQGYFCVDPDSSKN 759          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Nematostella
Match: EDO28250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T704])

HSP 1 Score: 91.2781 bits (225), Expect = 4.583e-22
Identity = 45/104 (43.27%), Postives = 66/104 (63.46%), Query Frame = 3
Query: 1695 KVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEG 2006
            K+TW+     D      IP   + +DNLI+K ++ K DDFK F+N++SK E  L G+ EL ++KKGD+IQLQR+G+FICD+ Y+          P VL ++P+G
Sbjct:    1 KLTWL----ADTPTAPTIPAVMVNFDNLISKGIITKTDDFKQFVNKNSKTEVILAGEPELASVKKGDVIQLQRRGFFICDQPYEPT-------SPCVLFSVPDG 93          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Nematostella
Match: EDO34258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPW1])

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-16
Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = 3
Query: 3237 IRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMF 3461
            IR   D + H SPG+KFN+WELKGVPIRIE+GP+++ NN  VL  R++  K +I  E     ++E LE I   MF
Sbjct:  156 IRAKGDFNEHHSPGWKFNHWELKGVPIRIEVGPRDVKNNKFVLVRRHDRSKHTIQHEGFVGSIQETLEVIQNEMF 230          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101171733])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 341/663 (51.43%), Postives = 459/663 (69.23%), Query Frame = 3
Query:   72 NWKNFSKNILKNNDLKVS-LNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            +W  FS   L +     S L  L+ +++ RT+LV   L+ AD +++  L    +     K  S+P +V R+++ L +      +  +K +S K +                + + ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+++SDHF  +++  E+L+    AY DNT   QMK+ERE++  SKCR+ TVE+N+K W  MK GTE G   C+R K+DMNSNNGC+RDP +YRCK   H RTG  YKVYPTYDF CPIVDS+EGVTH LRT+EY+DR++QF+ I++ L LRKP + +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+W+FNKKVIDP+APR+TALSGS   +V V I +  E +++ V +HPKN  +G K VW+ P V VE  DA  F E   VTFINWGN++ITKI+K ++  + S++A+LNL ++DFKKT K+TW+     D      +P   + Y  LI+K VLGKDDDFK ++N+++K EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VLI IP+G++KE  T G K KS+++
Sbjct:   79 HWLEFSARRLADPSSSTSALAELDKALSLRTFLVGHGLTLADLSVWAALKATNDLSG--KGGSLP-HVSRWFSFLSSQVPFSAV-GNKFASKKPEPKTTNS----------DKKKQDLGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIQPDQFTFTSDHFPTIMRMAEKLLAEGKAYIDNTPPEQMKQEREQRIESKCRSNTVEQNMKMWEEMKAGTEYGQTCCMRAKIDMNSNNGCLRDPALYRCKNAPHPRTGDTYKVYPTYDFACPIVDSLEGVTHALRTTEYHDRDDQFYWIINALQLRKPHVWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWSFNKKVIDPVAPRFTALSGS--YVVPVSIPEAKEEMKE-VAKHPKNPEVGVKEVWYGPKVLVEGADAETFKEGEVVTFINWGNLIITKINKGADGKVASLEARLNLDNKDFKKTTKITWL----ADTTSAPTMPAVCVSYQPLISKAVLGKDDDFKQYINKNTKMEEKMVGDPCLKSLKKGDIIQLQRRGFYICDQPYEPISPNSCKESPCVLIYIPDGHTKEMPTAGSKDKSKSQ 720          

HSP 2 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 291/506 (57.51%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC++VRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA +YE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   R G+++  FQNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QVVI+PCG+T    EQE EA++ +C K   RL  A +RV +D   + SPG+KFN+WELKGVP+R+E+GPK++     V   R  G K ++ +  +E+ +   LE I  ++F KA ++L +H   A TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF     L  G  C++ + +   +Y+T+FGRSY
Sbjct: 1164 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWEAIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNIVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVMQILDLYARIYEELLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKRPGEKQLAFQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACVQVVIIPCGITASLPEQEKEALLAQCSKYLKRLLDAGVRVKSDFRDNYSPGWKFNHWELKGVPVRLEVGPKDMQQKQCVAVRRDTGAKITLPEGEVEKRLVAMLEEIQGSLFKKASDDLRSHMVTADTMEQFQKELDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFSPLKTLQPGQMCVSGKEAA--QYYTLFGRSY 1667          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101171733])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 340/663 (51.28%), Postives = 453/663 (68.33%), Query Frame = 3
Query:   72 NWKNFSKNILKNNDLKVS-LNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            +W  FS   L +     S L  L+ +++ RT+LV   L+ AD +++  L    +     K  S+P +V R+++ L +      +    +   K+D                       GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+++SDHF  +++  E+L+    AY DNT   QMK+ERE++  SKCR+ TVE+N+K W  MK GTE G   C+R K+DMNSNNGC+RDP +YRCK   H RTG  YKVYPTYDF CPIVDS+EGVTH LRT+EY+DR++QF+ I++ L LRKP + +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+W+FNKKVIDP+APR+TALSGS   +V V I +  E +++ V +HPKN  +G K VW+ P V VE  DA  F E   VTFINWGN++ITKI+K ++  + S++A+LNL ++DFKKT K+TW+     D      +P   + Y  LI+K VLGKDDDFK ++N+++K EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VLI IP+G++KE  T G K KS+++
Sbjct:   80 HWLEFSARRLADPSSSTSALAELDKALSLRTFLVGHGLTLADLSVWAALKATNDLSG--KGGSLP-HVSRWFSFLSSQVPFSAVGNKFSDKKKQDL----------------------GKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIQPDQFTFTSDHFPTIMRMAEKLLAEGKAYIDNTPPEQMKQEREQRIESKCRSNTVEQNMKMWEEMKAGTEYGQTCCMRAKIDMNSNNGCLRDPALYRCKNAPHPRTGDTYKVYPTYDFACPIVDSLEGVTHALRTTEYHDRDDQFYWIINALQLRKPHVWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWSFNKKVIDPVAPRFTALSGS--YVVPVSIPEAKEEMKE-VAKHPKNPEVGVKEVWYGPKVLVEGADAETFKEGEVVTFINWGNLIITKINKGADGKVASLEARLNLDNKDFKKTTKITWL----ADTTSAPTMPAVCVSYQPLISKAVLGKDDDFKQYINKNTKMEEKMVGDPCLKSLKKGDIIQLQRRGFYICDQPYEPISPNSCKESPCVLIYIPDGHTKEMPTAGSKDKSKSQ 710          

HSP 2 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 291/506 (57.51%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC++VRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA +YE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   R G+++  FQNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QVVI+PCG+T    EQE EA++ +C K   RL  A +RV +D   + SPG+KFN+WELKGVP+R+E+GPK++     V   R  G K ++ +  +E+ +   LE I  ++F KA ++L +H   A TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF     L  G  C++ + +   +Y+T+FGRSY
Sbjct:  995 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWEAIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNIVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVMQILDLYARIYEELLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKRPGEKQLAFQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACVQVVIIPCGITASLPEQEKEALLAQCSKYLKRLLDAGVRVKSDFRDNYSPGWKFNHWELKGVPVRLEVGPKDMQQKQCVAVRRDTGAKITLPEGEVEKRLVAMLEEIQGSLFKKASDDLRSHMVTADTMEQFQKELDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFSPLKTLQPGQMCVSGKEAA--QYYTLFGRSY 1498          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101171733])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 341/670 (50.90%), Postives = 459/670 (68.51%), Query Frame = 3
Query:   72 NWKNFSKNILKNNDLKVS-LNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNK-------KVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            +W  FS   L +     S L  L+ +++ RT+LV   L+ AD +++  L    +     K  S+P +V R+++ L +      +  +K +S K +                + + ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+++SDHF  +++  E+L+    AY DNT   QMK+ERE++  SKCR+ TVE+N+K W  MK GTE G   C+R K+DMNSNNGC+RDP +YRCK   H RTG  YKVYPTYDF CPIVDS+EGVTH LRT+EY+DR++QF+ I++ L LRKP + +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+W+FNK       KVIDP+APR+TALSGS   +V V I +  E +++ V +HPKN  +G K VW+ P V VE  DA  F E   VTFINWGN++ITKI+K ++  + S++A+LNL ++DFKKT K+TW+     D      +P   + Y  LI+K VLGKDDDFK ++N+++K EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VLI IP+G++KE  T G K KS+++
Sbjct:   79 HWLEFSARRLADPSSSTSALAELDKALSLRTFLVGHGLTLADLSVWAALKATNDLSG--KGGSLP-HVSRWFSFLSSQVPFSAV-GNKFASKKPEPKTTNS----------DKKKQDLGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIQPDQFTFTSDHFPTIMRMAEKLLAEGKAYIDNTPPEQMKQEREQRIESKCRSNTVEQNMKMWEEMKAGTEYGQTCCMRAKIDMNSNNGCLRDPALYRCKNAPHPRTGDTYKVYPTYDFACPIVDSLEGVTHALRTTEYHDRDDQFYWIINALQLRKPHVWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWSFNKKLPVSCLKVIDPVAPRFTALSGS--YVVPVSIPEAKEEMKE-VAKHPKNPEVGVKEVWYGPKVLVEGADAETFKEGEVVTFINWGNLIITKINKGADGKVASLEARLNLDNKDFKKTTKITWL----ADTTSAPTMPAVCVSYQPLISKAVLGKDDDFKQYINKNTKMEEKMVGDPCLKSLKKGDIIQLQRRGFYICDQPYEPISPNSCKESPCVLIYIPDGHTKEMPTAGSKDKSKSQ 727          

HSP 2 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 291/506 (57.51%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC++VRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA +YE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   R G+++  FQNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QVVI+PCG+T    EQE EA++ +C K   RL  A +RV +D   + SPG+KFN+WELKGVP+R+E+GPK++     V   R  G K ++ +  +E+ +   LE I  ++F KA ++L +H   A TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF     L  G  C++ + +   +Y+T+FGRSY
Sbjct: 1088 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWEAIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNIVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVMQILDLYARIYEELLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKRPGEKQLAFQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACVQVVIIPCGITASLPEQEKEALLAQCSKYLKRLLDAGVRVKSDFRDNYSPGWKFNHWELKGVPVRLEVGPKDMQQKQCVAVRRDTGAKITLPEGEVEKRLVAMLEEIQGSLFKKASDDLRSHMVTADTMEQFQKELDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFSPLKTLQPGQMCVSGKEAA--QYYTLFGRSY 1591          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Match: eprs1 (glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101171733])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 341/670 (50.90%), Postives = 459/670 (68.51%), Query Frame = 3
Query:   72 NWKNFSKNILKNNDLKVS-LNYLNDSIAHRTYLVNDSLSDADKNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSGKKDXXXXXXXXXXXXXXXXNVQFEEGGKFVGLKNGSKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNK-------KVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTK 2057
            +W  FS   L +     S L  L+ +++ RT+LV   L+ AD +++  L    +     K  S+P +V R+++ L +      +  +K +S K +                + + ++ GKFV L     G VVVRFPPEASGYLHIGHAKAAL+NQHY+  + GKLIMRFDDTNP KE E+FEK+ILEDV  L +  D F+++SDHF  +++  E+L+    AY DNT   QMK+ERE++  SKCR+ TVE+N+K W  MK GTE G   C+R K+DMNSNNGC+RDP +YRCK   H RTG  YKVYPTYDF CPIVDS+EGVTH LRT+EY+DR++QF+ I++ L LRKP + +Y+RL L NTVLSKRKLT+ V++GYVDGWDDPR PTVRG+LR GMT+EGLK+F+ AQG  R+ V MEWDK+W+FNK       KVIDP+APR+TALSGS   +V V I +  E +++ V +HPKN  +G K VW+ P V VE  DA  F E   VTFINWGN++ITKI+K ++  + S++A+LNL ++DFKKT K+TW+     D      +P   + Y  LI+K VLGKDDDFK ++N+++K EE ++GD  LK+LKKGDIIQLQR+G++ICD+ Y+     + K+ P VLI IP+G++KE  T G K KS+++
Sbjct:   79 HWLEFSARRLADPSSSTSALAELDKALSLRTFLVGHGLTLADLSVWAALKATNDLSG--KGGSLP-HVSRWFSFLSSQVPFSAV-GNKFASKKPEPKTTNS----------DKKKQDLGKFVELPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQHYQVTFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLQIQPDQFTFTSDHFPTIMRMAEKLLAEGKAYIDNTPPEQMKQEREQRIESKCRSNTVEQNMKMWEEMKAGTEYGQTCCMRAKIDMNSNNGCLRDPALYRCKNAPHPRTGDTYKVYPTYDFACPIVDSLEGVTHALRTTEYHDRDDQFYWIINALQLRKPHVWEYARLNLNNTVLSKRKLTWFVDQGYVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGGSRSVVNMEWDKIWSFNKKLPVSCLKVIDPVAPRFTALSGS--YVVPVSIPEAKEEMKE-VAKHPKNPEVGVKEVWYGPKVLVEGADAETFKEGEVVTFINWGNLIITKINKGADGKVASLEARLNLDNKDFKKTTKITWL----ADTTSAPTMPAVCVSYQPLISKAVLGKDDDFKQYINKNTKMEEKMVGDPCLKSLKKGDIIQLQRRGFYICDQPYEPISPNSCKESPCVLIYIPDGHTKEMPTAGSKDKSKSQ 727          

HSP 2 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 291/506 (57.51%), Postives = 373/506 (73.72%), Query Frame = 3
Query: 2253 KKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFE--SRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNL--GDKCINSECSMKPKYFTMFGRSY 3758
            KK TRLGLE  KE+N ++WY QVITK E+I+YYD+ GCY+L P +  IWE I++  +  I+  GV+ C FP F+S+++L KEK HIADF+PEVAWVT +G   L EPIA+RPTSET MYP Y+K ++SHRDLP+K NQWC++VRWEFKHP PFLR+REFLWQEGHTA++ K +A EEV QILDLYA +YE+LLAIPVVKGRKTEKEKFAG D+TTT E +I +SGRAIQGATSHHLGQNFSKMF+I FE   R G+++  FQNSWG+TTRTIG+L MVHGD+ GLVLPPRVA  QVVI+PCG+T    EQE EA++ +C K   RL  A +RV +D   + SPG+KFN+WELKGVP+R+E+GPK++     V   R  G K ++ +  +E+ +   LE I  ++F KA ++L +H   A TME     L++  ++  PFCG   CED IK  +A +  +E GAPSMGAKSLCIPF     L  G  C++ + +   +Y+T+FGRSY
Sbjct: 1171 KKQTRLGLEAKKEENLADWYSQVITKAEMIEYYDVSGCYVLRPWSYSIWEAIKDFFDKEIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNIVRWEFKHPQPFLRTREFLWQEGHTAFATKEEATEEVMQILDLYARIYEELLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKRPGEKQLAFQNSWGITTRTIGVLTMVHGDNMGLVLPPRVACVQVVIIPCGITASLPEQEKEALLAQCSKYLKRLLDAGVRVKSDFRDNYSPGWKFNHWELKGVPVRLEVGPKDMQQKQCVAVRRDTGAKITLPEGEVEKRLVAMLEEIQGSLFKKASDDLRSHMVTADTMEQFQKELDQGRIVQIPFCGGIECEDWIKKTTAKDQDLEPGAPSMGAKSLCIPFSPLKTLQPGQMCVSGKEAA--QYYTLFGRSY 1674          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Match: qars1 (glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101169286])

HSP 1 Score: 205.297 bits (521), Expect = 1.749e-54
Identity = 158/515 (30.68%), Postives = 238/515 (46.21%), Query Frame = 3
Query:  456 GNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAEN--------TNVTFINWGNIL-ITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWM--PLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREEC-----LIGDVELKNLKKGDIIQLQRKGYFICDEEYKEN 1952
            G +  RFPPE +G LHIGHAKA   N  Y     G   +R+DDTNP KE E++   I + V+ LG +    +++SDHF  L     +LI+  +AY  +    ++K        S  R++ +EE+L  +  MK G     +  +R+KM M   +G M DP  YR K   H RTG ++ +YPTYD+T  + DSIE +TH+L T E+  R   ++ + + L L  P   +Y RL L  TV+SKRK+  +V  G V  WDDPR+ T+  + R G   E +  F    G   +    E   L A  + V++  APR  A++  +   V +  + +    +  V   P NE  G  +V FT T+F+E+ D  +  E           V   + G ++ I KI K++E  +  ++     S+   K    + W+  PL    R+           YD L          +  N    D            + D  +K  K  D  Q +R GYF  D +   N
Sbjct:  240 GQIRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRYDDTNPEKEEEKYFTAIKDMVEWLGYTPYDVTHASDHFQKLYDLAVDLIRRGHAYVCHQKGEELKGHNVPP--SPWRDRPIEESLVLFERMKKGLFAEGEATLRMKMVME--DGKM-DPVAYRIKYTPHHRTGDEWCIYPTYDYTHCLCDSIENITHSLCTKEFQARRSSYYWLCNALDLYCPVQWEYGRLNLTYTVVSKRKIIKLVETGVVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVSQTTTEPHLLEACVRDVLNESAPR--AMAVLEPLKVTITNLPENAKSDVRVPDFPANEAKGSHTVPFTRTIFIEQSDFREVMEKGYKRLTPEQPVGLRHAGYVISIQKIIKDAEGKVAELEVTCCSSETAEKPKAFIHWVSKPLACEVRL-----------YDKLFLHKHPEDPSEVPNGFLSDINPHSLEVIRNALVDTSVKTAKVFDKFQFERVGYFSLDPDSTAN 736          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Planmine SMEST
Match: SMESG000057140.1 (SMESG000057140.1)

HSP 1 Score: 2109.34 bits (5464), Expect = 0.000e+0
Identity = 1057/1063 (99.44%), Postives = 1060/1063 (99.72%), Query Frame = 3
Query:  570 MRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLINIPEGNSKERATVGMKQKSQTKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQNENKTVENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQEFVFQNSWGMTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLGDKCINSECSMKPKYFTMFGRSY 3758
            MRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIV+DSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENC ITGKQYPLVLINIPEGNSKERATVGMKQKSQTKPEKSGDDSNSKKDKTSKKEKTEKVENKNKKTEKVENKNKKSEKVELQNENKT ENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQEFVFQNSWGMTTRTIGILVMVHGDD+GLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQ+LADRLKTA IRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLGDKCINSECSMKPKYFTMFGRSY
Sbjct:    1 MRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLVLVRIVDQLEIVQDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCPITGKQYPLVLINIPEGNSKERATVGMKQKSQTKPEKSGDDSNSKKDKTSKKEKTEKVENKNKKTEKVENKNKKSEKVELQNENKTAENQSEASKKTELKKVTRLGLEVSKEDNFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKGVKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTSETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEGHTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFTTTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQEFVFQNSWGMTTRTIGILVMVHGDDKGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMMEKCQQLADRLKTAGIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKELANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHRSVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSMGAKSLCIPFEQPCNLGDKCINSECSMKPKYFTMFGRSY 1063          
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Planmine SMEST
Match: SMESG000072743.1 (SMESG000072743.1)

HSP 1 Score: 204.142 bits (518), Expect = 1.079e-55
Identity = 156/518 (30.12%), Postives = 250/518 (48.26%), Query Frame = 3
Query:  450 SKGNVVVRFPPEASGYLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKSLGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTISKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYRCKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFRILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTVRGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYTALSGSDRSLV---LVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERDDAVDFAENTNVTF----------INWGNILITKI---HKNSENVITSIDAKLNLSDRDFKKTQKVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKREECLIGDVEL--KNLKKGDI---IQLQRKGYFICDEE 1940
            + G VV RFPPE +G LHIGHAKA   N  Y     G   +R+DDTNP KE E+F   I + V+ LG      +Y+SD+F  L +Y  +LIK   AY  +    +++       +S  R++ +EE+LK +  MKNG  E  +  +R+K+ M        DP  YR K   H RTG  + +YPTYDFT  I DSIE ++H+L + E+  R   ++ + + L +  P   +Y RL +  TV+SKRK+  +V++G V  WDDPR+ T+  + R G   E + +F    G  +   V++   L A  +  ++  APR  A+    + ++      I  QLE+ +      P  E+ G   +  +  +F+ER    DF+E+    +          + +  I+IT       N    + +I+A     D+  K    + W+       I +Y    S +F +    ++  G    +   +NRDS     L+    L  + + K  +    Q +R GYF+ D++
Sbjct:   45 TGGKVVTRFPPEPNGVLHIGHAKAIHFNFGYAKKNNGICYLRYDDTNPEKEEEKFFLAIKDMVEWLGFEPYAVTYASDNFSKLYEYARKLIKVNQAYICHQPLEEIRGF--NPPLSPWRDRPIEESLKIFEDMKNGKIEEGKATLRMKLIMEDGKP---DPVAYRIKFVPHHRTGNDWCIYPTYDFTHCICDSIENISHSLCSKEFQSRRSAYYWLCNALDIYCPVQWEYGRLNMWYTVMSKRKILQLVDKGIVGNWDDPRLFTLTALRRRGFPAESIGDFCEKIGVTQTQTVIDPAMLEACVRNTLNLKAPRTMAVVEPIKIVISNFPDSIPSQLEVFD-----FPGEESRGSHKISTSNVIFIERS---DFSESPMKGYRRLTPEQPVGLRYLGIVITVTSIDRDNQSGAVIAINATCCGVDQCKKPKAFIHWVANPIACEIRNY----SRLFSEKFPEEHPQG----YLACINRDS----LLVNGGALIDRYITKPAVYTRFQFERTGYFVVDQD 537          
The following BLAST results are available for this feature:
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPRS10.000e+053.83glutamyl-prolyl-tRNA synthetase 1 [Source:HGNC Sym... [more]
EPRS10.000e+053.27glutamyl-prolyl-tRNA synthetase 1 [Source:HGNC Sym... [more]
QARS17.999e-5831.13glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;A... [more]
QARS13.811e-5731.45glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;A... [more]
QARS15.260e-5731.13glutaminyl-tRNA synthetase 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ears-10.000e+055.26Glutamyl(E) Amino-acyl tRNA Synthetase [Source:Un... [more]
ears-10.000e+055.26Glutamyl(E) Amino-acyl tRNA Synthetase [Source:Un... [more]
pars-10.000e+055.05Prolyl Amino-acyl tRNA Synthetase [Source:UniProt... [more]
pars-10.000e+055.05Prolyl Amino-acyl tRNA Synthetase [Source:UniProt... [more]
pars-13.807e-16360.70Prolyl Amino-acyl tRNA Synthetase [Source:UniProt... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GluProRS0.000e+050.91gene:FBgn0005674 transcript:FBtr0084511[more]
GluProRS0.000e+055.38gene:FBgn0005674 transcript:FBtr0084512[more]
GlnRS8.383e-4933.15gene:FBgn0027090 transcript:FBtr0084866[more]
GluRS-m2.775e-1224.73gene:FBgn0036629 transcript:FBtr0075411[more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eprs10.000e+051.26glutamyl-prolyl-tRNA synthetase 1 [Source:ZFIN;Acc... [more]
eprs10.000e+051.11glutamyl-prolyl-tRNA synthetase 1 [Source:ZFIN;Acc... [more]
qars17.091e-5135.34glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-... [more]
qars13.145e-2035.48glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-... [more]
qars11.324e-745.90glutaminyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a90.000e+053.45solute carrier family 12, member 9 [Source:Xenbase... [more]
slc12a90.000e+053.45solute carrier family 12, member 9 [Source:Xenbase... [more]
slc12a90.000e+053.45solute carrier family 12, member 9 [Source:Xenbase... [more]
slc12a90.000e+052.90solute carrier family 12, member 9 [Source:Xenbase... [more]
slc12a90.000e+052.90solute carrier family 12, member 9 [Source:Xenbase... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eprs0.000e+054.14glutamyl-prolyl-tRNA synthetase [Source:MGI Symbol... [more]
Qars2.125e-5430.55glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:... [more]
Qars3.406e-5430.55glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:... [more]
Qars1.455e-2440.60glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:... [more]
Qars3.333e-1050.00glutaminyl-tRNA synthetase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CGC7|SYEP_MOUSE0.000e+054.14Bifunctional glutamate/proline--tRNA ligase OS=Mus... [more]
sp|Q7SIA2|SYEP_CRIGR0.000e+053.75Bifunctional glutamate/proline--tRNA ligase OS=Cri... [more]
sp|P07814|SYEP_HUMAN0.000e+053.83Bifunctional glutamate/proline--tRNA ligase OS=Hom... [more]
sp|P28668|SYEP_DROME0.000e+050.91Bifunctional glutamate/proline--tRNA ligase OS=Dro... [more]
sp|P38708|YHI0_YEAST0.000e+053.91Putative proline--tRNA ligase YHR020W OS=Saccharom... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9JM240.000e+048.18E3 ubiquitin-protein ligase OS=Acyrthosiphon pisum... [more]
A0A0C2N0W90.000e+048.80Bifunctional glutamate/proline--tRNA ligase OS=The... [more]
B9EIU10.000e+054.14Glutamyl-prolyl-tRNA synthetase OS=Mus musculus OX... [more]
A0A5G3KY010.000e+053.45Solute carrier family 12, member 9 OS=Xenopus trop... [more]
A0A4E0RXE30.000e+052.38Glutamyl tRNA synthetase cytoplasmic OS=Fasciola h... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eprs10.000e+049.85glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
eprs10.000e+049.78glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
eprs10.000e+049.27glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
qars11.731e-5330.60glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc... [more]
qars12.626e-5330.60glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000156.18.299e-10965.20pep scaffold:Pmarinus_7.0:GL476617:504787:510854:1... [more]
ENSPMAT00000000155.12.993e-5042.52pep scaffold:Pmarinus_7.0:GL476617:490058:495926:1... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
YHR020W_mRNA0.000e+053.91Prolyl-tRNA synthetase; N-terminal domain shows we... [more]
GUS14.861e-15242.94Glutamyl-tRNA synthetase (GluRS); forms a complex ... [more]
GLN42.282e-6334.44Glutamine tRNA synthetase; monomeric class I tRNA ... [more]
MSE13.998e-722.07Mitochondrial glutamyl-tRNA synthetase; predicted ... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO400147.558e-5930.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282504.583e-2243.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342581.088e-1649.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eprs10.000e+051.43glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
eprs10.000e+051.28glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
eprs10.000e+050.90glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
eprs10.000e+050.90glutamyl-prolyl-tRNA synthetase 1 [Source:NCBI gen... [more]
qars11.749e-5430.68glutaminyl-tRNA synthetase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Bifunctional glutamate/proline--tRNA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000057140.10.000e+099.44SMESG000057140.1[more]
SMESG000072743.11.079e-5530.12SMESG000072743.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030404 ID=SMED30030404|Name=Bifunctional glutamate/proline--tRNA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=3867bp
CGGCTTTTAATTAATTGCGAAATCATCATTTTATATTTTGATTAATGGAT
CAAGCAAGCATTCTAATACTAAATTGGAAAAATTTTTCTAAAAACATTTT
AAAAAATAATGATTTAAAAGTATCATTGAATTACCTTAATGATTCTATTG
CACATAGAACTTATCTAGTTAACGATTCATTATCAGATGCAGATAAAAAT
ATCTATCTAACTCTTTACAACAATGAAAACTTCCAAAATTTATTAAAAGC
CGATTCTGTACCTTTAAATGTTTTGAGATATTATAATCATCTTCAAACTC
TGGATGAAATTAAAACCATTTTGACGCATAAAAATTCATCGGGAAAAAAA
GACACTGTAAAAGTAGAAAAATCGAAACCTAAAGAAGAAAAGTCCACTTC
TAATGTACAATTCGAAGAAGGCGGTAAATTTGTTGGCCTAAAAAACGGAT
CTAAGGGTAACGTAGTTGTTAGATTTCCACCTGAAGCAAGTGGTTATCTC
CATATTGGTCATGCCAAAGCAGCTTTAATTAACCAGCACTATAAAGACCA
CTATGCTGGCAAACTTATAATGCGATTCGACGACACAAATCCTGCTAAAG
AAACTGAAGAATTTGAAAAAATTATTTTAGAGGATGTTAAAAGTCTTGGA
TTAAGTTACGATCATTTCAGTTATTCTTCTGATCATTTTGATTTACTAAT
CAAGTATTGCGAAGAGCTTATTAAATCAGAAAATGCATATGCTGATAATA
CGGATGCAGTTCAAATGAAAAAAGAGCGCGAAGAGAAAACCATATCAAAA
TGCCGCAATCAAACCGTCGAAGAAAATCTTAAATATTGGAATTTAATGAA
AAATGGAACAGAAGAAGGTTTACAATATTGCATTCGAATCAAAATGGACA
TGAATTCTAATAATGGCTGCATGCGTGATCCGACTATTTATAGATGTAAA
CCCGAATTTCATGTTAGAACTGGATATAAATATAAAGTCTACCCAACTTA
TGATTTTACTTGCCCAATAGTAGACAGTATAGAAGGAGTCACACATACCT
TAAGGACAAGTGAATATAATGATAGGAATGAGCAATTTTTCCGTATTCTC
GATCTGTTATCGCTGAGAAAACCTGAAATCGCTGATTACTCAAGATTAGC
TTTACAGAATACTGTCTTATCAAAGAGAAAATTGACATTTATAGTAAATG
AAGGCTATGTTGACGGTTGGGACGATCCTAGAATGCCTACAGTTCGCGGA
ATTCTCAGACATGGTATGACAATAGAGGGATTAAAAGAATTTGTATTAGC
TCAAGGATTCGGGCGTGCCAATGTCGTAATGGAATGGGATAAATTATGGG
CGTTCAATAAAAAAGTAATCGATCCTATAGCTCCACGATATACTGCGTTG
AGTGGATCAGACAGATCATTAGTTCTAGTGAGAATTGTTGACCAATTAGA
AATTGTCGAGGATTCAGTTGGAAGACATCCGAAGAATGAAAATATCGGAC
AGAAATCGGTATGGTTTACTCCAACGGTTTTCGTTGAACGAGATGACGCA
GTGGATTTCGCGGAAAACACCAATGTTACCTTTATCAACTGGGGAAATAT
TTTAATTACCAAAATCCATAAAAATAGTGAAAATGTCATCACATCAATCG
ATGCCAAATTGAATTTATCGGATCGGGATTTCAAGAAAACCCAAAAAGTC
ACCTGGATGCCTTTAGGTTCAAACGATCGAATTGAGGACTATTTTATTCC
AGTCTCAGCGATATTCTATGACAATCTCATAACGAAAAACGTACTGGGCA
AAGATGATGATTTCAAAAACTTTCTGAATAGAGATTCCAAACGAGAAGAA
TGTCTAATAGGTGACGTGGAACTTAAAAATCTCAAAAAAGGCGACATAAT
CCAGCTTCAACGAAAAGGATATTTTATTTGTGACGAGGAATATAAAGAAA
ATTGTTCAATCACTGGTAAACAGTATCCATTGGTGTTGATAAACATTCCC
GAAGGAAACAGTAAAGAAAGAGCCACTGTCGGAATGAAACAGAAATCTCA
AACGAAACCAGAAAAATCCGGTGATGATTCTAATAGCAAAAAAGACAAAA
CTAGTAAAAAGGAGAAAACCGAAAAAGTAGAGAATAAAAATAAGAAAACT
GAAAAAGTAGAGAATAAAAATAAAAAAAGTGAAAAAGTAGAGTTACAAAA
TGAAAACAAGACAGTGGAAAATCAATCGGAAGCGTCAAAGAAAACCGAAC
TGAAAAAAGTAACAAGATTGGGACTGGAAGTATCAAAGGAGGATAATTTC
TCTGAATGGTATATCCAAGTGATTACAAAGGGAGAATTAATCGATTATTA
CGATATTAAAGGCTGTTATATTCTGCTCCCGGAAACCATGGAGATCTGGG
AGAAAATCCAGAACCACATCAATACAACTATCCGTGCAAAGGGTGTTAAG
GCGTGCAACTTCCCTACTTTCATTTCTAAAAGTTCTCTAATGAAAGAAAA
AGATCATATTGCCGATTTCTCACCAGAAGTAGCATGGGTAACAATGGCGG
GCGACAAGAACCTAGAGGAACCGATTGCTATTCGACCGACAAGTGAAACA
GCTATGTATCCATTCTATTCCAAGCGGATCCGATCACACAGAGATCTGCC
ACTGAAATATAATCAATGGTGCAGTGTCGTCCGATGGGAATTCAAGCATC
CGATTCCGTTCCTGAGATCCCGAGAATTCCTCTGGCAAGAAGGCCACACG
GCTTACTCCAATAAAAACGATGCCGTCGAAGAGGTACATCAAATCCTCGA
TCTCTACGCATCGGTGTACGAGGACCTGTTAGCAATCCCGGTTGTGAAAG
GTCGGAAAACCGAGAAAGAGAAATTTGCCGGTGCCGATTTCACCACTACA
ACCGAGGTCTATATTGGCAGTTCCGGTCGAGCAATCCAAGGCGCGACATC
GCATCATTTGGGACAGAATTTCAGCAAAATGTTCGACATCCGATTCGAAT
CCCGCGACGGTAAGCAAGAGTTTGTGTTTCAGAACTCGTGGGGAATGACA
ACGAGGACTATTGGAATCCTGGTTATGGTGCACGGGGACGACAGGGGATT
GGTTTTGCCGCCCAGAGTTGCGGAACATCAAGTTGTAATCGTTCCTTGCG
GATTGACAATAAAAGCCACCGAACAGGAAACCGAAGCGATGATGGAAAAA
TGCCAAAAGTTGGCGGATCGATTGAAAACGGCGGAAATACGAGTCTATGC
TGATCTCGATCCCCACAGATCTCCGGGATTTAAGTTCAATAATTGGGAAT
TAAAAGGTGTTCCAATTAGAATTGAGATGGGCCCTAAAGAATTGGCAAAC
AATACTGTGGTGTTGTGTTATCGGTACAATGGGGTGAAGGAATCGATAAT
GGATGAGAGACTGGAGCGGTTTGTCGAAGAGAAATTGGAAGCCATACACG
AAGCTATGTTTGTTAAGGCCAAAAACGAATTGGATGCACATAGGAGTGTT
GCATTTACAATGGAGGATTTAATCAACGGATTGAATAGGAAAATGTTGAT
AACGGCCCCGTTTTGTGGAGACAAAGCTTGTGAAGATAGAATAAAAATCG
TCAGTGCAGGAGAAGCAGTTGTTGAAGAAGGAGCTCCGTCGATGGGTGCA
AAATCGCTCTGCATACCGTTTGAGCAACCCTGTAATCTTGGTGACAAATG
TATCAATTCTGAGTGCTCAATGAAACCGAAATACTTTACAATGTTCGGTC
GAAGTTACTAACATTATTTTAAATATATAATGGCTTGTTTAAATAAATTT
TCTATTATTATTATTGTTTGTTTTATAATTTATTGCTATTAGTAATTTGA
CTACATATTATGTGCAT
back to top

protein sequence of SMED30030404-orf-1

>SMED30030404-orf-1 ID=SMED30030404-orf-1|Name=SMED30030404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1239bp
MDQASILILNWKNFSKNILKNNDLKVSLNYLNDSIAHRTYLVNDSLSDAD
KNIYLTLYNNENFQNLLKADSVPLNVLRYYNHLQTLDEIKTILTHKNSSG
KKDTVKVEKSKPKEEKSTSNVQFEEGGKFVGLKNGSKGNVVVRFPPEASG
YLHIGHAKAALINQHYKDHYAGKLIMRFDDTNPAKETEEFEKIILEDVKS
LGLSYDHFSYSSDHFDLLIKYCEELIKSENAYADNTDAVQMKKEREEKTI
SKCRNQTVEENLKYWNLMKNGTEEGLQYCIRIKMDMNSNNGCMRDPTIYR
CKPEFHVRTGYKYKVYPTYDFTCPIVDSIEGVTHTLRTSEYNDRNEQFFR
ILDLLSLRKPEIADYSRLALQNTVLSKRKLTFIVNEGYVDGWDDPRMPTV
RGILRHGMTIEGLKEFVLAQGFGRANVVMEWDKLWAFNKKVIDPIAPRYT
ALSGSDRSLVLVRIVDQLEIVEDSVGRHPKNENIGQKSVWFTPTVFVERD
DAVDFAENTNVTFINWGNILITKIHKNSENVITSIDAKLNLSDRDFKKTQ
KVTWMPLGSNDRIEDYFIPVSAIFYDNLITKNVLGKDDDFKNFLNRDSKR
EECLIGDVELKNLKKGDIIQLQRKGYFICDEEYKENCSITGKQYPLVLIN
IPEGNSKERATVGMKQKSQTKPEKSGDDSNSKKDKTSKKEKTEKVENKNK
KTEKVENKNKKSEKVELQNENKTVENQSEASKKTELKKVTRLGLEVSKED
NFSEWYIQVITKGELIDYYDIKGCYILLPETMEIWEKIQNHINTTIRAKG
VKACNFPTFISKSSLMKEKDHIADFSPEVAWVTMAGDKNLEEPIAIRPTS
ETAMYPFYSKRIRSHRDLPLKYNQWCSVVRWEFKHPIPFLRSREFLWQEG
HTAYSNKNDAVEEVHQILDLYASVYEDLLAIPVVKGRKTEKEKFAGADFT
TTTEVYIGSSGRAIQGATSHHLGQNFSKMFDIRFESRDGKQEFVFQNSWG
MTTRTIGILVMVHGDDRGLVLPPRVAEHQVVIVPCGLTIKATEQETEAMM
EKCQKLADRLKTAEIRVYADLDPHRSPGFKFNNWELKGVPIRIEMGPKEL
ANNTVVLCYRYNGVKESIMDERLERFVEEKLEAIHEAMFVKAKNELDAHR
SVAFTMEDLINGLNRKMLITAPFCGDKACEDRIKIVSAGEAVVEEGAPSM
GAKSLCIPFEQPCNLGDKCINSECSMKPKYFTMFGRSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003824catalytic activity
GO:0004818glutamate-tRNA ligase activity
GO:0008270zinc ion binding
GO:0035613RNA stem-loop binding
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0051020GTPase binding
GO:0000166nucleotide binding
GO:0016876ligase activity, forming aminoacyl-tRNA and related compounds
GO:0005524ATP binding
GO:0004827proline-tRNA ligase activity
GO:0004812aminoacyl-tRNA ligase activity
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0017101aminoacyl-tRNA synthetase multienzyme complex
GO:0097452GAIT complex
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
GO:0006424glutamyl-tRNA aminoacylation
GO:0008152metabolic process
GO:0017148negative regulation of translation
GO:0032869cellular response to insulin stimulus
GO:0071346cellular response to interferon-gamma
GO:0043039tRNA aminoacylation
GO:0006433prolyl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR036621Anticodon-bd_dom_sf
IPR004499Pro-tRNA-ligase_IIa_arc-type
IPR004526Glu-tRNA-synth_arc/euk
IPR033721ProRS_core_arch_euk
IPR036282Glutathione-S-Trfase_C_sf
IPR000924Glu/Gln-tRNA-synth
IPR016061Pro-tRNA_ligase_II_C
IPR002314aa-tRNA-synt_IIb
IPR014729Rossmann-like_a/b/a_fold
IPR020059Glu/Gln-tRNA-synth_Ib_codon-bd
IPR010987Glutathione-S-Trfase_C-like
IPR020056Rbsml_L25/Gln-tRNA_synth_N
IPR004154Anticodon-bd
IPR020061Glu_tRNA_lig_a-bdl
IPR020058Glu/Gln-tRNA-synth_Ib_cat-dom
IPR001412aa-tRNA-synth_I_CS
IPR006195aa-tRNA-synth_II
IPR017449Pro-tRNA_synth_II
IPR011035Ribosomal_L25/Gln-tRNA_synth
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1039..1059
NoneNo IPR availableCOILSCoilCoilcoord: 688..734
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 744..1022
e-value: 2.4E-109
score: 367.1
NoneNo IPR availableGENE3DG3DSA:1.20.1050.130coord: 3..103
e-value: 8.9E-15
score: 56.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 657..735
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..735
NoneNo IPR availablePANTHERPTHR43382:SF2BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASEcoord: 683..1238
coord: 10..693
NoneNo IPR availablePANTHERPTHR43382FAMILY NOT NAMEDcoord: 683..1238
coord: 10..693
NoneNo IPR availableCDDcd00862ProRS_anticodon_zinccoord: 1018..1238
e-value: 1.03317E-69
score: 230.262
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 140..451
NoneNo IPR availableSUPERFAMILYSSF52954Class II aaRS ABD-relatedcoord: 1017..1148
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 749..1016
IPR000924Glutamyl/glutaminyl-tRNA synthetasePRINTSPR00987TRNASYNTHGLUcoord: 333..341
score: 46.67
coord: 157..168
score: 34.58
coord: 143..155
score: 60.0
coord: 317..327
score: 50.0
coord: 172..185
score: 47.68
IPR016061Proline-tRNA ligase, class II, C-terminalSMARTSM00946ProRS_C_1_2coord: 1156..1238
e-value: 7.8E-23
score: 91.9
IPR016061Proline-tRNA ligase, class II, C-terminalPFAMPF09180ProRS-C_1coord: 1156..1238
e-value: 1.3E-17
score: 63.8
IPR017449Prolyl-tRNA synthetase, class IIGENE3DG3DSA:3.30.110.30coord: 1151..1237
e-value: 2.5E-27
score: 96.6
IPR017449Prolyl-tRNA synthetase, class IISUPERFAMILYSSF64586C-terminal domain of ProRScoord: 1155..1238
IPR004154Anticodon-bindingPFAMPF03129HGTP_anticodoncoord: 1029..1129
e-value: 1.0E-16
score: 60.8
IPR020056Ribosomal protein L25/Gln-tRNA synthetase, N-terminalGENE3DG3DSA:2.40.240.10coord: 568..636
e-value: 8.2E-23
score: 82.9
IPR020056Ribosomal protein L25/Gln-tRNA synthetase, N-terminalGENE3DG3DSA:2.40.240.10coord: 472..567
e-value: 8.2E-23
score: 82.9
IPR020059Glutamyl/glutaminyl-tRNA synthetase, class Ib, anti-codon binding domainPFAMPF03950tRNA-synt_1c_Ccoord: 446..630
e-value: 1.2E-30
score: 106.7
IPR002314Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)PFAMPF00587tRNA-synt_2bcoord: 838..1010
e-value: 4.1E-19
score: 69.2
IPR036621Anticodon-binding domain superfamilyGENE3DG3DSA:3.40.50.800coord: 1023..1147
e-value: 4.5E-37
score: 128.5
IPR004499Proline-tRNA ligase, class IIa, archaeal-typeTIGRFAMTIGR00408TIGR00408coord: 746..1238
e-value: 1.1E-171
score: 569.9
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 104..449
e-value: 1.5E-119
score: 401.0
IPR004526Glutamyl-tRNA synthetase, archaeal/eukaryotic cytosolicTIGRFAMTIGR00463TIGR00463coord: 108..636
e-value: 1.6E-134
score: 447.5
IPR020058Glutamyl/glutaminyl-tRNA synthetase, class Ib, catalytic domainPFAMPF00749tRNA-synt_1ccoord: 140..443
e-value: 1.5E-103
score: 346.0
IPR001412Aminoacyl-tRNA synthetase, class I, conserved sitePROSITEPS00178AA_TRNA_LIGASE_Icoord: 146..157
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 782..1022
score: 21.155
IPR033721Prolyl-tRNA synthetase, catalytic domainCDDcd00778ProRS_core_arch_eukcoord: 751..1012
e-value: 1.57871E-157
score: 469.384
IPR011035Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain superfamilySUPERFAMILYSSF50715Ribosomal protein L25-likecoord: 446..654
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 7..90