Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30030383
Length (bp)3952
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30030383) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30030383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30030383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30030383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030383SMESG000003862.1 Contig985uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030383SMESG000003862.1 Contig985newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030383SMESG000062458.1 Contig4602GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030383SMESG000003862.1 Contig4602GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030383SMESG000042605.1 Contig985uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030383SMESG000042605.1 Contig985newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30030383SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030383SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30030383SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030383SMESG000003862.1 dd_Smed_v6_3667_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030383SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 72.7886 bits (177), Expect = 8.649e-13
Identity = 46/158 (29.11%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDY--KKYIFPVSINE---RFKGVIDRCLVEDPNYRISVHELL 2065
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N        ++ H  ++ +   K   P  + +    FK  ID CL +DP++R +  ELL
Sbjct:   43 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPN--------SDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELL 192          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 73.559 bits (179), Expect = 1.571e-12
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 2
Query: 1487 ERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++  + +  KADVWS G  ++E++T K        E +  +  FKI  +      P  I+E  +  + R  VE    R S  ELL+
Sbjct:  418 ERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK----PPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEA-RQRPSAEELLT 614          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 72.7886 bits (177), Expect = 1.596e-12
Identity = 46/152 (30.26%), Postives = 82/152 (53.95%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDY--KKYIFPVSINE---RFKGVIDRCLVEDPNYRISVHELL 2065
            ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N        ++ H  ++ +   K   P  + +    FK  ID CL +DP++R +  ELL
Sbjct:  126 KEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPN--------SDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RSKR (ribosomal protein S6 kinase related [Source:HGNC Symbol;Acc:HGNC:26314])

HSP 1 Score: 72.7886 bits (177), Expect = 1.704e-12
Identity = 41/134 (30.60%), Postives = 70/134 (52.24%), Query Frame = 2
Query: 1655 LACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIP-GQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRI 2047
            L  LHD GI++ ++ M +ILLD +G +KL    + + +P G +   I     Y+APE+L   P+N  AD WS G++L  + TGK   F    E  + +    + +     P S+N+    ++   L ++P +R+
Sbjct:  217 LCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMAPEVLSGGPYNHAADWWSLGVLLFSLATGK---FPVAAERDHVAMLASVTHSDSEIPASLNQGLSLLLHELLCQNPLHRL 347          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 73.559 bits (179), Expect = 1.761e-12
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 2
Query: 1487 ERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++  + +  KADVWS G  ++E++T K        E +  +  FKI  +      P  I+E  +  + R  VE    R S  ELL+
Sbjct:  449 ERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK----PPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEA-RQRPSAEELLT 645          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 77.0258 bits (188), Expect = 6.312e-15
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-IGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  101 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 246          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 77.411 bits (189), Expect = 2.167e-14
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  258 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 403          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 77.411 bits (189), Expect = 4.158e-14
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-IGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  478 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 77.411 bits (189), Expect = 4.177e-14
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-IGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  481 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 626          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 77.411 bits (189), Expect = 4.224e-14
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-IGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  433 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 578          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: inaC (gene:FBgn0004784 transcript:FBtr0087047)

HSP 1 Score: 73.1738 bits (178), Expect = 1.051e-12
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 2
Query: 1664 LHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEIN----KDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFK-IDYKKYIFPVSINERFKGVIDRCLVEDPNYRISV 2053
            LH+  I+Y +L + +ILLD +G +KL    + K    +++         +Y+APEI+   P++I AD WSFG++L E + G+     A  E  +E+  F+ I  KK +FP   +     +I   L + PN R+  
Sbjct:  486 LHERDIIYRDLKLDNILLDGEGHVKLVDFGLSKEGVTERQTTRTFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQ-----APFEGDDETTVFRNIKDKKAVFPKHFSVEAMDIITSFLTKKPNNRLGA 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303432)

HSP 1 Score: 71.2478 bits (173), Expect = 4.066e-12
Identity = 43/140 (30.71%), Postives = 76/140 (54.29%), Query Frame = 2
Query: 1664 LHDHGIVYDELTMSHILLDSKGDIKLASINIGK--IIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKC-FNFSAKTEAKN---ESHFFKIDYKKYI-FPVSINERFKGVIDRCLVEDPNYRISVH 2056
            LH+ GI+Y +L + ++LLD +G IKL    + K  I PG   +      +Y+APEIL  + +    D W+ G++L E++ G+  F+ +  +E  +   E + F++  +K I  P S++ R   V+   L ++P  R+  H
Sbjct:  297 LHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCH 436          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303433)

HSP 1 Score: 70.8626 bits (172), Expect = 4.309e-12
Identity = 43/140 (30.71%), Postives = 76/140 (54.29%), Query Frame = 2
Query: 1664 LHDHGIVYDELTMSHILLDSKGDIKLASINIGK--IIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKC-FNFSAKTEAKN---ESHFFKIDYKKYI-FPVSINERFKGVIDRCLVEDPNYRISVH 2056
            LH+ GI+Y +L + ++LLD +G IKL    + K  I PG   +      +Y+APEIL  + +    D W+ G++L E++ G+  F+ +  +E  +   E + F++  +K I  P S++ R   V+   L ++P  R+  H
Sbjct:  276 LHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCH 415          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303429)

HSP 1 Score: 70.8626 bits (172), Expect = 4.494e-12
Identity = 43/140 (30.71%), Postives = 76/140 (54.29%), Query Frame = 2
Query: 1664 LHDHGIVYDELTMSHILLDSKGDIKLASINIGK--IIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKC-FNFSAKTEAKN---ESHFFKIDYKKYI-FPVSINERFKGVIDRCLVEDPNYRISVH 2056
            LH+ GI+Y +L + ++LLD +G IKL    + K  I PG   +      +Y+APEIL  + +    D W+ G++L E++ G+  F+ +  +E  +   E + F++  +K I  P S++ R   V+   L ++P  R+  H
Sbjct:  297 LHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCH 436          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083226)

HSP 1 Score: 70.8626 bits (172), Expect = 4.497e-12
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 2
Query: 1601 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGK--IIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESH---FFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRIS 2050
            RI + D    +  +I+  L  LH  GI+Y +L + ++LLD  G IK+A   + K  I  G+         +YLAPE+LD+  +    D W  G+++ E+I G+   +       N  H   F  I  ++  FP +I +  K ++   L +DP  R+ 
Sbjct:  278 RIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFY-------NRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 427          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 76.6406 bits (187), Expect = 1.072e-13
Identity = 73/287 (25.44%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++  + +  KADVWS G  ++E++T K        E +  +  FKI  +      P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  324 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK----PPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 599          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 76.2554 bits (186), Expect = 1.790e-13
Identity = 73/287 (25.44%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++  + +  KADVWS G  ++E++T K        E +  +  FKI  +      P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  342 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK----PPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 75.8702 bits (185), Expect = 1.965e-13
Identity = 73/287 (25.44%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++  + +  KADVWS G  ++E++T K        E +  +  FKI  +      P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  336 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK----PPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 611          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 73.559 bits (179), Expect = 5.570e-13
Identity = 57/187 (30.48%), Postives = 97/187 (51.87%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G    A    + K    I+  L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D    +KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  200 VFIAMELMGTCAEKLKKRIQGPIPEAI---LGKMTVAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLL 383          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 73.559 bits (179), Expect = 6.089e-13
Identity = 57/187 (30.48%), Postives = 97/187 (51.87%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G    A    + K    I+  L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D    +KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  209 VFIAMELMGTCAEKLKKRIQGPIPEAI---LGKMTVAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLL 392          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045672.1 (protein kinase C delta type-like [Source:NCBI gene;Acc:101734050])

HSP 1 Score: 78.5666 bits (192), Expect = 5.131e-15
Identity = 58/217 (26.73%), Postives = 106/217 (48.85%), Query Frame = 2
Query: 1325 IFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMA-------ISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIG-KIIPGQKRNEINKD---YLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESH 1942
            +  K    Q+  A+   NN +VA+    +      +N  S+++E R L V         + A ++ +    ++ME  +       ++ K H K     TR     +VI +  +++ GL  LH  GI++ +L   +IL+ S+G IK+A   +  + I G     +++    Y+APE+L+++ +N   D W+FGIIL ++ TG+ + F+ K  A    H
Sbjct:   11 VLGKGTFGQVVLASTPTNNHQVAIKV--IPKKSRMVNRESILREARVLRVAAGHPYLCHMHAAFQTQNYAFIAMEFASRGSLKDLLTKKHHLK-----TR-----QVIFYSAEMVCGLQYLHSRGIIHSDLKPDNILVSSEGHIKIADFGLAAENIFGNDTICVHRGTMKYMAPEVLEDQQYNAAVDWWAFGIILCQMATGR-YPFNDKNGAAKLRH 214          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 73.9442 bits (180), Expect = 5.772e-13
Identity = 49/167 (29.34%), Postives = 82/167 (49.10%), Query Frame = 2
Query: 1601 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTE------AKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N             KN       D+ K          FK  +D CL +DP++R +  ELL
Sbjct:  112 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 73.9442 bits (180), Expect = 5.928e-13
Identity = 49/167 (29.34%), Postives = 82/167 (49.10%), Query Frame = 2
Query: 1601 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTE------AKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N             KN       D+ K          FK  +D CL +DP++R +  ELL
Sbjct:  105 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 73.559 bits (179), Expect = 6.856e-13
Identity = 49/167 (29.34%), Postives = 82/167 (49.10%), Query Frame = 2
Query: 1601 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTE------AKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N             KN       D+ K          FK  +D CL +DP++R +  ELL
Sbjct:  100 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045494.1 (MAP/microtubule affinity-regulating kinase 4 [Source:NCBI gene;Acc:100491038])

HSP 1 Score: 74.7146 bits (182), Expect = 6.991e-13
Identity = 72/276 (26.09%), Postives = 132/276 (47.83%), Query Frame = 2
Query: 1259 AQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNA--SERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIG-KIIPGQKRNEI--NKDYLAPEILDNKPWN-IKADVWSFGIILLEIITGKC-FNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            A+ +   P +  VG  R  ++    K   +++  A      +EVA+   ++ D K  +N SSL K  R++ +M        V++F + + E  + + ME    S  E F  +    R+   +   K +RQI+  +   H   IV+ +L   ++LLDS+ +IK+A      +  PG K +    +  Y APE+   K +N  + DVWS G+IL  +++G   F+     E +      ++   KY  P  ++   +GV+ R LV +P+ R ++ +++
Sbjct:   36 ARSRSSVPEEPHVGNYR--LLRTIGKGNFAKVKLARHVLTGREVAI---KIID-KTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLIMEYA--SGGEVFDYLVSHGRMKEKEARAK-FRQIVSAVHYCHQKNIVHRDLKAENLLLDSESNIKIADFGFSNEFTPGGKLDTFCGSPPYAAPELFQGKRYNGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRE-----RVLRGKYRIPFYMSTDCEGVLRRFLVLNPSKRCTLDQIM 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 72.7886 bits (177), Expect = 1.032e-12
Identity = 47/158 (29.75%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDY--KKYIFPVSINE---RFKGVIDRCLVEDPNYRISVHELL 2065
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N        ++ H  ++ +   K   P  I +    FK  ID CL +DP++R +  ELL
Sbjct:  120 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPN--------SDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 72.7886 bits (177), Expect = 1.095e-12
Identity = 47/152 (30.92%), Postives = 82/152 (53.95%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDY--KKYIFPVSINE---RFKGVIDRCLVEDPNYRISVHELL 2065
            ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N        ++ H  ++ +   K   P  I +    FK  ID CL +DP++R +  ELL
Sbjct:  126 KEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPN--------SDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: 4921509C19Rik (RIKEN cDNA 4921509C19 gene [Source:MGI Symbol;Acc:MGI:2685851])

HSP 1 Score: 73.1738 bits (178), Expect = 1.575e-12
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIG-KIIPGQKRNEI--NKDYLAPEILDNKPWNIKA-DVWSFGIILLEIITGKCFNFSAKT-EAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHEL 2062
            E  + ++Q++  L   H+ GIV+ +L   +ILLD +G++KL    +G KII GQK         Y APE+ +++ ++ +A DVWS G++L  + TG C  F+  + EA  +    KI   KY    S++     VI + L  +P  R +VH++
Sbjct:  118 ECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGLGTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATG-CLPFNGYSYEAIKQ----KIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Gm14147 (predicted gene 14147 [Source:MGI Symbol;Acc:MGI:3651555])

HSP 1 Score: 73.1738 bits (178), Expect = 1.630e-12
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIG-KIIPGQKRNEI--NKDYLAPEILDNKPWNIKA-DVWSFGIILLEIITGKCFNFSAKT-EAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHEL 2062
            E  + ++Q++  L   H+ GIV+ +L   +ILLD +G++KL    +G KII GQK         Y APE+ +++ ++ +A DVWS G++L  + TG C  F+  + EA  +    KI   KY    S++     VI + L  +P  R +VH++
Sbjct:  118 ECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGLGTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATG-CLPFNGYSYEAIKQ----KIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Gm14147 (predicted gene 14147 [Source:MGI Symbol;Acc:MGI:3651555])

HSP 1 Score: 73.1738 bits (178), Expect = 1.630e-12
Identity = 51/153 (33.33%), Postives = 84/153 (54.90%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIG-KIIPGQKRNEI--NKDYLAPEILDNKPWNIKA-DVWSFGIILLEIITGKCFNFSAKT-EAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHEL 2062
            E  + ++Q++  L   H+ GIV+ +L   +ILLD +G++KL    +G KII GQK         Y APE+ +++ ++ +A DVWS G++L  + TG C  F+  + EA  +    KI   KY    S++     VI + L  +P  R +VH++
Sbjct:  118 ECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGLGTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATG-CLPFNGYSYEAIKQ----KIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDI 265          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0PKV7|MKK5_LEIME (Mitogen-activated protein kinase kinase 5 OS=Leishmania mexicana OX=5665 GN=MKK5 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.410e-13
Identity = 65/261 (24.90%), Postives = 122/261 (46.74%), Query Frame = 2
Query: 1322 GIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMN-ASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLH-DHGIVYDELTMSHILLDSK-GDIKLASINIGKIIPGQKRNEIN----KDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKI------DYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            G   K     + +A    +NK VAL + +++  +  IN   + +EL  L   + A+   V  +  +  EG V ++ME M  SL E +K V           +    R +L+GL  LH +  +++ +L  S++L +S+ GDIK++   +   +   K +  +      Y++PE L  + ++  AD+WS G+++ E+  G C  ++      +E+ F+ +      D      P  ++      I  C+V+ P+ R +  ELL
Sbjct:   63 GFLGKGSSGSVRRAVHRGSNKVVALKEIKVTG-QTHINE--IRRELETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPV-------LACITRLMLKGLTYLHRNRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTVTYMSPERLRGEHYSYGADIWSLGLVVAELAVGVC-PYAGLRGGSSEARFWALLQHLNGDGTALELPPEMDSDLADFISACVVKSPDRRPTCTELL 312          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|G5EGQ3|MAX2_CAEEL (Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans OX=6239 GN=max-2 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.288e-13
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-IGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINER------------FKGVIDRCLVEDPNYRISVHELLS 2068
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +    +I PG KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G             E  + +    K I+ ++ N +            F   +D+CLV DP+ R    ELL+
Sbjct:  478 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG-------------EPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 623          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7XIW5|CIPKT_ORYSJ (CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica OX=39947 GN=CIPK29 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 9.069e-13
Identity = 66/281 (23.49%), Postives = 124/281 (44.13%), Query Frame = 2
Query: 1292 SVGRL---RFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN---------------SSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEI--NKDYLAPEILDNKPWN-IKADVWSFGIILLEIITGKC-FNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            + GR+   R+ + G+  +   +++Y A D    ++VA+  +        +                 ++++  LR   VM    R   I A  K    V   ++L A    E F  +D   R+ + D    ++RQ++  +   H  G+ + ++   ++LLD  GD+K+A   +G +  G   + +     Y+APEIL  K +N  K D+WS G++L  +  G   FN     +A   + + KI   K+  P   +   + ++ R L  +P  RI   E+++
Sbjct:   23 AAGRVLLGRYELGGLLGRGASAKVYLARDLLTGRDVAIKSFPNPRHGGGLRGGEEDVLLRPAPIEREAAILPRLRHRHVM----RLREILATRK---KVHFVLDLAAGG--ELFSLLDASGRM-TEDLARHYFRQLISAVRYCHSRGVYHRDIKPENLLLDDAGDLKVADFGLGAVADGALHHTLCGTPAYVAPEILSRKGYNPAKVDIWSCGVVLFVLAAGYLPFN-----DASLVNMYRKIYAGKFRCPAWFSPELRCLVRRILDPNPATRIDTEEIIT 288          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O22040|ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.763e-12
Identity = 48/157 (30.57%), Postives = 82/157 (52.23%), Query Frame = 2
Query: 1616 DEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGK------IIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + V++ Y RQ+L GL  LH+H I++ ++  ++IL+D+KG IKLA     K       + G K  +    ++APE++     +  AD+WS G  ++E++TGK   +S + +      F          P +++   K  + +CL E PN R +  ELL
Sbjct:  171 ESVVRTYTRQLLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKA-PWSQQYKEVAAIFFIGTTKSHPPIPDTLSSDAKDFLLKCLQEVPNLRPTASELL 326          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q55GC2|DST2_DICDI (Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum OX=44689 GN=dst2 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.808e-12
Identity = 53/158 (33.54%), Postives = 83/158 (52.53%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQKRNE-INKDY-LAPEILDNK----PWNIKADVWSFGIILLEIITGKCFNFSAKTEAK-NESHFFKIDYK-KYIFPVSINER------FKGVIDRCLVEDPNYRISVHELL 2065
            R+ L+GL  LH   +++ +L  ++ILL   GD+KLA   + G +    KRN  I   Y +APE+++N+    P++ KAD+WS GI L+E+         A+ E   +E H  K+ ++  Y  P  +  +      F   I  CL +DPN R +  ELL
Sbjct:  123 RETLKGLEYLHHTNVIHRDLKGANILLTESGDVKLADFGVSGLLDKSSKRNTFIGTPYWMAPEVIENRSNPVPYDTKADIWSLGITLIEL---------AEAEPPLSEIHPMKVLFQIPYRDPPKLKNQENYSKDFINFIQSCLQKDPNQRKTATELL 271          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A167KRR5 (Protein kinase domain-containing protein (Fragment) OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=PHYBLDRAFT_91659 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.239e-16
Identity = 69/264 (26.14%), Postives = 126/264 (47.73%), Query Frame = 2
Query: 1310 FSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNA------SERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQ----KRNEINKDYLAPEILDNKPW-NIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            ++I+    K    ++Y A D+   + VA+    +S   AF N+   I    + T+ +A       +  VR+  +   +  + V ME   +S  E + A+  K R     +  KW+R+++E +  +H + IV+ +L   ++L+D  G I+L     G+ +  +    K    +  Y APE++   P      D+WS G+IL  ++TGK   F ++T  +    F KI    Y  P  ++ +   +I R L ++PN R++ H+ LS
Sbjct:    1 YAILKTLGKGNFGKVYLANDSLTGENVAVKVMSMS---AFKNDDQQIHAHSEQTICDAFVTSLNHKNIVRVIEVTADDSNMCVVMEY--VSGGELYDAIR-KVRKLQEPKAQKWFRELVEAVGYIHKNKIVHRDLKPENVLIDQHGHIRLCDFGFGRKLDDEEGLLKTYCGSPYYAAPEMVTATPHKGPPVDMWSCGVILYAMLTGK-LPFQSETMPQL---FKKISLASYTPPRDVSNQASNLISRLLCKNPNDRLTAHQCLS 254          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2V8LVA0 (Protein kinase domain-containing protein OS=Acidobacteria bacterium OX=1978231 GN=DMF75_16680 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.576e-16
Identity = 71/262 (27.10%), Postives = 128/262 (48.85%), Query Frame = 2
Query: 1307 RFSIIGIFKKQELSQIYKATDNFNNKEVAL---MQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEI---NKDYLAPEILDNKPWNIKADVWSFGIILLEIITG-KCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKG-------VIDRCLVEDPNYRIS 2050
            R+ I+G+  +  + ++Y+A D    + VAL    ++ L+D  A       ++  R++T  N      R++ I + EG   +SME +     E   ++  +      D+ I+  RQI  GLA  HD G+++ +L  +++++D  G+ ++    +  +      +EI      Y+APE LD + + +++D++S G++L E+ TG K F      EA       K+  +    P + +E  KG       VIDRCL +DP  R S
Sbjct:   70 RYRIVGLLGRGGMGEVYRAEDLKLGQPVALKFLPEHLLTDGAALARFHREVRVARQVTHRNV----CRVYDIGEVEGRHFLSMEFIR---GEELSSLSRRIGRLPQDKAIQIARQICAGLAAAHDVGVLHRDLKPANVMIDENGNARITDFGLAGLAEEFHEDEIRAGTPAYMAPEQLDGRTFTVRSDIYSLGLVLYELFTGRKAF------EAPTLGELVKLR-RSETTPTTPSEIVKGLDPLIEKVIDRCLQKDPEDRPS 317          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3HQ82 (serine/threonine-protein kinase 17A-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157181 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.220e-15
Identity = 81/273 (29.67%), Postives = 128/273 (46.89%), Query Frame = 2
Query: 1277 KPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSK---GDIKLASINIGKIIP-GQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFP----VSINERFKGVIDRCLVEDPNYRISVHELL 2065
            +PL E     RF+I G   + + + + K  DN + +E A  +Y     K     S ++ E+  L +  A  R + +  +Y+    + +  E  A    E F  +D +       EVI   RQI+EGL  LHD  +V+ +L   +ILL +    GD+KL      +++  G+   +I    DY+APE+L  +P     D+WS G+++  ++TG C  F+   E K E+ F  I      FP      I+E     I +CLV  P  RIS  + L
Sbjct:   33 EPLTE-----RFTIEGEIGRGKFAVVRKIRDNHSGQEYA-AKYIRKRRKGKDVRSEILHEVVMLEMALAHPRLIDLKEVYETSHELVLITEYAAGG--ELFHHIDEEESFKEK-EVIHLMRQIMEGLVFLHDRNVVHLDLKPQNILLTNPHPHGDVKLCDFGFARLVNYGEDIRDIIGTPDYVAPEVLSYEPIGTYTDIWSVGVLVYVMLTG-CSPFAG--EDKQET-FLNISQVNLDFPEDLFCDISENAIDFISKCLVRQPGERISARDCL 292          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3HRL9 (serine/threonine-protein kinase 17A-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106157181 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.387e-15
Identity = 81/273 (29.67%), Postives = 128/273 (46.89%), Query Frame = 2
Query: 1277 KPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSK---GDIKLASINIGKIIP-GQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFP----VSINERFKGVIDRCLVEDPNYRISVHELL 2065
            +PL E     RF+I G   + + + + K  DN + +E A  +Y     K     S ++ E+  L +  A  R + +  +Y+    + +  E  A    E F  +D +       EVI   RQI+EGL  LHD  +V+ +L   +ILL +    GD+KL      +++  G+   +I    DY+APE+L  +P     D+WS G+++  ++TG C  F+   E K E+ F  I      FP      I+E     I +CLV  P  RIS  + L
Sbjct:   33 EPLTE-----RFTIEGEIGRGKFAVVRKIRDNHSGQEYA-AKYIRKRRKGKDVRSEILHEVVMLEMALAHPRLIDLKEVYETSHELVLITEYAAGG--ELFHHIDEEESFKEK-EVIHLMRQIMEGLVFLHDRNVVHLDLKPQNILLTNPHPHGDVKLCDFGFARLVNYGEDIRDIIGTPDYVAPEVLSYEPIGTYTDIWSVGVLVYVMLTG-CSPFAG--EDKQET-FLNISQVNLDFPEDLFCDISENAIDFISKCLVRQPGERISARDCL 292          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3N5L7S7 (Serine/threonine protein kinase (Fragment) OS=Acidobacteria bacterium OX=1978231 GN=EHM61_25595 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 8.552e-15
Identity = 68/256 (26.56%), Postives = 119/256 (46.48%), Query Frame = 2
Query: 1352 IYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKT---RIASND----EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPG--------------QKRNEI---NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRI 2047
            +Y+A D   N++VA+        + F+N+   +   ++   + AS     I AIY  E   S  + +M +        ++GKT   R+A       E +   R+I EGL   H+ GIV+ +L  +++ +  +G  K+    + K + G              Q R  +      Y++PE  + +  + +AD+W+FG IL E +TGK   F A+T  +  +   K +    +FP +I  R K ++ RCL +DP  R+
Sbjct:  102 VYRAEDTNLNRQVAIKVLP----ETFLNDRERLARFQREAQLLASLNHPNIAAIYGLERTESSPLLIMEL--------IEGKTLAERLAKGPLPVVEALTICREIAEGLEAAHEKGIVHRDLKPANVKITPEGQAKILDFGLAKALQGEPDSSEHSPEISEVQTRTGVILGTAAYMSPEQANGRAVDKRADIWAFGCILFECLTGK-RAFEAETATETMAAILKSEPDWNLFPAAIPWRTKDLLHRCLQKDPRERL 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:103028616])

HSP 1 Score: 74.7146 bits (182), Expect = 1.430e-13
Identity = 77/266 (28.95%), Postives = 126/266 (47.37%), Query Frame = 2
Query: 1295 VGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAIS-LKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSK---GDIKLASINIGKII--PGQKRNEIN-KDYLAPEILDNKPWNIKADVWSFGIILLEIITGKC-FNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            +GR +F+++   KK     + KAT      +    + R  D KA      +I E+  L    ++ R V + A Y+ E  + + +E  A   + EH  + +    + S  +VI+  RQ LEG+  LH   +V+ +L   +ILL S    GDIKL    + + +   G+ R  +   +Y+APEIL+ +P    +D+WS G+I   +ITG+  F    K +         +DY K  F   ++E     I + LV+ P  R S  + LS
Sbjct:   38 LGRGKFAVV---KKC----VEKATGKVFAAKFVRKRRRGRDCKA-----EVIHEMAVLEAAKSNPRVVNLHAAYETEHDIVLLLEYAAGGEIFEHCVSDE----LLSEGQVIRLIRQTLEGIHQLHQSNVVHLDLKPQNILLTSLNPLGDIKLVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTASDLWSVGVITYMLITGESPFAGEDKQQTFLNVSQVNVDYSKEAF-ARVSELAVHFIRKLLVKAPEDRPSAADCLS 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 75.8702 bits (185), Expect = 1.862e-13
Identity = 74/287 (25.78%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q +        +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++    +  KADVWS G  ++E++T K        E +  +  FKI  +    I P   +E+ +  I R  VE   +R S  ELL
Sbjct:  336 SRLRPQDRPV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK----PPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELL 611          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 75.8702 bits (185), Expect = 1.862e-13
Identity = 74/287 (25.78%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q +        +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++    +  KADVWS G  ++E++T K        E +  +  FKI  +    I P   +E+ +  I R  VE   +R S  ELL
Sbjct:  336 SRLRPQDRPV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK----PPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELL 611          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 75.8702 bits (185), Expect = 1.862e-13
Identity = 74/287 (25.78%), Postives = 131/287 (45.64%), Query Frame = 2
Query: 1247 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-------PGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKY--IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q +        +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL      K +        G +       +++PE++    +  KADVWS G  ++E++T K        E +  +  FKI  +    I P   +E+ +  I R  VE   +R S  ELL
Sbjct:  336 SRLRPQDRPV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK----PPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELL 611          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 74.7146 bits (182), Expect = 6.062e-13
Identity = 51/165 (30.91%), Postives = 85/165 (51.52%), Query Frame = 2
Query: 1604 IASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDS-KGDIKLASINIGK----IIPGQKRNEINKDYLAPEILDNKP--WNIKADVWSFGIILLEIITGKC--FNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            + +N+  I +Y +QILEGL  LHD+ I + ++   ++L+++  G +K++     K    I P  +       Y+APEI+D  P  +   AD+WS G  ++E+ TGK   +       A  +   FKI  +    P S++   K  I RC   DP+ R + +ELL+
Sbjct:  739 LKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPE---IPDSMSSEAKAFILRCFEPDPDLRATANELLT 900          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 70.8626 bits (172), Expect = 2.482e-13
Identity = 74/272 (27.21%), Postives = 119/272 (43.75%), Query Frame = 2
Query: 1352 IYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKD----YLAPEI-LDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKI----------------DYKKYIFPVSINERFKGVIDRCLVE-----------DPNYRISVHELLS 2068
            +YKA +    + VAL + RL D +     S+ I+E+  L  +N     VR+  I   E  + +  EL+   LK   K +D  T       ++K Y  Q+L+G+A  H H I++ +L   ++L++++G IKLA   + +     +R   ++     Y APEI L  K ++   DVWS G I  E++T +   F   +E       F+                 DYK   FP   N+    V+     E           DPN R++ +  LS
Sbjct:   18 VYKARNKLTGEAVALKKIRL-DTETEGVPSTAIREISLLRELN-HPNIVRLLTIIHSEKKLYLVFELLDQDLK---KFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRAL-FPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPDYKS-TFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMALS 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 70.0922 bits (170), Expect = 3.231e-13
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 2
Query: 1640 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKI-IPGQKRNEI---NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISV 2053
            +I+ GL  LHD GI+Y +L + +ILLD  G +K+A   + K  I G  R        DY+APEI+  + +N   D WSFG++L E++ G+   F    E   E  F  I      +P  I +  + ++   L  +P  R+ V
Sbjct:   96 EIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQS-PFRGDDE---EELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGV 233          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 71.2478 bits (173), Expect = 1.073e-12
Identity = 47/196 (23.98%), Postives = 95/196 (48.47%), Query Frame = 2
Query: 1496 VRIFAIYKGEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKII-PGQKRNEI---NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            V+  + +K E  + + +EL    SL    ++     ++ +  EV  + RQ++ GL  LH  G+V+ +L + +  +    ++K+  + +   + P + R        +YLAPE+L+ +    +AD+WS G  +  ++ G+   FS    A     +  I   ++ FP S++   + ++   L  DP+ R S+ +L S
Sbjct:   88 VQFISSFKDENFIYIILELCNGQSLAHMLRS----RKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPNYLAPEVLNKRGHGPEADIWSLGCAVFTMLAGRP-PFSTSDLANT---YACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQS 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 3.567e-12
Identity = 48/171 (28.07%), Postives = 79/171 (46.20%), Query Frame = 2
Query: 1577 FKAVDG-KTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQK---RNEINKDY-LAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSIN--ERFKGVIDRCLVEDPNYRISVHELLS 2068
            FK ++  K  + S D+++ W  Q+   L  +HD  I++ ++   +I L   G ++L    I +++       R  I   Y L+PEI +NKP+N K+D+W+ G +L E+ T          EA N  +      +    PVS +     +  +   L  DP  R  V  LLS
Sbjct:   89 FKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCT-----LRHAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLS 254          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 68.5514 bits (166), Expect = 4.134e-12
Identity = 47/155 (30.32%), Postives = 77/155 (49.68%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDEL--TMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTE------AKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            R+IL+GL  LH    ++ ++    +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N             KN     + +Y K          FK  +D CL +DP +R +  ELL
Sbjct:  128 REILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKA---------FKEFVDSCLNKDPQFRPTAKELL 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 72.4034 bits (176), Expect = 1.423e-13
Identity = 46/147 (31.29%), Postives = 71/147 (48.30%), Query Frame = 2
Query: 1616 DEVIKWYR-QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEIN-KDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRIS 2050
            + V K+Y  ++   L  LH   I+Y +L   +ILLD  G IK+      K +P          DY+APE++  KP+N   D WSFGI++ E++ G    + + T    E    KI   +  FP   NE  K ++ R +  D + R+ 
Sbjct:  184 NPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYE----KILNAELRFPPFFNEDVKDLLSRLITRDLSQRLG 326          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 73.1738 bits (178), Expect = 1.936e-13
Identity = 44/168 (26.19%), Postives = 83/168 (49.40%), Query Frame = 2
Query: 1613 NDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEIN-----------------KDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHEL 2062
            N+   ++Y  QI++ +  LH+ GI++ ++   +ILLD    +KL      KI+P +  N  +                  +Y++PE+L++   + + D+W+FG IL +++ GK   F A  E        KI   +Y F     +  K ++ + LV DPN R+++ ++
Sbjct:  222 NETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKP-PFKAANEYLTFQKVMKI---QYAFTAGFPQIVKDLVKKLLVRDPNDRLTIKQI 385          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 71.633 bits (174), Expect = 3.825e-13
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 1484 SERFVRIFAIYKGEGLVSV--SMELMAI-SLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKD------YLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFP---------VSINERFKGVIDRCLVEDPNYRISVHELL 2065
            S+  V+ + ++  E   S+  +ME M   SL+  +K +  +    S   + K    +L GL+ LH+  +++ ++   +ILL+ KG+IKL    +     G+  N +         Y+APE +  +P+++  DVWS G+ LLE+  G+ F F +    +N +    +       P         +S ++ F+  ID CL +D   R S  ++L
Sbjct:  270 SDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS----GEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGR-FPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQML 476          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 71.633 bits (174), Expect = 7.082e-13
Identity = 47/155 (30.32%), Postives = 84/155 (54.19%), Query Frame = 2
Query: 1619 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKG-DIKLASINIGKI-IPGQ--KRNEINKDYLAPEILDNKPWN-IKADVWSFGIILLEIITGK-CFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            E I +++QI+EG++  H   I + +L   ++LLD K   IK+A   +  + +P +  K +  +  Y +PEI+  +P++   +DVWS GI+L  ++TG   FN     +   +    K+   KY  P +++   + +I + LV DP  RI+  E+L
Sbjct:  215 EAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFN-----DDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEIL 364          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 68.5514 bits (166), Expect = 3.159e-12
Identity = 54/212 (25.47%), Postives = 100/212 (47.17%), Query Frame = 2
Query: 1484 SERFVRIFAIYKGE--GLVSVSMELMA-ISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKD------YLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFP---------VSINERFKGVIDRCLVEDPNYRISVHELL 2065
            SE  VR + ++  +    + ++ME M   SL   +K +  +    S   + K    +L GL+ LH+  +++ ++   +ILL+  G +KL    +     G+  N +         Y+APE +  +P+++ +DVWS G+ +LE+  GK F  S++  A N + F  + +     P         +  +  FK  ID CL +D   R S  +++
Sbjct:  277 SEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS----GEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGK-FPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMI 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 79.7221 bits (195), Expect = 5.502e-16
Identity = 43/157 (27.39%), Postives = 82/157 (52.23%), Query Frame = 2
Query: 1610 SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN----IGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            S ++V    R +L+ L  LH  G+++ ++    ILL S G +KL+       + + +P +K       ++APE++  KP+  + D+WS GI++LE++ G+   F+ +   +       ++      P+ I+ R +  +D  L+ DP YR +  ELL+
Sbjct:  121 SEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFN-EPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLN 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 78.1814 bits (191), Expect = 1.245e-15
Identity = 52/170 (30.59%), Postives = 90/170 (52.94%), Query Frame = 2
Query: 1577 FKAVDGKTRIA-SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQ---KRNEINKDY-LAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHF-FKIDYKKY-IFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            +K ++G+  IA S D+V+ W+ QI  GL  +HD  I++ ++   +I L   G IK+    I +++       R  I   Y L+PEI++N+P+N K+D+WS G +L E++T          EA N  +   KI    Y   P+  +   + ++ + L  +P+ R SV+ +L
Sbjct:   89 YKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLT-----LKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVL 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 73.559 bits (179), Expect = 8.217e-14
Identity = 44/149 (29.53%), Postives = 79/149 (53.02%), Query Frame = 2
Query: 1628 KWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLS 2068
            K+ RQ+ + LA  H   +++ ++   ++LL+ KGDIK+A        P  +R  +    DYL PE+++ K  + K D+WS G++  E + GK   F A  E  NE+ + +I      FP  ++   + +I + L  +PN R+ +  +L+
Sbjct:  150 KYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKP-PFEA--EGHNET-YRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLN 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 72.7886 bits (177), Expect = 7.353e-13
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query: 1640 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGK--IIPGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFK-IDYKKYIFPV 1981
            +++  L  LH +G++Y +L + ++LLD+ G IKLA   + K  + PG+         DY+APEIL  +P+    D W+ G+++ E++ G+        EA+NE   F+ I +   ++PV
Sbjct:  490 EVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQ-----PPFEAENEEDLFESILHDDVLYPV 603          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH03])

HSP 1 Score: 68.1662 bits (165), Expect = 2.213e-12
Identity = 58/201 (28.86%), Postives = 98/201 (48.76%), Query Frame = 2
Query: 1490 RFVRIFAIYKGEGLVSVSMEL-MAISLKEHFKAVDGKTRIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSK---GDIKLASINIGKII-PGQKRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITG-----------KCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVED 2032
            + +++  +Y+    + + +EL +   L  H  A+D     +S  E  V+   RQILEG+  LH    V+ ++  ++ILL +     +IK+    + + I PG++   I    +Y+APEIL+ +P    +D+WS G++   ++TG            C+N S       ESHF  I Y    F  ++ +R  G  DR  VED
Sbjct:   55 KIIQLHEVYETRTELILVLELALGGDLHRHCVALDSDEPASSRSEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNILLMTDEIYPEIKIIDFGLARRIKPGEQICLIVGTPEYVAPEILEFEPVGKPSDIWSIGVLAYVMLTGMSPFAGDDKHETCYNVSLCAIDFPESHFDNISYTAQDFIRTVLQRCPG--DRPTVED 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 72.7886 bits (177), Expect = 9.965e-13
Identity = 56/188 (29.79%), Postives = 99/188 (52.66%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVI-KWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G       ++++ K    I++ L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D     KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  153 VFIAMELMGTCAEKLKKRIQGPI----PEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLL 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 72.7886 bits (177), Expect = 1.114e-12
Identity = 56/188 (29.79%), Postives = 99/188 (52.66%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVI-KWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G       ++++ K    I++ L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D     KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  209 VFIAMELMGTCAEKLKKRIQGPI----PEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLL 392          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 72.4034 bits (176), Expect = 1.380e-12
Identity = 56/188 (29.79%), Postives = 99/188 (52.66%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVI-KWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G       ++++ K    I++ L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D     KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  209 VFIAMELMGTCAEKLKKRIQGPI----PEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLL 392          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 72.0182 bits (175), Expect = 1.863e-12
Identity = 56/188 (29.79%), Postives = 99/188 (52.66%), Query Frame = 2
Query: 1532 VSVSMELMAISLKEHFKAVDGKTRIASNDEVI-KWYRQILEGLACLHD-HGIVYDELTMSHILLDSKGDIKLASINI-GKII--PGQKRNEINKDYLAPEILD----NKP-WNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            V ++MELM    ++  K + G       ++++ K    I++ L  L + HG+++ ++  S+ILLD+KG IKL    I G+++    + R+     Y+APE +D     KP ++I+ADVWS GI L+E+ TG+    + KT+ +  +   + D       +  +  F+  +  CL +D   R   H+LL
Sbjct:  193 VFIAMELMGTCAEKLKKRIQGPI----PEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLL 376          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 71.633 bits (174), Expect = 2.390e-12
Identity = 45/152 (29.61%), Postives = 81/152 (53.29%), Query Frame = 2
Query: 1637 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI-GKIIPGQ-KRNEI--NKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDY--KKYIFPV---SINERFKGVIDRCLVEDPNYRISVHELL 2065
            R+IL+GL  LH    ++ ++  +++LL  +GD+KLA   + G++   Q KRN       ++APE++    ++ KAD+WS GI  +E+  G+  N        ++ H  ++ +   K   P      ++ FK  ++ CL +DP +R +  ELL
Sbjct:  122 REILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPN--------SDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELL 265          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003862.1 (SMESG000003862.1)

HSP 1 Score: 1306.58 bits (3380), Expect = 0.000e+0
Identity = 645/655 (98.47%), Postives = 646/655 (98.63%), Query Frame = 2
Query:  101 MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLEKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELL 2065
            MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLK RLPTENKVIELH YGN+NVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTL KAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVI  CL EDPN RISV  LL
Sbjct:    1 MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKLRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIHSCLNEDPNNRISVRVLL 655          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 412/641 (64.27%), Postives = 492/641 (76.76%), Query Frame = 2
Query:  155 QEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLEKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLSID 2074
            +EPISVCS+NRP+ L DSKCAN+  IC+KQDD +C+QLQ +CKQCPPS++TV          KY+L+N +I IL  N+V F LL+ ENRFK+I KF          N Y ++ SRK +  ++N IGDFGTKLKFRLPTENKVIELH YGNDNVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T E A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI   I G K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAK EA N+S+FFKIDY KYIFP SINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:    8 KEPISVCSQNRPYTLFDSKCANFFDICTKQDDYECDQLQASCKQCPPSKITV----------KYQLMNIMIQILTFNIVIFVLLIIENRFKLIKKF----------NTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 617          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 357/544 (65.62%), Postives = 423/544 (77.76%), Query Frame = 2
Query:  446 SLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLEKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLSID 2074
            S     ++ N Y ++ SRK +  ++N IGDFGTKLKFRLPTENKVIELH YGNDNVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T E A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI   I G K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAK EA N+S+FFKIDY KYIFP SINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:   63 SFKASNEKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 595          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 357/544 (65.62%), Postives = 423/544 (77.76%), Query Frame = 2
Query:  446 SLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLEKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHELLSID 2074
            S     ++ N Y ++ SRK +  ++N IGDFGTKLKFRLPTENKVIELH YGNDNVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T E A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI   I G K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAK EA N+S+FFKIDY KYIFP SINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:   47 SFKASNEKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 579          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003859.1 (SMESG000003859.1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 363/657 (55.25%), Postives = 473/657 (71.99%), Query Frame = 2
Query:  101 MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDDDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVK-PSDAANYSDLNNPDLTLEKAGVKDNDQIVAITKKPVKIMFSSILSNDE-NFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRISVHEL 2062
            M LFV  IYL ILS +NG+EPISVC+R  PFRLSDSKCAN+  IC K+DD QCN LQ+ACKQCPPS++TVI+LQEILRIVKYRLVNFLI I   NVV   LL+ ENRFK+I+K C  + KKK+++ Y LL+SRK  T  +N   D G  LKF +P + K IELH YGN+N V +KKR+CKKWP+A++ SYK+MK I  G  LDDN+ ++S I S++ EI CQ+DYS++  +ILVLRV GI+R TELVQI+K KKISDLN+ILCKLLDQSDLV +VK P  AANYSDLNN + TLE AGVKDND+I AITK  VK  FSSIL +DE +F   L N+E+ S+I ++V+ KFKS D VL++  + + S++F+FQY+I D  +I YCRF  + A  ++ KPLKE + R + S       +E + +YKA DNF+ +E AL++Y+LSDWK+F  N +LIKEL +L ++ + ERFV IF +YK    + VSMELM +S+K      + +  + S   ++KW +QILEGLA LHD GI+YD LTMSHI+LDSK DIKL+SI+IGK+    K NE N  Y APE+L N+PWNIK+DVWSFG++L EIITGK F+        N   + +I   + +FP    + F+ +I  CL+++P  RISV +L
Sbjct:    1 MILFVFVIYLCILSTLNGEEPISVCAREFPFRLSDSKCANFNAICVKKDDAQCNLLQDACKQCPPSKITVIILQEILRIVKYRLVNFLIVIFTFNVVVVILLMLENRFKLISKCCFSVIKKKKIDYYQLLRSRKRITAVSNFTKDSGVNLKFLVPLK-KSIELHVYGNENNVSVKKRICKKWPEARAGSYKMMKFICNGVELDDNQYLMSCITSYKDEITCQLDYSLDIRNILVLRVNGIKRHTELVQIDKDKKISDLNKILCKLLDQSDLVTFVKKPVKAANYSDLNNEEQTLENAGVKDNDRIAAITKISVKTKFSSILEDDEASFEINLLNIEKASTIYSLVKNKFKSSDFVLMMNNQHLKSDKFMFQYHIVDVGEINYCRFYSLSALTEDEKPLKEKIKR-KLS-------KENASLYKAIDNFSKQESALLKYKLSDWKSFKENPNLIKELSRLKIVKSHERFVEIFGLYKSASEIGVSMELMVMSMKNILDIPENRKELVSFKNIVKWSQQILEGLAFLHDQGIIYDNLTMSHIILDSKSDIKLSSISIGKLFTDHKSNEKNAVYRAPELLKNEPWNIKSDVWSFGVVLFEIITGKDFHLPTANN-DNNPDWIEISGNESMFPEGKYKWFEDIIKNCLIKNPINRISVKKL 647          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK268.649e-1329.11serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
MAP3K31.571e-1228.64mitogen-activated protein kinase kinase kinase 3 [... [more]
STK261.596e-1230.26serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
RSKR1.704e-1230.60ribosomal protein S6 kinase related [Source:HGNC S... [more]
MAP3K31.761e-1228.64mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-26.312e-1530.19Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.167e-1430.19Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-24.158e-1430.19Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-24.177e-1430.19Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-24.224e-1430.19Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inaC1.051e-1231.85gene:FBgn0004784 transcript:FBtr0087047[more]
aPKC4.066e-1230.71gene:FBgn0261854 transcript:FBtr0303432[more]
aPKC4.309e-1230.71gene:FBgn0261854 transcript:FBtr0303433[more]
aPKC4.494e-1230.71gene:FBgn0261854 transcript:FBtr0303429[more]
Akt14.497e-1229.30gene:FBgn0010379 transcript:FBtr0083226[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k31.072e-1325.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.790e-1325.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.965e-1325.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map2k75.570e-1330.48mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k76.089e-1330.48mitogen-activated protein kinase kinase 7 [Source:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045672.15.131e-1526.73protein kinase C delta type-like [Source:NCBI gene... [more]
cpvl5.772e-1329.34carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
cpvl5.928e-1329.34carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
cpvl6.856e-1329.34carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
ENSXETT00000045494.16.991e-1326.09MAP/microtubule affinity-regulating kinase 4 [Sour... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk261.032e-1229.75serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk261.095e-1230.92serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
4921509C19Rik1.575e-1233.33RIKEN cDNA 4921509C19 gene [Source:MGI Symbol;Acc:... [more]
Gm141471.630e-1233.33predicted gene 14147 [Source:MGI Symbol;Acc:MGI:36... [more]
Gm141471.630e-1233.33predicted gene 14147 [Source:MGI Symbol;Acc:MGI:36... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0PKV7|MKK5_LEIME3.410e-1324.90Mitogen-activated protein kinase kinase 5 OS=Leish... [more]
sp|G5EGQ3|MAX2_CAEEL5.288e-1330.19Serine/threonine-protein kinase max-2 OS=Caenorhab... [more]
sp|Q7XIW5|CIPKT_ORYSJ9.069e-1323.49CBL-interacting protein kinase 29 OS=Oryza sativa ... [more]
sp|O22040|ANP1_ARATH1.763e-1230.57Mitogen-activated protein kinase kinase kinase ANP... [more]
sp|Q55GC2|DST2_DICDI1.808e-1233.54Serine/threonine-protein kinase dst2 OS=Dictyostel... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A167KRR54.239e-1626.14Protein kinase domain-containing protein (Fragment... [more]
A0A2V8LVA04.576e-1627.10Protein kinase domain-containing protein OS=Acidob... [more]
A0A1S3HQ822.220e-1529.67serine/threonine-protein kinase 17A-like isoform X... [more]
A0A1S3HRL92.387e-1529.67serine/threonine-protein kinase 17A-like isoform X... [more]
A0A3N5L7S78.552e-1526.56Serine/threonine protein kinase (Fragment) OS=Acid... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b1.430e-1328.95serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
map3k31.862e-1325.78mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.862e-1325.78mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.862e-1325.78mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k56.062e-1330.91mitogen-activated protein kinase kinase kinase 5 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk22.482e-1327.21cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
PRKCD3.231e-1333.10protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
plk31.073e-1223.98polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000007414.13.567e-1228.07pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
stk25a4.134e-1230.32serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK11.423e-1331.29cAMP-dependent protein kinase catalytic subunit; p... [more]
PKH11.936e-1326.19Serine/threonine protein kinase; involved in sphin... [more]
MKK23.825e-1325.94MAPKK involved in the protein kinase C signaling p... [more]
HSL17.082e-1330.32Nim1p-related protein kinase; septin-binding kinas... [more]
MKK13.159e-1225.47MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458465.502e-1627.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498221.245e-1530.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354378.217e-1429.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355857.353e-1331.93Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO370242.213e-1228.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k79.965e-1329.79mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k71.114e-1229.79mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k71.380e-1229.79mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k71.863e-1229.79mitogen-activated protein kinase kinase 7 [Source:... [more]
stk25b2.390e-1229.61serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003862.10.000e+098.47SMESG000003862.1[more]
SMESG000003878.10.000e+064.27SMESG000003878.1[more]
SMESG000003878.10.000e+065.63SMESG000003878.1[more]
SMESG000003878.10.000e+065.63SMESG000003878.1[more]
SMESG000003859.10.000e+055.25SMESG000003859.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030383 ID=SMED30030383|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3952bp
CGTGAACAAACTGATATTATGTTCAGTTTATCAAAATCACTTATTTGTTT
GACTGATCTAAAGTTTAGATCTAAACGAATCATTCAAATTTGTATTTGAC
ATGAATTTATTTGTTATCTTTATTTATTTATATATTTTATCAAATGTTAA
TGGTCAAGAACCGATATCAGTTTGTTCACGGAATCGCCCATTTAGACTAT
CCGATAGCAAATGCGCCAATTACACTGGGATTTGTTCAAAACAAGATGAT
GACCAGTGCAATCAATTACAAAATGCGTGCAAGCAATGCCCTCCGAGCGA
AATGACAGTGATAATGCTACAGGAAATATTGAGAATTGTAAAATATCGAC
TTGTTAATTTTTTGATTGCCATTTTGATTGTCAATGTTGTCGCCTTCTTT
CTACTGGTATTTGAGAATCGGTTCAAGATTATAACTAAATTCTGTTCATT
GTTATGCAAAAAAAAGCAAGTTAACGTGTACCATTTGTTGCAGAGCAGGA
AAGGAAAAACATATTACGCAAATTGTATTGGAGATTTTGGGACAAAATTG
AAGTTCCGATTACCTACAGAAAACAAGGTGATAGAGCTGCATGCTTATGG
CAATGACAATGTTGTCAAAATAAAGAAACGTGTTTGCAAGAAGTGGCCCA
AAGCTAAATCAGATAGTTACAAAATAATGAAATTGATATATAAAGGGAAA
TGCCTTGATGACAATGAGAATATTTTGTCACTCATTGGGTCACACAGAGG
TGAAATATTGTGCCAGATGGATTACTCTGTGAATGCCAGTGACATTCTCG
TTCTCCGAGTGGCTGGCATCAGGCGAGACACTGAGCTCGTTCAAATTAAT
AAAGGGAAAAAGATTTCTGATCTAAATCAGATCTTGTGCAAATTACTTGA
CCAGTCAGATCTTGTTATATATGTGAAACCTAGCGACGCAGCCAATTATT
CAGATTTAAATAATCCCGATTTGACCTTGGAGAAGGCCGGTGTCAAGGAC
AATGATCAAATTGTTGCAATCACAAAAAAACCCGTAAAAATTATGTTTTC
ATCAATCCTTAGTAATGACGAAAATTTCAATAGTGAGTTATCGAATGTTG
AAAGGGTTTCGTCGATTTTGAATATAGTTGAACAAAAATTTAAATCTGAA
GATGTTTTAATAATTGGTGAACGTGACATGATATCAGAGCAATTTCTGTT
CCAGTATAATATTGATGACGAGAGCCAGATCAAATATTGCAGATTTAATG
AGATGGACGCACAGGATCAAGAAGTGAAGCCTCTTAAAGAATCAGTGGGA
AGATTGAGGTTTAGCATTATTGGCATATTTAAAAAGCAAGAGTTATCACA
AATATACAAAGCAACGGATAATTTCAACAATAAAGAGGTTGCTTTGATGC
AGTATAGACTATCCGATTGGAAGGCTTTTATAAACAATTCTAGTTTGATA
AAGGAGCTGAGAAAACTCACAGTAATGAATGCAAGTGAAAGATTTGTGCG
GATATTTGCCATATATAAAGGCGAGGGGTTGGTATCTGTGTCCATGGAAT
TGATGGCGATATCATTGAAAGAACATTTTAAAGCTGTTGATGGCAAAACC
AGAATAGCCTCAAATGATGAAGTTATTAAATGGTATCGACAAATTCTTGA
AGGCCTCGCCTGTCTTCATGATCACGGCATTGTATATGATGAGCTGACAA
TGTCTCACATTCTTCTGGATAGCAAAGGGGACATCAAGCTAGCCAGCATC
AATATTGGTAAAATAATTCCTGGACAAAAAAGAAATGAAATAAATAAAGA
TTATCTTGCTCCTGAGATTTTGGACAATAAACCGTGGAACATTAAGGCCG
ACGTGTGGTCATTTGGAATCATTCTGCTGGAGATTATTACCGGGAAATGT
TTCAATTTCAGTGCAAAAACTGAAGCTAAAAATGAATCCCATTTCTTCAA
AATTGATTATAAGAAATATATTTTCCCAGTATCAATAAATGAAAGGTTCA
AGGGCGTCATTGACAGGTGCTTGGTTGAGGATCCGAATTATAGGATATCT
GTGCACGAGCTACTGAGCATTGATTTACTGAGATCCTTTTGAAGGCTCTC
GCAATTCCTGTTTGCCGACTGGTTACATTAATTATTGCCGCAATATTTAT
TATTTACCATTATTAATTTTGTTACTTTATCTTTTTTTAAAGGTGCTGAT
TTTGGATAATTTATTTTCTTCAATTGATCTTTTCAAAAACACCAGATAAT
TTCCAAATGCACTTTTAGTAGCCATGGTGACGAGGACCTTCCTTTTACCA
TTCATATGGATCATCAGATGGAGTATTCCCATCAAAAGAGTGCGTTGACT
TTAAAGCTGGTGTGAAAGAGAAATTAATTATTTTTCTTTATTATTAATTA
TTATCATTAACTTATTGATCCGCTTTGAATAGTTTTTGGGTGAGGAAAAT
CATGACTGAATGAGATTATCTTTTTCCTACATAAATTAAATGTTGACTCA
AATGGAAACAGATTAATATCAAAGTATAGATAACCTCCCAAAAACCTGAA
ATAAATCAAATACAATAAGCAGAACATGGGAAAAGAACAATTATATAATA
CGTTGAGCATTTTATTTGCCAATAATAAACTATCACCAAGGCGTACGCAT
GAATGAGAACTAGCCGAATAGCAGAGCTATGCATAAACTGAAATCCAATT
AGCGGCATTAACTACGCTAAATTGTTCTGATTTATATTGATATTTATTAA
TTAATTTACAAATGTATCCCAAATTCAAATTGATTATTAATGAACTAAAA
CTCAATATAACAGTTAAATTAATTTAGACATTCATTGTAAGCATGATCTA
TTTGTTTAAAATGCATTTGATCGCTTTCCCGAAAATGCAATGCATCGAGA
GGGAACTGCAGTAGAAAACTAGCGTGATTATTCATATCGTCTGAATCAAT
CAGATATCGTTCGATAAGTTGCAACTCAGAAAAATTTAATTTTTTTTAAT
GTTTCGTACGTACGATTGTTCACTATTTACTAATACATACATATACTGTG
GGCAGGTGACACGTTGTGTTTGTCACGGTTGCAGATTACTGAGCAAGAGC
GATTATTTACAACGTTAAACTTCGATATAATTATTATTTCTTAACATATT
TTAATTTTTCTTTTCATGTTCCATTCATTGGATATATTTATCAGATAGAC
ATTACTAATATCTAACAAATGGTAGCAATAACAAGAATTTTGAGGTACAA
ATGTACTCCGCGCAGTGTTGTAAAGGTTAATCATAGTATTTTCTTAAAAT
AAAAATCACTACCCAAAACATAGTTTTCAATTATAAACGTGATGTTGAGC
ACATATATCGATCTTTCTTGAGATTCAAAATGCAGTTTTGAACAAAAATA
ATGATCTGTCGAAAATTGTGTAATGTAAATAAAGTTTTTGCTATTAATTT
CAGCTTTTAAAATTAGAAGAAATGTAATGGACAATGACTAAAATTTAAGT
TTATTTTGGTAAATACAACTTGTATATGGTTGTTTTCTCATCAGACATAG
GTCAAACTTGACATTCAGAAAAGTAAGTCGATTTCAAGTCAAAAATAAGA
AATTCCCAGTAAAAATAGAAGTTTTATGTAGATCAAATGACATTGATTAA
CTCGAGTGCTTGCGCGCGGCTTAAATCGACCCAGACTTCAAACACGTATA
ATATTTTATTTAAAAATTCAAATAACTTTTTTCTTTGATAGCTTAGTTAT
GCAATGCTTTGAATAAGTCACATATGTCTCAGATCTAGGAAATTGTAGAA
CAGCAGTTGGAATATCATCCTTACGTAATTCAGCATTATAAATATTTCGA
CCTGTAATATATCAGGTCGATCAAAGCTTGACATCATATATTTTCATAAA
TTAAAAAAATAAGGATGGAAAAGGTAAATAACTTTGTTAAGTATCGCAAT
AT
back to top

protein sequence of SMED30030383-orf-1

>SMED30030383-orf-1 ID=SMED30030383-orf-1|Name=SMED30030383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MNLFVIFIYLYILSNVNGQEPISVCSRNRPFRLSDSKCANYTGICSKQDD
DQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFF
LLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKL
KFRLPTENKVIELHAYGNDNVVKIKKRVCKKWPKAKSDSYKIMKLIYKGK
CLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQIN
KGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLEKAGVKD
NDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSE
DVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVG
RLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLI
KELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKT
RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASI
NIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKC
FNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIDRCLVEDPNYRIS
VHELLSIDLLRSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR039540UBL3-like_ubiquitin_dom
IPR000626Ubiquitin-like_dom
IPR000719Prot_kinase_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039540UBL3-like, ubiquitin domainPFAMPF13881Rad60-SLD_2coord: 149..208
e-value: 2.3E-6
score: 27.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 381..645
e-value: 1.1E-32
score: 115.2
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 143..219
e-value: 4.1E-7
score: 31.7
NoneNo IPR availablePANTHERPTHR44305FAMILY NOT NAMEDcoord: 437..645
NoneNo IPR availablePANTHERPTHR44305:SF12TYROSINE-PROTEIN KINASE C03B1.5-RELATEDcoord: 437..645
NoneNo IPR availableCDDcd00180PKccoord: 416..595
e-value: 1.81642E-22
score: 93.8743
NoneNo IPR availableCDDcd01814Ubl_MUBs_plantcoord: 150..206
e-value: 1.4403E-4
score: 38.8993
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.81
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 415..645
e-value: 7.3E-27
score: 94.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 404..645
score: 24.485
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 148..208
score: 9.134
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 403..645
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 149..208