POU domain protein

Overview
NamePOU domain protein
Smed IDSMED30030379
Uniprot Best hitPOU domain, class 3, transcription factor 3-A OS=Danio rerio OX=7955 GN=pou3f3a PE=2 SV=2 (E=3.7915e-81)
Length (bp)1625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of POU domain protein (SMED30030379) t-SNE clustered cells

Violin plots show distribution of expression levels for POU domain protein (SMED30030379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of POU domain protein (SMED30030379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for POU domain protein (SMED30030379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: tL58QO8P

 

back to top

Expression Details

POU domain protein ( pou2/3 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the protonephridia, renal system and protonephridial progenitor cell

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30030379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30030379SMESG000076173.1 dd_Smed_v4_8234_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
X2 cellSMED30030379SMESG000076173.1 SmedASXL_008748SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
protonephridial progenitor cellSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
proximal tubuleSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
protonephridial progenitor cellSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
proximal tubuleSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
protonephridial progenitor cellSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
protonephridiaSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:24523458whole organismasexual adultcolorimetric in situ hybridization evidence
proximal tubuleSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
protonephridial progenitor cellSMED30030379SMESG000076173.1 SMED30030379smed_20140614PMID:29906446FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
distal tubuleSMED30030379SMESG000076173.1 POU2/3smed_ncbi_20200123PMID:21937596whole organismasexual adultfluorescence in situ hybridization evidence
proximal tubuleSMED30030379SMESG000076173.1 POU2/3smed_ncbi_20200123PMID:21937596whole organismasexual adultfluorescence in situ hybridization evidence
Homology
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F2 (POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:9215])

HSP 1 Score: 258.84 bits (660), Expect = 6.835e-80
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  266 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV 438          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F4 (POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:9217])

HSP 1 Score: 253.832 bits (647), Expect = 4.895e-79
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  190 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 339          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 257.299 bits (656), Expect = 9.431e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  318 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 487          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 257.299 bits (656), Expect = 9.431e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  318 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 487          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F1 (POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9214])

HSP 1 Score: 252.292 bits (643), Expect = 2.089e-77
Identity = 122/159 (76.73%), Postives = 136/159 (85.53%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP------PPLN 1255
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DS+  +P+ +DK+ A GRKRKKRTSIEVGVK ALESHF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP      PP++
Sbjct:  251 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMD 409          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-6 (Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Prot;Acc:P20268])

HSP 1 Score: 226.868 bits (577), Expect = 5.976e-69
Identity = 121/188 (64.36%), Postives = 143/188 (76.06%), Query Frame = 2
Query:  770 EISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAP-SGIDKVTA-AGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM------TPPPL---NG--TSSDLFPHPGLT 1294
            +IS  +++   D+LE FAK FKQRRIKLG+TQADVG+ALG LYG++FSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P S  +K+T  AGRKRKKRTSIEV VK+ LE HF    KP AQ ITQ+A  L LEKEVVRVWFCNRRQKEKR+       P P+   NG   ++DLFP+  + 
Sbjct:  182 DISDDSEQTCPDDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIAPNQYDAPHPMALNNGYPMTADLFPYQAVV 369          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 159.073 bits (401), Expect = 3.787e-42
Identity = 87/209 (41.63%), Postives = 122/209 (58.37%), Query Frame = 2
Query:  785 NQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADST----GCAPSGIDK---------------------------VTAAG--------RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP----PLNGTSSDLFPH 1282
            + +I  +ELE FA+ FK++RIK GFTQ DVG+ALG  YG+ FSQTTI RFEAL LSFKNMCKLRPLL +WL + +            IDK                           VTA+         ++R+KRT++++  +NAL++ F+   +P    +T +A+SL L+++VVRVWFCNRRQK +R+  P     +  + S +FPH
Sbjct:  288 DDRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRVDEPIEGEMVTPSVSPVFPH 496          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 158.688 bits (400), Expect = 4.092e-42
Identity = 87/209 (41.63%), Postives = 122/209 (58.37%), Query Frame = 2
Query:  785 NQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADST----GCAPSGIDK---------------------------VTAAG--------RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP----PLNGTSSDLFPH 1282
            + +I  +ELE FA+ FK++RIK GFTQ DVG+ALG  YG+ FSQTTI RFEAL LSFKNMCKLRPLL +WL + +            IDK                           VTA+         ++R+KRT++++  +NAL++ F+   +P    +T +A+SL L+++VVRVWFCNRRQK +R+  P     +  + S +FPH
Sbjct:  290 DDRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRVDEPIEGEMVTPSVSPVFPH 498          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 140.198 bits (352), Expect = 2.425e-37
Identity = 75/150 (50.00%), Postives = 97/150 (64.67%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAA---GRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKR 1234
            +LE FA+ FKQRRIKLG TQADVG AL +L     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL++A+        I  +        K++KRTSI    K  LE  F +Q +P+ + I  +AD L L+K VVRVWFCN+RQK+KR
Sbjct:  106 QLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 254          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 140.969 bits (354), Expect = 4.326e-37
Identity = 75/150 (50.00%), Postives = 97/150 (64.67%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAA---GRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKR 1234
            +LE FA+ FKQRRIKLG TQADVG AL +L     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL++A+        I  +        K++KRTSI    K  LE  F +Q +P+ + I  +AD L L+K VVRVWFCN+RQK+KR
Sbjct:  162 QLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 310          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0345911)

HSP 1 Score: 262.692 bits (670), Expect = 5.715e-82
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0076944)

HSP 1 Score: 262.692 bits (670), Expect = 5.715e-82
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0330059)

HSP 1 Score: 263.848 bits (673), Expect = 2.175e-79
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0346998)

HSP 1 Score: 263.848 bits (673), Expect = 2.744e-79
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0346999)

HSP 1 Score: 263.462 bits (672), Expect = 4.579e-79
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 265.774 bits (678), Expect = 9.859e-83
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 265.003 bits (676), Expect = 1.180e-82
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:NCBI gene;Acc:30386])

HSP 1 Score: 263.462 bits (672), Expect = 5.023e-82
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f2b (POU class 3 homeobox 2b [Source:NCBI gene;Acc:30397])

HSP 1 Score: 261.536 bits (667), Expect = 6.136e-82
Identity = 129/170 (75.88%), Postives = 141/170 (82.94%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  PL GT     D  PH G+
Sbjct:  204 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGPLPGTEDVYGDTPPHHGV 373          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f2b (POU class 3 homeobox 2b [Source:NCBI gene;Acc:30397])

HSP 1 Score: 261.536 bits (667), Expect = 6.136e-82
Identity = 129/170 (75.88%), Postives = 141/170 (82.94%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  PL GT     D  PH G+
Sbjct:  204 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGPLPGTEDVYGDTPPHHGV 373          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f2 (POU class 3 homeobox 2 [Source:NCBI gene;Acc:100486226])

HSP 1 Score: 260.766 bits (665), Expect = 1.542e-81
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  205 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTIPGPEDVYGASRDTPPHHGV 377          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: slc25a38 (solute carrier family 25 member 38 [Source:Xenbase;Acc:XB-GENE-5814283])

HSP 1 Score: 257.684 bits (657), Expect = 1.872e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G  VG D
Sbjct:  266 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-NVGAD 435          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: tecta.1 (tectorin alpha, gene 1 [Source:Xenbase;Acc:XB-GENE-1011878])

HSP 1 Score: 254.988 bits (650), Expect = 2.060e-79
Identity = 120/149 (80.54%), Postives = 132/149 (88.59%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP 1243
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DST  +P+ +DK+ A GRKRKKRTSIEVGVK ALE+HF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP
Sbjct:  198 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSTTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 346          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f4 (POU class 3 homeobox 4 [Source:NCBI gene;Acc:100036711])

HSP 1 Score: 254.603 bits (649), Expect = 2.394e-79
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  189 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 338          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: efl1 (elongation factor like GTPase 1 [Source:Xenbase;Acc:XB-GENE-5894854])

HSP 1 Score: 204.912 bits (520), Expect = 6.507e-58
Identity = 113/224 (50.45%), Postives = 143/224 (63.84%), Query Frame = 2
Query:  599 HWVDSKPT-TVNSQ-LLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEA-----DSTGCAPSGIDK----VTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            + + S+P+ T+ SQ   PT +I+A P+Q        + QS+  P  +DT              L +    +ELEQFAK FKQRRIKLGFTQ DVGLA+G LYG+ FSQTTI RFEAL LSFKNMCKL+PLL KWL +A     DS+    S ++     +    R+RKKRTSIE  ++ ALE  F    KPT++ IT +AD L +EKEV+RVWFCNRRQKEKR+
Sbjct:  235 NLLQSQPSITLTSQPATPTRTIAATPVQQ-------LPQSQTTPKRIDTP------------SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENITSDSSLSNQSVLNSPGHGMEGLNRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRI 439          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f2 (POU domain, class 3, transcription factor 2 [Source:MGI Symbol;Acc:MGI:101895])

HSP 1 Score: 258.84 bits (660), Expect = 4.960e-80
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  268 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV 440          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f4 (POU domain, class 3, transcription factor 4 [Source:MGI Symbol;Acc:MGI:101894])

HSP 1 Score: 253.832 bits (647), Expect = 3.186e-79
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  190 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 339          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f3 (POU domain, class 3, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102564])

HSP 1 Score: 257.299 bits (656), Expect = 6.801e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  315 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 484          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f3 (POU domain, class 3, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102564])

HSP 1 Score: 257.299 bits (656), Expect = 6.801e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  315 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 484          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f1 (POU domain, class 3, transcription factor 1 [Source:MGI Symbol;Acc:MGI:101896])

HSP 1 Score: 251.906 bits (642), Expect = 2.054e-77
Identity = 122/159 (76.73%), Postives = 136/159 (85.53%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP------PPLN 1255
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DS+  +P+ +DK+ A GRKRKKRTSIEVGVK ALESHF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP      PP++
Sbjct:  249 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMD 407          
BLAST of POU domain protein vs. UniProt
Match: sp|P56224|P3F3A_DANRE (POU domain, class 3, transcription factor 3-A OS=Danio rerio OX=7955 GN=pou3f3a PE=2 SV=2)

HSP 1 Score: 263.462 bits (672), Expect = 3.792e-81
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. UniProt
Match: sp|P79746|PO3F2_DANRE (POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 4.632e-81
Identity = 129/170 (75.88%), Postives = 141/170 (82.94%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  PL GT     D  PH G+
Sbjct:  204 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGPLPGTEDVYGDTPPHHGV 373          
BLAST of POU domain protein vs. UniProt
Match: sp|P16241|CF1A_DROME (POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5)

HSP 1 Score: 262.692 bits (670), Expect = 5.728e-81
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. UniProt
Match: sp|P70030|P3F2B_XENLA (POU domain, class 3, transcription factor 2-B OS=Xenopus laevis OX=8355 GN=pou3f2-b PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.866e-80
Identity = 128/173 (73.99%), Postives = 141/173 (81.50%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  208 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTIPGAEDVYGASRDTPPHLGV 380          
BLAST of POU domain protein vs. UniProt
Match: sp|Q17237|SGF3_BOMMO (Silk gland factor 3 OS=Bombyx mori OX=7091 GN=SGF3 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.519e-80
Identity = 122/150 (81.33%), Postives = 133/150 (88.67%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  153 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 302          
BLAST of POU domain protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18530172 (tr|O17487|O17487_ARTSF POU domain protein OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 5.526e-81
Identity = 131/181 (72.38%), Postives = 147/181 (81.22%), Query Frame = 2
Query:  755 IDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTV 1297
            +D +G      +  ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +QSKP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  NG +S     PG+ V
Sbjct:  158 LDHDGLHDTEEENPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQSKPSAQEITALADSLQLEKEVVRVWFCNRRQKEKRMTPPVPNGPNS-----PGMRV 333          
BLAST of POU domain protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20302925 (tr|A0A1S3I3F7|A0A1S3I3F7_LINUN POU domain protein OS=Lingula unguis OX=7574 GN=LOC106160339 PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.296e-80
Identity = 134/188 (71.28%), Postives = 149/188 (79.26%), Query Frame = 2
Query:  722 PTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHP 1285
            P   D  + D    + EIS  +   S D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE+HF +Q KP+AQ ITQLADSL LEKEVVRVWFCNRRQKEKRMTPP   G + +  P P
Sbjct:  155 PALRDPTVDDLERQHAEISDEDTPTS-DDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTSGSPTSIDKIAAQGRKRKKRTSIEVTVKGALENHFLKQPKPSAQEITQLADSLQLEKEVVRVWFCNRRQKEKRMTPPGTIGPNGEFIPAP 341          
BLAST of POU domain protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22515698 (tr|A0A3R7MN56|A0A3R7MN56_PENVA POU domain protein OS=Penaeus vannamei OX=6689 GN=C7M84_025394 PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.686e-80
Identity = 124/160 (77.50%), Postives = 139/160 (86.88%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLF 1276
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ I+QLAD+L LEKEVVRVWFCNRRQKEKRMTPP LNG  + + 
Sbjct:  140 TSDDLEAFAKSFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEISQLADTLQLEKEVVRVWFCNRRQKEKRMTPPILNGPDTQVV 299          
BLAST of POU domain protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20234283 (tr|A0A2P6L9N0|A0A2P6L9N0_NEPCL POU domain protein OS=Nephila clavipes OX=2585209 GN=NCL1_11965 PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.474e-80
Identity = 127/169 (75.15%), Postives = 141/169 (83.43%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTVGT 1303
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE+HF +Q KP AQ I  LADSL LEKEVVRVWFCNRRQKEKRMT PP+N  +       GL +G+
Sbjct:  172 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLAKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALENHFHKQPKPAAQEIANLADSLQLEKEVVRVWFCNRRQKEKRMT-PPMNMGAGGQMTEGGLMMGS 339          
BLAST of POU domain protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21985143 (tr|T1IUA9|T1IUA9_STRMM POU domain protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 6.625e-80
Identity = 128/182 (70.33%), Postives = 147/182 (80.77%), Query Frame = 2
Query:  707 QSEYCPTNVDTELQDQIDSNGEI--SRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            Q  + P  +  ++ ++  +N E   S  +   ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +Q KP+AQ I  LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  128 QMAHHPAMLHRDVHNESPANPEHQESGEDDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALESHFHKQPKPSAQEIASLADSLQLEKEVVRVWFCNRRQKEKRMTPP 309          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou3f3a (POU class 3 homeobox 3 [Source:NCBI gene;Acc:103040687])

HSP 1 Score: 259.61 bits (662), Expect = 1.230e-80
Identity = 124/164 (75.61%), Postives = 140/164 (85.37%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  +  D++   G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVGQSPEDVYSQAG 409          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: POU3F4 (POU class 3 homeobox 4 [Source:NCBI gene;Acc:103039910])

HSP 1 Score: 255.758 bits (652), Expect = 4.394e-80
Identity = 121/150 (80.67%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +PS IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  182 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPSSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 331          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: ENSAMXT00000041388.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 254.603 bits (649), Expect = 1.463e-78
Identity = 122/164 (74.39%), Postives = 139/164 (84.76%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  +++   G
Sbjct:  246 TSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEEVYSQVG 409          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: ENSAMXT00000040961.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 254.988 bits (650), Expect = 3.103e-78
Identity = 122/164 (74.39%), Postives = 139/164 (84.76%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  +++   G
Sbjct:  292 TSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEEVYSQVG 455          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: ENSAMXT00000030028.1 (POU domain, class 3, transcription factor 3-B-like [Source:NCBI gene;Acc:103021364])

HSP 1 Score: 254.218 bits (648), Expect = 7.577e-78
Identity = 122/164 (74.39%), Postives = 139/164 (84.76%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  +++   G
Sbjct:  292 TSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEEVYSQVG 455          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou2f1b (POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2422])

HSP 1 Score: 196.052 bits (497), Expect = 6.619e-58
Identity = 98/157 (62.42%), Postives = 120/157 (76.43%), Query Frame = 2
Query:  803 DELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQE-----ADST----GCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            +ELE FAK+FKQRRIKLGFTQ DVGLA+G LYG+ FSQTTI RFEAL LSFKNMCKL+PLL KWL +     ADS+      +PSG++ +   GR+RKKRTSI+  V+ ALE  F    KPT++ ++ +A+ L +EKEVVRVWFCNRRQKEKR+ PP
Sbjct:  213 EELEVFAKMFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDTEHIPADSSPGNQNASPSGLEGL---GRRRKKRTSIDTHVRVALEKSFLENCKPTSEELSMIAEQLHMEKEVVRVWFCNRRQKEKRINPP 366          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou4f2 (POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-040401-1])

HSP 1 Score: 154.066 bits (388), Expect = 2.696e-42
Identity = 79/148 (53.38%), Postives = 103/148 (69.59%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            ELE FA+ FKQRRIKLG TQADVG ALGNL     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL+EA+           +   G K++KRTSI    K +LE++F+ Q +P+++ I  +A+ L L+K VVRVWFCN+RQK+KRM
Sbjct:  210 ELEAFAERFKQRRIKLGVTQADVGSALGNLKIPGVGSL-SQSTICRFESLTLSHNNMIALKPILQAWLEEAEKAHRNKQTKPDLFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM 356          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002675.1 (pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 gene:ENSPMAG00000002443.1 transcript:ENSPMAT00000002675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 9.323e-32
Identity = 64/160 (40.00%), Postives = 91/160 (56.88%), Query Frame = 2
Query:  788 QKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEA------------DSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEK 1231
            + +  +E+ +FAK+FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L L+ K+  K+RP+L +W+ EA            D  G  PS         ++RK+RTS        L +HF     PT+  +TQ+A+ LG ++EVVR+WFCN+RQ  K
Sbjct:    1 EAVDLEEIREFAKVFKLRRLALGLTQTQVGQALSAAEGPAYSQSAICRFEKLDLTPKSAQKMRPILERWMGEAEARHRMGTHTLTDFIGSEPS---------KRRKRRTSFTQEALVILNAHFDVGMHPTSAEMTQIAEQLGYDREVVRIWFCNKRQALK 151          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 121.324 bits (303), Expect = 4.339e-31
Identity = 60/151 (39.74%), Postives = 94/151 (62.25%), Query Frame = 2
Query:  794 ISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVT-----AAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEK 1231
            ++ +E+ +FA+ FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L ++ K+  K++P+L +W++EA++   A  G+  ++        +KRK+RTS        L +HF R + P+ Q +T +A+ L  ++EVVRVWFCN+RQ  K
Sbjct:  141 VNLEEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMEEAEARKQA--GLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALK 289          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 120.939 bits (302), Expect = 5.419e-31
Identity = 60/151 (39.74%), Postives = 94/151 (62.25%), Query Frame = 2
Query:  794 ISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVT-----AAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEK 1231
            ++ +E+ +FA+ FK RR+ LG TQ  VG AL    G  +SQ+ ICRFE L ++ K+  K++P+L +W++EA++   A  G+  ++        +KRK+RTS        L +HF R + P+ Q +T +A+ L  ++EVVRVWFCN+RQ  K
Sbjct:  138 VNLEEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMEEAEARKQA--GLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALK 286          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO33532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRV9])

HSP 1 Score: 243.432 bits (620), Expect = 3.455e-78
Identity = 115/148 (77.70%), Postives = 130/148 (87.84%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMT 1240
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EAD+   A  G+DK+   GRKRKKRTSIEV VK ALE+HF +  KPTAQ I+ LA++LGL+KEVVRVWFCNRRQKEKRMT
Sbjct:   38 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADNNNGATGGVDKLATTGRKRKKRTSIEVAVKGALENHFCKSPKPTAQEISALAENLGLDKEVVRVWFCNRRQKEKRMT 185          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO43881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXQ0])

HSP 1 Score: 191.815 bits (486), Expect = 1.132e-58
Identity = 95/156 (60.90%), Postives = 115/156 (73.72%), Query Frame = 2
Query:  803 DELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCA--------PSGIDKVTAAG--RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMT 1240
            DEL  FAK F+QRR+ LGFTQADVG+ALG LYG+V SQTTICRFEALQLS KNMCKL+PLL KWLQE D++           PS     T  G  +KRK+RT IE  VK  LE+HF +  +P+   I+ LA+SLGL++EVVRVWFCNRRQKE+R++
Sbjct:    7 DELSTFAKQFRQRRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRVS 162          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO30968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ94])

HSP 1 Score: 178.333 bits (451), Expect = 9.729e-54
Identity = 88/146 (60.27%), Postives = 108/146 (73.97%), Query Frame = 2
Query:  833 KQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCA--------PSGIDKVTAAG--RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMT 1240
            +QRR+ LGFTQADVG+ALG LYG+V SQTTICRFEALQLS KNMCKL+PLL KWLQE D++           PS     T  G  +KRK+RT IE  VK  LE+HF +  +P+   I+ LA+SLGL++EVVRVWFCNRRQKE+R++
Sbjct:    1 RQRRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQKERRVS 146          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO38767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC36])

HSP 1 Score: 177.948 bits (450), Expect = 2.442e-53
Identity = 86/144 (59.72%), Postives = 112/144 (77.78%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            ELE+FA  FK RRIKLGFTQ +VG AL  ++G+ FSQTTICRFE LQLSFKN CKL+P+L +WL+EA+ +G A     +   A R+RK+RT+I +  K ALE+HF +Q+KP++  I ++AD L L+KEVVRVWFCNRRQ+EKR+
Sbjct:    8 ELEEFATQFKLRRIKLGFTQTNVGAALAAVHGTDFSQTTICRFENLQLSFKNACKLKPILARWLEEAERSGGA---CGEKFGAERRRKRRTTIGLAAKEALENHFMKQTKPSSPEIVRIADGLRLDKEVVRVWFCNRRQREKRV 148          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO47033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB5])

HSP 1 Score: 139.813 bits (351), Expect = 3.731e-39
Identity = 75/148 (50.68%), Postives = 97/148 (65.54%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            ELE FA+ FKQRRIKLG TQADVG AL +L     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL+EA+                 K++KRTSI    K +LE++F+   +P++  I  +A+ L L K VVRVWFCN+RQK+KRM
Sbjct:    5 ELEWFAERFKQRRIKLGVTQADVGSALAHLKIPGVGSL-SQSTICRFESLTLSHNNMMALKPVLTAWLEEAEKAYKTKQCNSAFLPNSDKKRKRTSIGAAEKRSLEAYFAMNPRPSSDKIASIAEKLDLSKNVVRVWFCNQRQKKKRM 151          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou3f2a (POU domain, class 3, transcription factor 2-like [Source:NCBI gene;Acc:111947099])

HSP 1 Score: 256.144 bits (653), Expect = 1.810e-80
Identity = 125/168 (74.40%), Postives = 137/168 (81.55%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLF----PHPG 1288
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEVGVK ALESHF +  KP A  I  LADSL LEKEVVRVWFCNRRQKEKRMTP        D++    PH G
Sbjct:  172 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPGAAEINSLADSLQLEKEVVRVWFCNRRQKEKRMTPAGGQIAGEDMYGDTPPHHG 339          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou3f2b (POU domain, class 3, transcription factor 2 [Source:NCBI gene;Acc:101159940])

HSP 1 Score: 253.447 bits (646), Expect = 1.208e-79
Identity = 126/171 (73.68%), Postives = 141/171 (82.46%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTSSDLF----PHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  I  LAD+L LEKEVVRVWFCNRRQKEKRMTPP   L G S D++    PH G+
Sbjct:  151 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEIISLADNLHLEKEVVRVWFCNRRQKEKRMTPPGGALPG-SEDVYGDTPPHHGV 320          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou3f3a (POU domain, class 3, transcription factor 3-B [Source:NCBI gene;Acc:101174234])

HSP 1 Score: 252.677 bits (644), Expect = 4.377e-79
Identity = 124/170 (72.94%), Postives = 140/170 (82.35%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTVGTD 1306
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+   GRKRKKRTSIEV VK ALESHF +  KP+AQ I  LAD+L LEKEVVRVWFCNRRQKEKRMTPP L  +  D +   G ++G D
Sbjct:  161 TSDDLEHFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIATQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEINSLADTLQLEKEVVRVWFCNRRQKEKRMTPPGLPRSPEDSYSQVG-SLGPD 329          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou3f3b (POU domain, class 3, transcription factor 3-B [Source:NCBI gene;Acc:101162433])

HSP 1 Score: 254.218 bits (648), Expect = 1.641e-78
Identity = 122/160 (76.25%), Postives = 136/160 (85.00%), Query Frame = 2
Query:  809 LEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ I+ LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++   G
Sbjct:  244 LEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEISTLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVAQTPEDVYSQVG 403          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou3f3b (POU domain, class 3, transcription factor 3-B [Source:NCBI gene;Acc:101162433])

HSP 1 Score: 253.832 bits (647), Expect = 2.091e-78
Identity = 122/160 (76.25%), Postives = 136/160 (85.00%), Query Frame = 2
Query:  809 LEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ I+ LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++   G
Sbjct:  244 LEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEISTLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVAQTPEDVYSQVG 403          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000076173.1 (SMESG000076173.1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 465/466 (99.79%), Postives = 466/466 (100.00%), Query Frame = 2
Query:  167 MLTSGLNQEQSSPLTIVGMSESQFFNESIRYLPPETVERQSQFYANNNYPLGEFWNPQSEYAQYLQNTQPVSGPQFITSPAVGEAFYPSLYINTIHENVLLPSVDSFNPPSGFMISGYSQQDQTFPTVNEPTYDNIPNNWNYVDHWVDSKPTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTVGTDXXXXXXXXXXXXXXXXIGNQSSFNRIGDPSSTHPGVIVTSCGYYYGHVPNESLLNCGPYPHNIINNYEFRQSNDPNILNVKSECIS 1564
            MLTSGLNQEQSSPLTIVGMSESQFFNESIRYLPPETVERQSQFYANNNYPLGEFWNPQSEYAQYLQNTQPVSGPQFITSPAVGEAFYPSLYINTIHENVLLPSVDSFNPPSGFMISGYSQQDQTFPTVNEPTYDNIPNNWNYVDHWVDSKPTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTVGTDSSPHSSSHSNHDSFSSIGNQSSFNRIGDP+STHPGVIVTSCGYYYGHVPNESLLNCGPYPHNIINNYEFRQSNDPNILNVKSECIS
Sbjct:    1 MLTSGLNQEQSSPLTIVGMSESQFFNESIRYLPPETVERQSQFYANNNYPLGEFWNPQSEYAQYLQNTQPVSGPQFITSPAVGEAFYPSLYINTIHENVLLPSVDSFNPPSGFMISGYSQQDQTFPTVNEPTYDNIPNNWNYVDHWVDSKPTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTVGTDSSPHSSSHSNHDSFSSIGNQSSFNRIGDPASTHPGVIVTSCGYYYGHVPNESLLNCGPYPHNIINNYEFRQSNDPNILNVKSECIS 466          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000057970.1 (SMESG000057970.1)

HSP 1 Score: 243.817 bits (621), Expect = 2.892e-73
Identity = 114/149 (76.51%), Postives = 129/149 (86.58%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP 1243
            S+D+LEQFAK+FKQRRIKLG+TQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKLRPLL KWL EADS+  +P+  DK++A  RKRKKRTSIE  VK  LES F + SKP+AQ I+ LA+ L LEKEVVRVWFCNRRQKEKR+TP
Sbjct:  269 SSDDLEQFAKMFKQRRIKLGYTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLRPLLQKWLHEADSSSESPTNFDKISAQSRKRKKRTSIEANVKLILESSFMKLSKPSAQDISSLAEKLSLEKEVVRVWFCNRRQKEKRITP 417          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000008858.1 (SMESG000008858.1)

HSP 1 Score: 208.764 bits (530), Expect = 9.702e-60
Identity = 105/168 (62.50%), Postives = 127/168 (75.60%), Query Frame = 2
Query:  734 DTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEAD-STGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKR 1234
            D  L D I  N ++S ++ +    ELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNM KLRPLL KWL+EAD S       ++K+    R+RKKRT+IE+  K+ LES F++  KPTA  I  L++ + ++KEVVRVWFCNRRQKEK+
Sbjct:  295 DLFLSDSIIENSKLSTMDCR----ELEQFAKTFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMNKLRPLLSKWLEEADLSLSNTVVNVEKLANQNRQRKKRTNIEMNTKDILESSFNKDPKPTAAHIISLSERILMDKEVVRVWFCNRRQKEKK 458          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000013430.1 (SMESG000013430.1)

HSP 1 Score: 152.525 bits (384), Expect = 7.024e-41
Identity = 78/148 (52.70%), Postives = 102/148 (68.92%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNLYGS---VFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAP-SGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            ELE F++ FKQRRIKLG TQADVG ALGNL  S     SQ+TICRFE+L LS  NM  L+P+L  WL+EA+          D    +  +++KRTSI    K +LE++F+ Q +P+++ I Q+AD L L+K VVRVWFCN+RQK+KRM
Sbjct:  232 ELEIFSERFKQRRIKLGVTQADVGKALGNLKLSGVGSLSQSTICRFESLTLSHNNMVALKPILQAWLEEAERQAAERLKNPDIYNDSLDRKRKRTSITDAEKRSLEAYFAVQPRPSSEKIAQIADKLNLKKNVVRVWFCNQRQKQKRM 379          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000030759.1 (SMESG000030759.1)

HSP 1 Score: 150.984 bits (380), Expect = 1.109e-40
Identity = 80/156 (51.28%), Postives = 107/156 (68.59%), Query Frame = 2
Query:  800 TDELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAP-SGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL 1252
            T ELE FA+ FKQRRIKL  TQADVG ALGNL     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL++A++      +G D  +    +++KRTSI    K +LE+ F+ Q +P+++ I Q+A+ L L+K VVRVWFCN+RQK+KRM    L
Sbjct:  193 TRELEAFAEWFKQRRIKLRVTQADVGRALGNLKLAGVGSL-SQSTICRFESLTLSHNNMIALKPVLQTWLEDAETEAKERLNGSDAFSDIDERKRKRTSITDSEKRSLEAFFTIQPRPSSEKIIQIAEKLNLKKNVVRVWFCNQRQKQKRMKFSTL 347          
The following BLAST results are available for this feature:
BLAST of POU domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POU3F26.835e-8073.99POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F44.895e-7980.00POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F39.431e-7974.85POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F39.431e-7974.85POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F12.089e-7776.73POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of POU domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-65.976e-6964.36Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Pr... [more]
ceh-183.787e-4241.63Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
ceh-184.092e-4241.63Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
unc-862.425e-3750.00Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
unc-864.326e-3750.00Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
back to top
BLAST of POU domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vvl5.715e-8277.58gene:FBgn0086680 transcript:FBtr0345911[more]
vvl5.715e-8277.58gene:FBgn0086680 transcript:FBtr0076944[more]
vvl2.175e-7977.58gene:FBgn0086680 transcript:FBtr0330059[more]
vvl2.744e-7977.58gene:FBgn0086680 transcript:FBtr0346998[more]
vvl4.579e-7977.58gene:FBgn0086680 transcript:FBtr0346999[more]
back to top
BLAST of POU domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f3a9.859e-8376.83POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f3a1.180e-8276.83POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f3a5.023e-8276.83POU class 3 homeobox 3a [Source:NCBI gene;Acc:3038... [more]
pou3f2b6.136e-8275.88POU class 3 homeobox 2b [Source:NCBI gene;Acc:3039... [more]
pou3f2b6.136e-8275.88POU class 3 homeobox 2b [Source:NCBI gene;Acc:3039... [more]
back to top
BLAST of POU domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f21.542e-8173.99POU class 3 homeobox 2 [Source:NCBI gene;Acc:10048... [more]
slc25a381.872e-7974.85solute carrier family 25 member 38 [Source:Xenbase... [more]
tecta.12.060e-7980.54tectorin alpha, gene 1 [Source:Xenbase;Acc:XB-GENE... [more]
pou3f42.394e-7980.00POU class 3 homeobox 4 [Source:NCBI gene;Acc:10003... [more]
efl16.507e-5850.45elongation factor like GTPase 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of POU domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pou3f24.960e-8073.99POU domain, class 3, transcription factor 2 [Sourc... [more]
Pou3f43.186e-7980.00POU domain, class 3, transcription factor 4 [Sourc... [more]
Pou3f36.801e-7974.85POU domain, class 3, transcription factor 3 [Sourc... [more]
Pou3f36.801e-7974.85POU domain, class 3, transcription factor 3 [Sourc... [more]
Pou3f12.054e-7776.73POU domain, class 3, transcription factor 1 [Sourc... [more]
back to top
BLAST of POU domain protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56224|P3F3A_DANRE3.792e-8176.83POU domain, class 3, transcription factor 3-A OS=D... [more]
sp|P79746|PO3F2_DANRE4.632e-8175.88POU domain, class 3, transcription factor 2 OS=Dan... [more]
sp|P16241|CF1A_DROME5.728e-8177.58POU domain protein CF1A OS=Drosophila melanogaster... [more]
sp|P70030|P3F2B_XENLA1.866e-8073.99POU domain, class 3, transcription factor 2-B OS=X... [more]
sp|Q17237|SGF3_BOMMO5.519e-8081.33Silk gland factor 3 OS=Bombyx mori OX=7091 GN=SGF3... [more]
back to top
BLAST of POU domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|185301725.526e-8172.38tr|O17487|O17487_ARTSF POU domain protein OS=Artem... [more]
gnl|BL_ORD_ID|203029251.296e-8071.28tr|A0A1S3I3F7|A0A1S3I3F7_LINUN POU domain protein ... [more]
gnl|BL_ORD_ID|225156984.686e-8077.50tr|A0A3R7MN56|A0A3R7MN56_PENVA POU domain protein ... [more]
gnl|BL_ORD_ID|202342835.474e-8075.15tr|A0A2P6L9N0|A0A2P6L9N0_NEPCL POU domain protein ... [more]
gnl|BL_ORD_ID|219851436.625e-8070.33tr|T1IUA9|T1IUA9_STRMM POU domain protein OS=Strig... [more]
back to top
BLAST of POU domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f3a1.230e-8075.61POU class 3 homeobox 3 [Source:NCBI gene;Acc:10304... [more]
POU3F44.394e-8080.67POU class 3 homeobox 4 [Source:NCBI gene;Acc:10303... [more]
ENSAMXT00000041388.11.463e-7874.39POU domain, class 3, transcription factor 3-B-like... [more]
ENSAMXT00000040961.13.103e-7874.39POU domain, class 3, transcription factor 3-B-like... [more]
ENSAMXT00000030028.17.577e-7874.39POU domain, class 3, transcription factor 3-B-like... [more]
back to top
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou2f1b6.619e-5862.42POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou4f22.696e-4253.38POU class 4 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000002675.19.323e-3240.00pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 ge... [more]
pou6f24.339e-3139.74POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou6f25.419e-3139.74POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of POU domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of POU domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335323.455e-7877.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438811.132e-5860.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309689.729e-5460.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387672.442e-5359.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470333.731e-3950.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of POU domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f2a1.810e-8074.40POU domain, class 3, transcription factor 2-like [... [more]
pou3f2b1.208e-7973.68POU domain, class 3, transcription factor 2 [Sourc... [more]
pou3f3a4.377e-7972.94POU domain, class 3, transcription factor 3-B [Sou... [more]
pou3f3b1.641e-7876.25POU domain, class 3, transcription factor 3-B [Sou... [more]
pou3f3b2.091e-7876.25POU domain, class 3, transcription factor 3-B [Sou... [more]
back to top
BLAST of POU domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076173.10.000e+099.79SMESG000076173.1[more]
SMESG000057970.12.892e-7376.51SMESG000057970.1[more]
SMESG000008858.19.702e-6062.50SMESG000008858.1[more]
SMESG000013430.17.024e-4152.70SMESG000013430.1[more]
SMESG000030759.11.109e-4051.28SMESG000030759.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030379 ID=SMED30030379|Name=POU domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1625bp
AATTAGCTATGCGAGCTGCTTTATCAGGCATGACTGTGATAAAACTGTCA
TTATTTATGCGCATAATTTGCCGTTAGTATTTGCTCAACCAATTTGACGT
TCAACAACAACAGCAACAACATCCACCACCTCCACCAACATCCTCATTAT
CATTATTATTATTGTCATGTTAACAAGCGGACTTAATCAGGAACAATCAT
CGCCTTTAACAATCGTAGGCATGAGTGAGTCTCAGTTTTTCAACGAATCT
ATCAGATATTTGCCTCCGGAAACCGTGGAGAGACAAAGCCAATTTTATGC
AAATAATAATTATCCCCTTGGTGAGTTTTGGAATCCACAATCCGAATATG
CACAATACTTGCAAAATACCCAGCCAGTCTCGGGGCCTCAATTCATTACT
TCGCCGGCGGTTGGAGAGGCATTCTATCCATCTCTTTATATCAATACTAT
CCATGAAAATGTATTACTACCTTCGGTTGATTCCTTCAATCCTCCCAGTG
GATTTATGATTTCGGGATATTCACAGCAAGACCAAACCTTTCCCACGGTC
AATGAACCGACGTATGACAATATCCCAAACAATTGGAATTATGTTGATCA
TTGGGTTGATTCCAAGCCAACAACAGTGAATTCTCAGCTGTTGCCAACCT
CGTCAATTTCCGCCGTCCCCATTCAGAATTCGTTTTGGGACTGCGAGTCG
ATTGACCAATCAGAATATTGTCCCACAAATGTTGATACCGAGCTCCAAGA
TCAAATTGATTCCAACGGAGAAATCAGTAGACTCAATCAAAAGATTTCTA
CTGACGAGTTGGAGCAGTTTGCGAAAATTTTCAAACAGCGAAGAATCAAA
CTCGGATTTACACAAGCCGACGTCGGGTTAGCCCTCGGTAATTTATACGG
CAGCGTGTTCAGTCAAACAACAATTTGCCGGTTTGAGGCACTGCAGCTCA
GTTTTAAAAACATGTGCAAACTTCGACCTCTGTTAGGGAAGTGGTTGCAA
GAAGCCGACTCAACCGGATGTGCTCCGTCCGGTATTGACAAAGTCACAGC
TGCTGGACGAAAACGAAAAAAGCGAACCAGCATTGAGGTTGGAGTGAAAA
ATGCACTGGAATCTCACTTTTCTCGACAAAGCAAACCGACAGCCCAAATC
ATTACACAGCTTGCAGACAGTCTCGGATTGGAAAAAGAAGTTGTCAGGGT
ATGGTTCTGTAATCGGCGACAGAAGGAAAAACGAATGACGCCTCCGCCAC
TGAATGGAACAAGCTCAGATTTATTTCCACATCCTGGTTTAACTGTCGGA
ACTGATAGTTCTCCTCATTCCTCATCTCACAGTAATCATGATTCATTCTC
GTCCATTGGTAACCAGTCAAGCTTCAATCGAATAGGTGATCCCTCCTCGA
CTCATCCCGGAGTCATTGTCACATCTTGCGGTTATTACTATGGTCATGTT
CCAAATGAATCACTTCTCAATTGTGGGCCTTACCCTCACAACATCATCAA
CAATTACGAATTCAGACAGTCCAATGATCCCAATATCCTCAATGTCAAAT
CCGAGTGCATCAGCTGACTCATGTCGAACTCACCGAAAAGAAAGCTAATA
ATATTCTATTTCAATAATAATAAAA
back to top

protein sequence of SMED30030379-orf-1

>SMED30030379-orf-1 ID=SMED30030379-orf-1|Name=SMED30030379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MLTSGLNQEQSSPLTIVGMSESQFFNESIRYLPPETVERQSQFYANNNYP
LGEFWNPQSEYAQYLQNTQPVSGPQFITSPAVGEAFYPSLYINTIHENVL
LPSVDSFNPPSGFMISGYSQQDQTFPTVNEPTYDNIPNNWNYVDHWVDSK
PTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSN
GEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQ
TTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKR
KKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNR
RQKEKRMTPPPLNGTSSDLFPHPGLTVGTDSSPHSSSHSNHDSFSSIGNQ
SSFNRIGDPSSTHPGVIVTSCGYYYGHVPNESLLNCGPYPHNIINNYEFR
QSNDPNILNVKSECIS*
back to top
Aliases
The feature 'POU domain protein' has the following synonyms
Synonym
pou2/3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000053distal tubule
PLANA:0000087proximal tubule
PLANA:0002111X2 cell
PLANA:0000011protonephridial progenitor cell
PLANA:0000020protonephridia
PLANA:0000088renal system
Vocabulary: INTERPRO
TermDefinition
IPR013847POU
IPR001356Homeobox_dom
IPR000327POU_dom
IPR009057Homeobox-like_sf
IPR010982Lambda_DNA-bd_dom_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000005Stage 5
PLANA:0000007Stage 7
PLANA:0000006Stage 6
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013847POU domainPRINTSPR00028POUDOMAINcoord: 265..280
score: 69.6
coord: 333..348
score: 79.04
coord: 249..262
score: 89.58
coord: 298..318
score: 66.17
coord: 226..243
score: 79.22
IPR000327POU-specific domainSMARTSM00352poucoord: 207..281
e-value: 4.3E-50
score: 182.4
IPR000327POU-specific domainPFAMPF00157Poucoord: 212..281
e-value: 7.5E-36
score: 121.9
IPR000327POU-specific domainPROSITEPS00465POU_2coord: 249..262
IPR000327POU-specific domainPROSITEPS00035POU_1coord: 225..237
IPR000327POU-specific domainPROSITEPS51179POU_3coord: 207..281
score: 53.564
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 299..361
e-value: 3.4E-18
score: 76.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 300..356
e-value: 1.2E-17
score: 63.5
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 297..357
score: 16.633
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 300..357
e-value: 7.95197E-16
score: 69.5796
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 282..349
e-value: 1.2E-22
score: 81.5
NoneNo IPR availablePANTHERPTHR11636POU DOMAINcoord: 193..391
NoneNo IPR availablePANTHERPTHR11636:SF89POU DOMAIN PROTEIN 2, ISOFORM B-RELATEDcoord: 193..391
IPR010982Lambda repressor-like, DNA-binding domain superfamilyGENE3DG3DSA:1.10.260.40coord: 211..281
e-value: 1.4E-39
score: 135.9
IPR010982Lambda repressor-like, DNA-binding domain superfamilySUPERFAMILYSSF47413lambda repressor-like DNA-binding domainscoord: 209..281
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 332..355
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 287..357