POU domain protein

Overview
NamePOU domain protein
Smed IDSMED30030379
Uniprot Best hitPOU domain, class 3, transcription factor 3-A OS=Danio rerio GN=pou3f3a PE=2 SV=2 (E=7.90619e-80)
Length (bp)1625
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of POU domain protein (SMED30030379) t-SNE clustered cells

Violin plots show distribution of expression levels for POU domain protein (SMED30030379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of POU domain protein (SMED30030379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for POU domain protein (SMED30030379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

POU domain protein ( pou2/3 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the renal system, protonephridia and protonephridial progenitor

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F2 (POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:9215])

HSP 1 Score: 258.84 bits (660), Expect = 1.268e-78
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  266 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV 438          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F4 (POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:9217])

HSP 1 Score: 253.832 bits (647), Expect = 9.590e-78
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  190 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 339          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F3 (POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:9216])

HSP 1 Score: 257.299 bits (656), Expect = 1.609e-77
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  318 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 487          
BLAST of POU domain protein vs. Ensembl Human
Match: POU3F1 (POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9214])

HSP 1 Score: 252.292 bits (643), Expect = 3.623e-76
Identity = 122/159 (76.73%), Postives = 136/159 (85.53%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP------PPLN 1255
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DS+  +P+ +DK+ A GRKRKKRTSIEVGVK ALESHF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP      PP++
Sbjct:  251 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMD 409          
BLAST of POU domain protein vs. Ensembl Human
Match: POU2F1 (POU class 2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9212])

HSP 1 Score: 206.068 bits (523), Expect = 8.195e-58
Identity = 114/225 (50.67%), Postives = 145/225 (64.44%), Query Frame = 2
Query:  599 HWVDSKPT-TVNSQ-LLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPS----------GIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            + + S+P+ T+ SQ   PT +I+A PIQ       ++ QS+  P  +DT              L +    +ELEQFAK FKQRRIKLGFTQ DVGLA+G LYG+ FSQTTI RFEAL LSFKNMCKL+PLL KWL +A++     S          GI+ ++   R+RKKRTSIE  ++ ALE  F    KPT++ IT +AD L +EKEV+RVWFCNRRQKEKR+
Sbjct:  143 NLLQSQPSITLTSQPATPTRTIAATPIQ-------TLPQSQSTPKRIDTP------------SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLS---RRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRI 345          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-6 (Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Prot;Acc:P20268])

HSP 1 Score: 226.868 bits (577), Expect = 8.763e-68
Identity = 121/188 (64.36%), Postives = 143/188 (76.06%), Query Frame = 2
Query:  770 EISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAP-SGIDKVTA-AGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM------TPPPL---NG--TSSDLFPHPGLT 1294
            +IS  +++   D+LE FAK FKQRRIKLG+TQADVG+ALG LYG++FSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P S  +K+T  AGRKRKKRTSIEV VK+ LE HF    KP AQ ITQ+A  L LEKEVVRVWFCNRRQKEKR+       P P+   NG   ++DLFP+  + 
Sbjct:  182 DISDDSEQTCPDDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIAPNQYDAPHPMALNNGYPMTADLFPYQAVV 369          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 159.073 bits (401), Expect = 7.369e-42
Identity = 87/209 (41.63%), Postives = 122/209 (58.37%), Query Frame = 2
Query:  785 NQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADST----GCAPSGIDK---------------------------VTAAG--------RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP----PLNGTSSDLFPH 1282
            + +I  +ELE FA+ FK++RIK GFTQ DVG+ALG  YG+ FSQTTI RFEAL LSFKNMCKLRPLL +WL + +            IDK                           VTA+         ++R+KRT++++  +NAL++ F+   +P    +T +A+SL L+++VVRVWFCNRRQK +R+  P     +  + S +FPH
Sbjct:  288 DDRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRVDEPIEGEMVTPSVSPVFPH 496          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 158.688 bits (400), Expect = 7.844e-42
Identity = 87/209 (41.63%), Postives = 122/209 (58.37%), Query Frame = 2
Query:  785 NQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADST----GCAPSGIDK---------------------------VTAAG--------RKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP----PLNGTSSDLFPH 1282
            + +I  +ELE FA+ FK++RIK GFTQ DVG+ALG  YG+ FSQTTI RFEAL LSFKNMCKLRPLL +WL + +            IDK                           VTA+         ++R+KRT++++  +NAL++ F+   +P    +T +A+SL L+++VVRVWFCNRRQK +R+  P     +  + S +FPH
Sbjct:  290 DDRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMRRVDEPIEGEMVTPSVSPVFPH 498          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:RefSeq peptide;Acc:NP_498795])

HSP 1 Score: 140.198 bits (352), Expect = 8.236e-37
Identity = 75/150 (50.00%), Postives = 97/150 (64.67%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAA---GRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKR 1234
            +LE FA+ FKQRRIKLG TQADVG AL +L     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL++A+        I  +        K++KRTSI    K  LE  F +Q +P+ + I  +AD L L+K VVRVWFCN+RQK+KR
Sbjct:  124 QLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 272          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:RefSeq peptide;Acc:NP_498795])

HSP 1 Score: 140.969 bits (354), Expect = 8.249e-37
Identity = 75/150 (50.00%), Postives = 97/150 (64.67%), Query Frame = 2
Query:  806 ELEQFAKIFKQRRIKLGFTQADVGLALGNL----YGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAA---GRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKR 1234
            +LE FA+ FKQRRIKLG TQADVG AL +L     GS+ SQ+TICRFE+L LS  NM  L+P+L  WL++A+        I  +        K++KRTSI    K  LE  F +Q +P+ + I  +AD L L+K VVRVWFCN+RQK+KR
Sbjct:  162 QLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSL-SQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKR 310          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (ventral veins lacking [Source:FlyBase gene name;Acc:FBgn0086680])

HSP 1 Score: 262.692 bits (670), Expect = 1.216e-80
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (ventral veins lacking [Source:FlyBase gene name;Acc:FBgn0086680])

HSP 1 Score: 262.692 bits (670), Expect = 1.216e-80
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (ventral veins lacking [Source:FlyBase gene name;Acc:FBgn0086680])

HSP 1 Score: 263.848 bits (673), Expect = 3.849e-78
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (ventral veins lacking [Source:FlyBase gene name;Acc:FBgn0086680])

HSP 1 Score: 263.848 bits (673), Expect = 3.849e-78
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (ventral veins lacking [Source:FlyBase gene name;Acc:FBgn0086680])

HSP 1 Score: 263.848 bits (673), Expect = 3.849e-78
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-980526-220])

HSP 1 Score: 265.774 bits (678), Expect = 1.789e-81
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-980526-220])

HSP 1 Score: 265.003 bits (676), Expect = 2.170e-81
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f3a (POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-980526-220])

HSP 1 Score: 263.462 bits (672), Expect = 9.035e-81
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f2b (POU class 3 homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-980526-370])

HSP 1 Score: 261.536 bits (667), Expect = 1.161e-80
Identity = 129/170 (75.88%), Postives = 141/170 (82.94%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  PL GT     D  PH G+
Sbjct:  204 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGPLPGTEDVYGDTPPHHGV 373          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou3f2a (POU class 3 homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-980526-139])

HSP 1 Score: 254.218 bits (648), Expect = 2.170e-78
Identity = 125/169 (73.96%), Postives = 138/169 (81.66%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  I  LADSL LEKEVVRVWFCNRRQKEKRMTP   P+ G+     D  PH G
Sbjct:  163 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPGASEINSLADSLQLEKEVVRVWFCNRRQKEKRMTPQNGPMAGSEDVYGDASPHHG 331          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f2 (POU class 3 homeobox 2 [Source:Xenbase;Acc:XB-GENE-483174])

HSP 1 Score: 258.455 bits (659), Expect = 4.339e-81
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  105 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTIPGPEDVYGASRDTPPHHGV 277          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f3 (POU class 3 homeobox 3 [Source:Xenbase;Acc:XB-GENE-920672])

HSP 1 Score: 257.684 bits (657), Expect = 2.734e-79
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G  VG D
Sbjct:  216 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-NVGAD 385          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f1 (POU class 3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-853354])

HSP 1 Score: 254.988 bits (650), Expect = 1.400e-78
Identity = 120/149 (80.54%), Postives = 132/149 (88.59%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP 1243
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DST  +P+ +DK+ A GRKRKKRTSIEVGVK ALE+HF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP
Sbjct:  198 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSTTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP 346          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou3f4 (POU class 3 homeobox 4 [Source:Xenbase;Acc:XB-GENE-479667])

HSP 1 Score: 254.603 bits (649), Expect = 1.646e-78
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  189 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 338          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: POU2F1 (POU class 2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9212])

HSP 1 Score: 204.527 bits (519), Expect = 6.167e-58
Identity = 113/224 (50.45%), Postives = 143/224 (63.84%), Query Frame = 2
Query:  599 HWVDSKPT-TVNSQ-LLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEA-----DSTGCAPSGIDK----VTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            + + S+P+ T+ SQ   PT +I+A P+Q        + QS+  P  +DT              L +    +ELEQFAK FKQRRIKLGFTQ DVGLA+G LYG+ FSQTTI RFEAL LSFKNMCKL+PLL KWL +A     DS+    S ++     +    R+RKKRTSIE  ++ ALE  F    KPT++ IT +AD L +EKEV+RVWFCNRRQKEKR+
Sbjct:  249 NLLQSQPSITLTSQPATPTRTIAATPVQQ-------LPQSQTTPKRIDTP------------SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENITSDSSLSNQSVLNSPGHGMEGLNRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRI 453          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f2 (POU domain, class 3, transcription factor 2 [Source:MGI Symbol;Acc:MGI:101895])

HSP 1 Score: 258.84 bits (660), Expect = 8.823e-79
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  268 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV 440          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f4 (POU domain, class 3, transcription factor 4 [Source:MGI Symbol;Acc:MGI:101894])

HSP 1 Score: 253.832 bits (647), Expect = 6.001e-78
Identity = 120/150 (80.00%), Postives = 132/150 (88.00%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++DELEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK  LE+HF +  KP AQ I+ LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  190 TSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 339          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f3 (POU domain, class 3, transcription factor 3 [Source:MGI Symbol;Acc:MGI:102564])

HSP 1 Score: 257.299 bits (656), Expect = 1.118e-77
Identity = 128/171 (74.85%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPL-NGTSSDLFPHPGLTVGTD 1306
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP +   T  D++   G TV  D
Sbjct:  315 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVG-TVSAD 484          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou3f1 (POU domain, class 3, transcription factor 1 [Source:MGI Symbol;Acc:MGI:101896])

HSP 1 Score: 251.906 bits (642), Expect = 3.418e-76
Identity = 122/159 (76.73%), Postives = 136/159 (85.53%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP------PPLN 1255
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+E DS+  +P+ +DK+ A GRKRKKRTSIEVGVK ALESHF +  KP+A  IT LADSL LEKEVVRVWFCNRRQKEKRMTP      PP++
Sbjct:  249 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMD 407          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou2f1 (POU domain, class 2, transcription factor 1 [Source:MGI Symbol;Acc:MGI:101898])

HSP 1 Score: 203.756 bits (517), Expect = 2.891e-56
Identity = 110/226 (48.67%), Postives = 138/226 (61.06%), Query Frame = 2
Query:  605 VDSKPTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEAD---------------STGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRM 1237
            + S+PTT      PT +I+A  +Q       ++ QS+  P  +DT              L +    +ELEQFAK FKQRRIKLGFTQ DVGLA+G LYG+ FSQTTI RFEAL LSFKNMCKL+PLL KWL +A+               S G    G++      R+RKKRTSIE  ++ ALE  F    KPT++ IT +A+ L +EKEV+RVWFCNRRQKEKR+
Sbjct:  246 LTSQPTT------PTRTIAAASVQ-------TLPQSQSTPKRIDTP------------SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDSTASSPSALNSPGLGAEGLN------RRRKKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRI 440          
BLAST of POU domain protein vs. UniProt
Match: sp|P56224|P3F3A_DANRE (POU domain, class 3, transcription factor 3-A OS=Danio rerio GN=pou3f3a PE=2 SV=2)

HSP 1 Score: 263.462 bits (672), Expect = 7.906e-80
Identity = 126/164 (76.83%), Postives = 141/164 (85.98%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++ H G
Sbjct:  246 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVPQTPEDVYTHAG 409          
BLAST of POU domain protein vs. UniProt
Match: sp|P79746|PO3F2_DANRE (POU domain, class 3, transcription factor 2 OS=Danio rerio GN=pou3f2 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.016e-79
Identity = 129/170 (75.88%), Postives = 141/170 (82.94%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--PLNGTS---SDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ +DK+ A GRKRKKRTSIEV VK ALESHF +  KP A  IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  PL GT     D  PH G+
Sbjct:  204 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGPLPGTEDVYGDTPPHHGV 373          
BLAST of POU domain protein vs. UniProt
Match: sp|P16241|CF1A_DROME (POU domain protein CF1A OS=Drosophila melanogaster GN=vvl PE=2 SV=5)

HSP 1 Score: 262.692 bits (670), Expect = 1.202e-79
Identity = 128/165 (77.58%), Postives = 139/165 (84.24%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP-PLNGTSSDLFPHPG 1288
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  L G   D  P PG
Sbjct:  216 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMP-PG 379          
BLAST of POU domain protein vs. UniProt
Match: sp|P70030|P3F2B_XENLA (POU domain, class 3, transcription factor 2-B OS=Xenopus laevis GN=pou3f2-b PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 4.015e-79
Identity = 128/173 (73.99%), Postives = 141/173 (81.50%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:  208 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTIPGAEDVYGASRDTPPHLGV 380          
BLAST of POU domain protein vs. UniProt
Match: sp|Q17237|SGF3_BOMMO (Silk gland factor 3 OS=Bombyx mori GN=SGF3 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.210e-78
Identity = 122/150 (81.33%), Postives = 133/150 (88.67%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP 1246
            ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP
Sbjct:  153 TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPP 302          
BLAST of POU domain protein vs. TrEMBL
Match: tr|O17487|O17487_ARTSF (POU domain protein OS=Artemia franciscana PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 5.333e-80
Identity = 131/181 (72.38%), Postives = 147/181 (81.22%), Query Frame = 2
Query:  755 IDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPGLTV 1297
            +D +G      +  ++D+LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +QSKP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  NG +S     PG+ V
Sbjct:  158 LDHDGLHDTEEENPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQSKPSAQEITALADSLQLEKEVVRVWFCNRRQKEKRMTPPVPNGPNS-----PGMRV 333          
BLAST of POU domain protein vs. TrEMBL
Match: tr|A0A151NU07|A0A151NU07_ALLMI (POU domain protein OS=Alligator mississippiensis GN=POU3F2 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 8.705e-79
Identity = 128/173 (73.99%), Postives = 142/173 (82.08%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPP--------PLNGTSSDLFPHPGL 1291
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP         + G S D  PH G+
Sbjct:   13 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGASRDTPPHHGV 185          
BLAST of POU domain protein vs. TrEMBL
Match: tr|C5ILC6|C5ILC6_9CRUS (POU domain protein OS=Artemia sinica PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.436e-78
Identity = 127/171 (74.27%), Postives = 143/171 (83.63%), Query Frame = 2
Query:  755 IDSNGEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSS 1267
            +D +G      +  ++++LE FAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALE HF +QSKP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTPP  NG +S
Sbjct:  158 LDHDGLHDPEEENPTSEDLEGFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQSKPSAQEITALADSLQLEKEVVRVWFCNRRQKEKRMTPPVPNGPNS 328          
BLAST of POU domain protein vs. TrEMBL
Match: tr|R7UK02|R7UK02_CAPTE (POU domain protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_44575 PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.498e-78
Identity = 123/149 (82.55%), Postives = 134/149 (89.93%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTP 1243
            ++D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADST  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +Q KP+AQ IT LADSL LEKEVVRVWFCNRRQKEKRMTP
Sbjct:    8 TSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTSGSPTSIDKIAAQGRKRKKRTSIEVTVKGALESHFMKQPKPSAQEITHLADSLQLEKEVVRVWFCNRRQKEKRMTP 156          
BLAST of POU domain protein vs. TrEMBL
Match: tr|A0A146R4E9|A0A146R4E9_FUNHE (POU domain protein OS=Fundulus heteroclitus PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.660e-78
Identity = 124/164 (75.61%), Postives = 140/164 (85.37%), Query Frame = 2
Query:  797 STDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQTTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKRKKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNRRQKEKRMTPPPLNGTSSDLFPHPG 1288
            S+D+LEQFAK FKQRRIKLGFTQADVGLALG LYG+VFSQTTICRFEALQLSFKNMCKL+PLL KWL+EADS+  +P+ IDK+ A GRKRKKRTSIEV VK ALESHF +  KP+AQ I+ LAD+L LEKEVVRVWFCNRRQKEKRMTPP +  T  D++   G
Sbjct:   48 SSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEISTLADNLQLEKEVVRVWFCNRRQKEKRMTPPGVAQTPEDVYSQVG 211          
The following BLAST results are available for this feature:
BLAST of POU domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
POU3F21.268e-7873.99POU class 3 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F49.590e-7880.00POU class 3 homeobox 4 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F31.609e-7774.85POU class 3 homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
POU3F13.623e-7676.73POU class 3 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
POU2F18.195e-5850.67POU class 2 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of POU domain protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-68.763e-6864.36Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Pr... [more]
ceh-187.369e-4241.63Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
ceh-187.844e-4241.63Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
unc-868.236e-3750.00Transcription factor unc-86 [Source:RefSeq peptid... [more]
unc-868.249e-3750.00Transcription factor unc-86 [Source:RefSeq peptid... [more]
back to top
BLAST of POU domain protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
vvl1.216e-8077.58ventral veins lacking [Source:FlyBase gene name;Ac... [more]
vvl1.216e-8077.58ventral veins lacking [Source:FlyBase gene name;Ac... [more]
vvl3.849e-7877.58ventral veins lacking [Source:FlyBase gene name;Ac... [more]
vvl3.849e-7877.58ventral veins lacking [Source:FlyBase gene name;Ac... [more]
vvl3.849e-7877.58ventral veins lacking [Source:FlyBase gene name;Ac... [more]
back to top
BLAST of POU domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f3a1.789e-8176.83POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou3f3a2.170e-8176.83POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou3f3a9.035e-8176.83POU class 3 homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou3f2b1.161e-8075.88POU class 3 homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pou3f2a2.170e-7873.96POU class 3 homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of POU domain protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
pou3f24.339e-8173.99POU class 3 homeobox 2 [Source:Xenbase;Acc:XB-GENE... [more]
pou3f32.734e-7974.85POU class 3 homeobox 3 [Source:Xenbase;Acc:XB-GENE... [more]
pou3f11.400e-7880.54POU class 3 homeobox 1 [Source:Xenbase;Acc:XB-GENE... [more]
pou3f41.646e-7880.00POU class 3 homeobox 4 [Source:Xenbase;Acc:XB-GENE... [more]
POU2F16.167e-5850.45POU class 2 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of POU domain protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Pou3f28.823e-7973.99POU domain, class 3, transcription factor 2 [Sourc... [more]
Pou3f46.001e-7880.00POU domain, class 3, transcription factor 4 [Sourc... [more]
Pou3f31.118e-7774.85POU domain, class 3, transcription factor 3 [Sourc... [more]
Pou3f13.418e-7676.73POU domain, class 3, transcription factor 1 [Sourc... [more]
Pou2f12.891e-5648.67POU domain, class 2, transcription factor 1 [Sourc... [more]
back to top
BLAST of POU domain protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56224|P3F3A_DANRE7.906e-8076.83POU domain, class 3, transcription factor 3-A OS=D... [more]
sp|P79746|PO3F2_DANRE1.016e-7975.88POU domain, class 3, transcription factor 2 OS=Dan... [more]
sp|P16241|CF1A_DROME1.202e-7977.58POU domain protein CF1A OS=Drosophila melanogaster... [more]
sp|P70030|P3F2B_XENLA4.015e-7973.99POU domain, class 3, transcription factor 2-B OS=X... [more]
sp|Q17237|SGF3_BOMMO1.210e-7881.33Silk gland factor 3 OS=Bombyx mori GN=SGF3 PE=2 SV... [more]
back to top
BLAST of POU domain protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|O17487|O17487_ARTSF5.333e-8072.38POU domain protein OS=Artemia franciscana PE=2 SV=... [more]
tr|A0A151NU07|A0A151NU07_ALLMI8.705e-7973.99POU domain protein OS=Alligator mississippiensis G... [more]
tr|C5ILC6|C5ILC6_9CRUS1.436e-7874.27POU domain protein OS=Artemia sinica PE=2 SV=1[more]
tr|R7UK02|R7UK02_CAPTE1.498e-7882.55POU domain protein (Fragment) OS=Capitella teleta ... [more]
tr|A0A146R4E9|A0A146R4E9_FUNHE1.660e-7875.61POU domain protein OS=Fundulus heteroclitus PE=3 S... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 21..38
NoneNo IPR availableTMHMMTMhelixcoord: 12..29
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..21
score: 0.52
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR013847POU domainPRINTSPR00028POUDOMAINcoord: 272..285
score: 89.58
coord: 321..341
score: 66.17
coord: 249..266
score: 79.22
coord: 288..303
score: 69.6
coord: 356..371
score: 79.04
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 322..384
e-value: 3.4E-18
score: 76.4
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 323..379
e-value: 1.6E-17
score: 62.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 320..380
score: 16.633
IPR000327POU-specific domainSMARTSM00352poucoord: 230..304
e-value: 4.3E-50
score: 182.4
IPR000327POU-specific domainPFAMPF00157Poucoord: 235..304
e-value: 1.7E-36
score: 123.9
IPR000327POU-specific domainPROSITEPS00035POU_1coord: 248..260
IPR000327POU-specific domainPROSITEPS00465POU_2coord: 272..285
IPR000327POU-specific domainPROSITEPS51179POU_3coord: 230..304
score: 53.564
IPR009057Homeodomain-likeGENE3DG3DSA:1.10.10.60coord: 312..379
e-value: 2.4E-21
score: 75.3
IPR009057Homeodomain-likeSUPERFAMILYSSF46689Homeodomain-likecoord: 310..380
IPR010982Lambda repressor-like, DNA-binding domainGENE3DG3DSA:1.10.260.40coord: 235..304
e-value: 1.4E-39
score: 133.3
IPR010982Lambda repressor-like, DNA-binding domainSUPERFAMILYSSF47413lambda repressor-like DNA-binding domainscoord: 232..304
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 355..378

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000008Stage 8
PLANA:0000005Stage 5
PLANA:0000006Stage 6
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000011protonephridial progenitor
PLANA:0000088renal system
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR013847POU
IPR001356Homeobox_dom
IPR000327POU_dom
IPR009057Homeodomain-like
IPR010982Lambda_DNA-bd_dom
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030379 ID=SMED30030379|Name=POU domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1625bp
AATTAGCTATGCGAGCTGCTTTATCAGGCATGACTGTGATAAAACTGTCA
TTATTTATGCGCATAATTTGCCGTTAGTATTTGCTCAACCAATTTGACGT
TCAACAACAACAGCAACAACATCCACCACCTCCACCAACATCCTCATTAT
CATTATTATTATTGTCATGTTAACAAGCGGACTTAATCAGGAACAATCAT
CGCCTTTAACAATCGTAGGCATGAGTGAGTCTCAGTTTTTCAACGAATCT
ATCAGATATTTGCCTCCGGAAACCGTGGAGAGACAAAGCCAATTTTATGC
AAATAATAATTATCCCCTTGGTGAGTTTTGGAATCCACAATCCGAATATG
CACAATACTTGCAAAATACCCAGCCAGTCTCGGGGCCTCAATTCATTACT
TCGCCGGCGGTTGGAGAGGCATTCTATCCATCTCTTTATATCAATACTAT
CCATGAAAATGTATTACTACCTTCGGTTGATTCCTTCAATCCTCCCAGTG
GATTTATGATTTCGGGATATTCACAGCAAGACCAAACCTTTCCCACGGTC
AATGAACCGACGTATGACAATATCCCAAACAATTGGAATTATGTTGATCA
TTGGGTTGATTCCAAGCCAACAACAGTGAATTCTCAGCTGTTGCCAACCT
CGTCAATTTCCGCCGTCCCCATTCAGAATTCGTTTTGGGACTGCGAGTCG
ATTGACCAATCAGAATATTGTCCCACAAATGTTGATACCGAGCTCCAAGA
TCAAATTGATTCCAACGGAGAAATCAGTAGACTCAATCAAAAGATTTCTA
CTGACGAGTTGGAGCAGTTTGCGAAAATTTTCAAACAGCGAAGAATCAAA
CTCGGATTTACACAAGCCGACGTCGGGTTAGCCCTCGGTAATTTATACGG
CAGCGTGTTCAGTCAAACAACAATTTGCCGGTTTGAGGCACTGCAGCTCA
GTTTTAAAAACATGTGCAAACTTCGACCTCTGTTAGGGAAGTGGTTGCAA
GAAGCCGACTCAACCGGATGTGCTCCGTCCGGTATTGACAAAGTCACAGC
TGCTGGACGAAAACGAAAAAAGCGAACCAGCATTGAGGTTGGAGTGAAAA
ATGCACTGGAATCTCACTTTTCTCGACAAAGCAAACCGACAGCCCAAATC
ATTACACAGCTTGCAGACAGTCTCGGATTGGAAAAAGAAGTTGTCAGGGT
ATGGTTCTGTAATCGGCGACAGAAGGAAAAACGAATGACGCCTCCGCCAC
TGAATGGAACAAGCTCAGATTTATTTCCACATCCTGGTTTAACTGTCGGA
ACTGATAGTTCTCCTCATTCCTCATCTCACAGTAATCATGATTCATTCTC
GTCCATTGGTAACCAGTCAAGCTTCAATCGAATAGGTGATCCCTCCTCGA
CTCATCCCGGAGTCATTGTCACATCTTGCGGTTATTACTATGGTCATGTT
CCAAATGAATCACTTCTCAATTGTGGGCCTTACCCTCACAACATCATCAA
CAATTACGAATTCAGACAGTCCAATGATCCCAATATCCTCAATGTCAAAT
CCGAGTGCATCAGCTGACTCATGTCGAACTCACCGAAAAGAAAGCTAATA
ATATTCTATTTCAATAATAATAAAA
back to top

protein sequence of SMED30030379-orf-1

>SMED30030379-orf-1 ID=SMED30030379-orf-1|Name=SMED30030379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MLTSGLNQEQSSPLTIVGMSESQFFNESIRYLPPETVERQSQFYANNNYP
LGEFWNPQSEYAQYLQNTQPVSGPQFITSPAVGEAFYPSLYINTIHENVL
LPSVDSFNPPSGFMISGYSQQDQTFPTVNEPTYDNIPNNWNYVDHWVDSK
PTTVNSQLLPTSSISAVPIQNSFWDCESIDQSEYCPTNVDTELQDQIDSN
GEISRLNQKISTDELEQFAKIFKQRRIKLGFTQADVGLALGNLYGSVFSQ
TTICRFEALQLSFKNMCKLRPLLGKWLQEADSTGCAPSGIDKVTAAGRKR
KKRTSIEVGVKNALESHFSRQSKPTAQIITQLADSLGLEKEVVRVWFCNR
RQKEKRMTPPPLNGTSSDLFPHPGLTVGTDSSPHSSSHSNHDSFSSIGNQ
SSFNRIGDPSSTHPGVIVTSCGYYYGHVPNESLLNCGPYPHNIINNYEFR
QSNDPNILNVKSECIS*
back to top
Aliases
The feature 'POU domain protein' has the following synonyms
Synonym
pou2/3