Regulator of G protein signaling 20

Overview
NameRegulator of G protein signaling 20
Smed IDSMED30030374
Length (bp)1066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G protein signaling 20 (SMED30030374) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G protein signaling 20 (SMED30030374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G protein signaling 20 (SMED30030374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G protein signaling 20 (SMED30030374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030374SMESG000073688.1 SmedASXL_010523SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30030374SMESG000073688.1 dd_Smed_v6_27074_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30030374SMESG000073688.1 SMED30030374smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Match: RGS17 (regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088])

HSP 1 Score: 97.0561 bits (240), Expect = 3.838e-23
Identity = 46/96 (47.92%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             E++ RP  +  + S I+ +   +  T + V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E    ++EEKAR IYEDYISI
Sbjct:   49 GENAGRPTHTTKMES-IQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Match: RGS17 (regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088])

HSP 1 Score: 97.0561 bits (240), Expect = 3.838e-23
Identity = 46/96 (47.92%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             E++ RP  +  + S I+ +   +  T + V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E    ++EEKAR IYEDYISI
Sbjct:   49 GENAGRPTHTTKMES-IQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Match: RGS20 (regulator of G protein signaling 20 [Source:HGNC Symbol;Acc:HGNC:14600])

HSP 1 Score: 95.1301 bits (235), Expect = 3.792e-22
Identity = 46/97 (47.42%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  779 SEDSSRPQI-SNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +++  RP I S++L + +         TL+ V  W++SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E   +I+EEKAR IYEDYISI
Sbjct:   78 NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISI 174          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Match: RGS20 (regulator of G protein signaling 20 [Source:HGNC Symbol;Acc:HGNC:14600])

HSP 1 Score: 94.3597 bits (233), Expect = 1.373e-21
Identity = 46/97 (47.42%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  779 SEDSSRPQI-SNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +++  RP I S++L + +         TL+ V  W++SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E   +I+EEKAR IYEDYISI
Sbjct:  110 NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISI 206          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Match: RGS19 (regulator of G protein signaling 19 [Source:HGNC Symbol;Acc:HGNC:13735])

HSP 1 Score: 92.0485 bits (227), Expect = 2.735e-21
Identity = 38/66 (57.58%), Postives = 53/66 (80.30%), Query Frame = 2
Query:  869 VKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            V+ W++SF+ L+   AG+ +FR FL+ EYSEEN+LF+LACE+LK+E    +V+EKAR IYEDY+SI
Sbjct:   84 VQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSI 149          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 97.4413 bits (241), Expect = 6.287e-24
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  740 VACTFSCLN-----VHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            ++C  SC       V  +S  S +P +S  ++   +   N+   T + V  WS+SFE L++  AGQK F EFLK EYS+ENILF+ ACE+LK E   + +EEKAR IYED+ISI
Sbjct:    1 MSCAISCFGKIIVCVTHNSSPSGKPYVSGSVSVEKKNQENDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISI 114          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 88.9669 bits (219), Expect = 4.687e-21
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = 2
Query:  842 NEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            N+   T + V  WS+SFE L++  AGQK F EFLK EYS+ENILF+ ACE+LK E   + +EEKAR IYED+ISI
Sbjct:   21 NDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISI 95          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 88.5817 bits (218), Expect = 7.339e-21
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = 2
Query:  842 NEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            N+   T + V  WS+SFE L++  AGQK F EFLK EYS+ENILF+ ACE+LK E   + +EEKAR IYED+ISI
Sbjct:   26 NDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISI 100          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 88.5817 bits (218), Expect = 8.274e-21
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = 2
Query:  842 NEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            N+   T + V  WS+SFE L++  AGQK F EFLK EYS+ENILF+ ACE+LK E   + +EEKAR IYED+ISI
Sbjct:   28 NDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISI 102          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Match: rgs-1 (Regulator of G-protein signaling rgs-1 [Source:UniProtKB/Swiss-Prot;Acc:P34295])

HSP 1 Score: 82.8037 bits (203), Expect = 1.840e-18
Identity = 40/76 (52.63%), Postives = 53/76 (69.74%), Query Frame = 2
Query:  839 INEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +  E  + + V  W +SF+ L+   +GQK F EFLK EYS+ENILF+ ACE+LK E   + +EEKAR IYED+ISI
Sbjct:   25 VQPEALSYEMVYSWQQSFDTLMSFKSGQKCFAEFLKSEYSDENILFWQACEELKREKNSEKMEEKARIIYEDFISI 100          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0340279)

HSP 1 Score: 103.219 bits (256), Expect = 4.132e-25
Identity = 44/76 (57.89%), Postives = 63/76 (82.89%), Query Frame = 2
Query:  839 INEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            ++ E+ TL+ ++ W +SF+ L++ +AG+K+F+ FL+ E+SEENILF+LACEDLK E  P++VEEKAR IYEDYISI
Sbjct:  123 LDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISI 198          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0301142)

HSP 1 Score: 102.834 bits (255), Expect = 5.257e-25
Identity = 44/76 (57.89%), Postives = 63/76 (82.89%), Query Frame = 2
Query:  839 INEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            ++ E+ TL+ ++ W +SF+ L++ +AG+K+F+ FL+ E+SEENILF+LACEDLK E  P++VEEKAR IYEDYISI
Sbjct:  126 LDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISI 201          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0304669)

HSP 1 Score: 53.1434 bits (126), Expect = 2.721e-7
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  878 WSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLK-SETEPDIVEEKARFIYEDYIS 1063
            W+ SFE ++Q +AG + F EFLK E+S ENI F+ ACE  +  E+E D V + AR I+  +++
Sbjct:   65 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQ-AREIFAKHLA 126          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084273)

HSP 1 Score: 52.373 bits (124), Expect = 5.062e-7
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  878 WSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLK-SETEPDIVEEKARFIYEDYIS 1063
            W+ SFE ++Q +AG + F EFLK E+S ENI F+ ACE  +  E+E D V + AR I+  +++
Sbjct:  824 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQ-AREIFAKHLA 885          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084276)

HSP 1 Score: 51.6026 bits (122), Expect = 8.243e-7
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  878 WSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLK-SETEPDIVEEKARFIYEDYIS 1063
            W+ SFE ++Q +AG + F EFLK E+S ENI F+ ACE  +  E+E D V + AR I+  +++
Sbjct:  112 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQ-AREIFAKHLA 173          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Match: rgs17 (regulator of G protein signaling 17 [Source:ZFIN;Acc:ZDB-GENE-040718-229])

HSP 1 Score: 101.679 bits (252), Expect = 4.265e-25
Identity = 44/70 (62.86%), Postives = 57/70 (81.43%), Query Frame = 2
Query:  857 TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            TLD V  WS SFE++++   G+ +FREFL+ EYSEEN+LF++ACED+K ET P +VEEKAR IYEDY+SI
Sbjct:   64 TLDEVIAWSRSFEMMMRSPEGRDVFREFLRSEYSEENLLFWIACEDMKKETNPSVVEEKARIIYEDYVSI 133          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Match: rgs19 (regulator of G protein signaling 19 [Source:ZFIN;Acc:ZDB-GENE-080723-72])

HSP 1 Score: 95.9005 bits (237), Expect = 5.412e-23
Identity = 42/72 (58.33%), Postives = 57/72 (79.17%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K T++ +K+W++SF+ L++   G+  FREFL+ EYSEEN+LF+LACEDLK+E     +EEKAR IYEDYISI
Sbjct:   61 KPTMEEIKQWAQSFDKLMKNPGGRNKFREFLRTEYSEENMLFWLACEDLKNEINKSAIEEKARLIYEDYISI 132          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 87.4261 bits (215), Expect = 9.951e-20
Identity = 44/103 (42.72%), Postives = 64/103 (62.14%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINE-EKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +   D    + S D  +  +A   E  K T + +  W +SF+ L+ C +G+  FR+FL+ E+SEEN+LF+LACE+ + E    ++EEKAR IYEDYISI
Sbjct:   55 LTVRNEDRDERNRRASYDFKADGDADFEESPKPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISI 157          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 86.2705 bits (212), Expect = 2.376e-19
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K T + +  W +SF+ L+ C +G+  FR+FL+ E+SEEN+LF+LACE+ + E    ++EEKAR IYEDYISI
Sbjct:   82 KPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISI 153          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 86.6557 bits (213), Expect = 7.236e-19
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K T + +  W +SF+ L+ C +G+  FR+FL+ E+SEEN+LF+LACE+ + E    ++EEKAR IYEDYISI
Sbjct:  154 KPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISI 225          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 93.2041 bits (230), Expect = 2.467e-21
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKT---TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +  ++ +R + SN++  R   I N E++   TL+ V  W +SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E   +++EEKAR IYEDYISI
Sbjct:   88 LTVRNQDDERTR-RSSNEI--RGHGIPNWEESPSPTLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISI 189          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 93.2041 bits (230), Expect = 2.521e-21
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKT---TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +  ++ +R + SN++  R   I N E++   TL+ V  W +SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E   +++EEKAR IYEDYISI
Sbjct:   87 LTVRNQDDERTR-RSSNEI--RGHGIPNWEESPSPTLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISI 188          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 92.8189 bits (229), Expect = 3.186e-21
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKT---TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +  ++ +R + SN++  R   I N E++   TL+ V  W +SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E   +++EEKAR IYEDYISI
Sbjct:   91 LTVRNQDDERTR-RSSNEI--RGHGIPNWEESPSPTLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISI 192          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Match: RGS17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:100488096])

HSP 1 Score: 91.6633 bits (226), Expect = 3.615e-21
Identity = 48/99 (48.48%), Postives = 67/99 (67.68%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEK---TTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             E + RP      T+++E I  EE+    T + +  WS +F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK+E    IVE+ AR IYEDYISI
Sbjct:   45 GEQAGRP----THTTKMENIQVEEECQTPTAEEILSWSHNFDKMMKSPAGRNLFREFLRTEYSEENLLFWLACEDLKNEQNKKIVEDTARNIYEDYISI 139          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Match: RGS17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:100488096])

HSP 1 Score: 91.2781 bits (225), Expect = 4.194e-21
Identity = 48/99 (48.48%), Postives = 67/99 (67.68%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEK---TTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             E + RP      T+++E I  EE+    T + +  WS +F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK+E    IVE+ AR IYEDYISI
Sbjct:   49 GEQAGRP----THTTKMENIQVEEECQTPTAEEILSWSHNFDKMMKSPAGRNLFREFLRTEYSEENLLFWLACEDLKNEQNKKIVEDTARNIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 95.9005 bits (237), Expect = 2.286e-23
Identity = 43/73 (58.90%), Postives = 55/73 (75.34%), Query Frame = 2
Query:  848 EKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +  T D V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   71 QNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 95.5153 bits (236), Expect = 1.096e-22
Identity = 48/86 (55.81%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  818 TSRIEAI-INEE--KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T+++E+I + EE    T D V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   58 TTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 95.5153 bits (236), Expect = 1.096e-22
Identity = 48/86 (55.81%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  818 TSRIEAI-INEE--KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T+++E+I + EE    T D V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   58 TTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 95.1301 bits (235), Expect = 1.857e-22
Identity = 48/86 (55.81%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  818 TSRIEAI-INEE--KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T+++E+I + EE    T D V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   78 TTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISI 163          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Match: Rgs20 (regulator of G-protein signaling 20 [Source:MGI Symbol;Acc:MGI:1929866])

HSP 1 Score: 91.6633 bits (226), Expect = 2.509e-21
Identity = 46/97 (47.42%), Postives = 66/97 (68.04%), Query Frame = 2
Query:  779 SEDSSRPQ-ISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +++  RPQ  S+++ + I A       TL+ V  W++SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E     +EEKAR IYEDYISI
Sbjct:   45 NQEDQRPQRASHEIRTDIPACEESPTPTLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISI 141          
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Match: sp|Q9UGC6|RGS17_HUMAN (Regulator of G-protein signaling 17 OS=Homo sapiens OX=9606 GN=RGS17 PE=1 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.843e-22
Identity = 46/96 (47.92%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             E++ RP  +  + S I+ +   +  T + V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E    ++EEKAR IYEDYISI
Sbjct:   49 GENAGRPTHTTKMES-IQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Match: sp|Q9PWA0|RGS17_CHICK (Regulator of G-protein signaling 17 OS=Gallus gallus OX=9031 GN=RGS17 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.687e-22
Identity = 45/96 (46.88%), Postives = 67/96 (69.79%), Query Frame = 2
Query:  779 SEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
             +++ RP  +  + S I+ I   +  T D +  W+++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E    ++EEKAR IYEDYISI
Sbjct:   49 GDNAGRPTHTTKMES-IQVIEECQNPTADEILSWAQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Match: sp|Q9QZB0|RGS17_MOUSE (Regulator of G-protein signaling 17 OS=Mus musculus OX=10090 GN=Rgs17 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 7.668e-22
Identity = 48/86 (55.81%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  818 TSRIEAI-INEE--KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T+++E+I + EE    T D V  WS++F+ +++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   58 TTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISI 143          
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Match: sp|Q9PWA1|RGS20_CHICK (Regulator of G-protein signaling 20 OS=Gallus gallus OX=9031 GN=RGS20 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.255e-21
Identity = 50/105 (47.62%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKT---TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +  E+ +R + S++L +  E I N E++   TL+ V  W++SF+ L+   AG+  FREFL+ E+SEEN+LF++ACE+LK E+   ++EEKAR IYEDYISI
Sbjct:   50 LTVRNQEEERAR-RTSHELQA--EGIPNCEESPAPTLEEVNAWAQSFDKLMLTPAGRNAFREFLRTEFSEENMLFWMACEELKQESNKSVIEEKARLIYEDYISI 151          
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Match: sp|Q08DC7|RGS19_BOVIN (Regulator of G-protein signaling 19 OS=Bos taurus OX=9913 GN=RGS19 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.308e-21
Identity = 39/66 (59.09%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  869 VKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            V+ W++SF+ L+   AG+ +FREFL+ EYSEEN+LF+LACE+LK+E    +V+EKAR IYEDY+SI
Sbjct:   90 VRSWAQSFDKLMHSPAGRSVFREFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSI 155          
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Match: A0A074ZJM1 (RGS domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05775 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 6.460e-29
Identity = 59/102 (57.84%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + V +S +DS RP  S D  SR++    EEK   D +K W ESF++L+QC AG+K+FREFL+ EYSEENI+F+LACE+LK E+ P++VEEKAR IYED+ISI
Sbjct:  479 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISI 580          
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Match: A0A4S2L9E2 (RGS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008821 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 6.495e-29
Identity = 59/102 (57.84%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + V +S +DS RP  S D  SR++    EEK   D +K W ESF++L+QC AG+K+FREFL+ EYSEENI+F+LACE+LK E+ P++VEEKAR IYED+ISI
Sbjct:  479 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISI 580          
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Match: G7YDW3 (Regulator of G-protein signaling 20 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_105646 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.291e-29
Identity = 59/102 (57.84%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + V +S +DS RP  S D  SR++    EEK   D +K W ESF++L+QC AG+K+FREFL+ EYSEENI+F+LACE+LK E+ P++VEEKAR IYED+ISI
Sbjct:  477 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISI 578          
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Match: A0A1S8XAC3 (Regulator of G protein signaling domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_00447 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.308e-29
Identity = 59/102 (57.84%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + V +S +DS RP  S D  SR++    EEK   D +K W ESF++L+QC AG+K+FREFL+ EYSEENI+F+LACE+LK E+ P++VEEKAR IYED+ISI
Sbjct:  461 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISI 562          
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Match: A0A4S2LA62 (RGS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008821 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 8.324e-29
Identity = 59/102 (57.84%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + V +S +DS RP  S D  SR++    EEK   D +K W ESF++L+QC AG+K+FREFL+ EYSEENI+F+LACE+LK E+ P++VEEKAR IYED+ISI
Sbjct:  479 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISI 580          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Match: rgs17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:103040587])

HSP 1 Score: 100.908 bits (250), Expect = 8.737e-25
Identity = 43/77 (55.84%), Postives = 61/77 (79.22%), Query Frame = 2
Query:  836 IINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +  E+  TLD V  W+ SFE++++ + G++IF+EFL+ EYSEEN++F++ACEDLK ET P  +EEKAR IYEDY+SI
Sbjct:   66 VTEEQHPTLDEVVAWARSFEMMMRSTEGREIFKEFLQSEYSEENLMFWIACEDLKKETSPSTIEEKARIIYEDYVSI 142          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Match: rgs19 (regulator of G protein signaling 19 [Source:ZFIN;Acc:ZDB-GENE-080723-72])

HSP 1 Score: 99.3673 bits (246), Expect = 2.413e-24
Identity = 47/84 (55.95%), Postives = 65/84 (77.38%), Query Frame = 2
Query:  821 SRIEAIINEE--KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +++E I N E  K TL+ +K+W++SF+ L++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     ++EKAR IYEDYISI
Sbjct:   52 TKLETIPNCEATKPTLEEMKQWAQSFDKLMKNPAGRNVFREFLRTEYSEENMLFWLACEDLKKEINKSAIDEKARMIYEDYISI 135          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Match: rgs20 (regulator of G protein signaling 20 [Source:NCBI gene;Acc:103034107])

HSP 1 Score: 90.1225 bits (222), Expect = 1.775e-20
Identity = 38/70 (54.29%), Postives = 53/70 (75.71%), Query Frame = 2
Query:  857 TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T++ V+ W +SF+ L+ C +G+  FR+FL+ E+SEEN+LF+LACE+   ET    +EEKAR IYEDYISI
Sbjct:  112 TVEEVRAWGQSFDKLMHCPSGRSAFRQFLRTEFSEENMLFWLACEEFTKETNKSAIEEKARLIYEDYISI 181          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Match: rgs20 (regulator of G protein signaling 20 [Source:NCBI gene;Acc:103034107])

HSP 1 Score: 89.3521 bits (220), Expect = 5.451e-20
Identity = 38/70 (54.29%), Postives = 53/70 (75.71%), Query Frame = 2
Query:  857 TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            T++ V+ W +SF+ L+ C +G+  FR+FL+ E+SEEN+LF+LACE+   ET    +EEKAR IYEDYISI
Sbjct:  158 TVEEVRAWGQSFDKLMHCPSGRSAFRQFLRTEFSEENMLFWLACEEFTKETNKSAIEEKARLIYEDYISI 227          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Match: ENSAMXT00000052296.1 (regulator of G-protein signaling 20-like [Source:NCBI gene;Acc:103022271])

HSP 1 Score: 83.1889 bits (204), Expect = 3.661e-18
Identity = 38/70 (54.29%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  857 TLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            TL+ V+ W ++FE LI+   G+  FR+FLK E+SEEN+LF+LACE+LK ET    VE+  + IYEDY+SI
Sbjct:   91 TLEEVRLWGQTFEQLIKSPRGRASFRQFLKTEFSEENLLFWLACEELKKETNRTAVEQTVKQIYEDYVSI 160          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003940.1 (pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-1 gene:ENSPMAG00000003600.1 transcript:ENSPMAT00000003940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 2.429e-24
Identity = 54/105 (51.43%), Postives = 73/105 (69.52%), Query Frame = 2
Query:  761 LNVHSSSEDSSRPQISNDLTSRIEAIINEE---KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            L V +     SR + S++  S++E+I + E   K +L+ V  WS  FE L+  +AG+ +FREFL+ E+SEEN+LF+LACEDLK E   +IVEEKAR IYEDYISI
Sbjct:   47 LTVRNHEGAGSRRRSSHE--SKLESIQSPEESGKLSLEEVTSWSHCFERLMHSAAGRAVFREFLRTEFSEENLLFWLACEDLKKEENKNIVEEKARTIYEDYISI 149          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008468.1 (pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-1 gene:ENSPMAG00000007670.1 transcript:ENSPMAT00000008468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 4.283e-24
Identity = 46/85 (54.12%), Postives = 63/85 (74.12%), Query Frame = 2
Query:  821 SRIEAIINEE---KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +RIE + N++   K +++ V+ W +SF+ LI+ + G+  FREFL+ E+SEEN+LF+LACEDLK E     VEEKAR IYEDYISI
Sbjct:   55 TRIEMVQNKDSSGKPSMEEVQVWGQSFDKLIRSTGGRNTFREFLRTEFSEENMLFWLACEDLKREANKRAVEEKARVIYEDYISI 139          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000303.1 (pep scaffold:Pmarinus_7.0:GL477001:8680:13381:-1 gene:ENSPMAG00000000271.1 transcript:ENSPMAT00000000303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 1.904e-21
Identity = 36/65 (55.38%), Postives = 54/65 (83.08%), Query Frame = 2
Query:  872 KKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            + W  SF+ L++ +AG+++FREFL+ E+SEEN+LF+L+CE+L  E++P  +EE+AR IYEDYISI
Sbjct:   97 RAWGRSFDRLMRSAAGRRVFREFLRSEFSEENLLFWLSCEELTHESDPAAIEERARNIYEDYISI 161          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010564.1 (pep scaffold:Pmarinus_7.0:GL481967:17435:18590:-1 gene:ENSPMAG00000009570.1 transcript:ENSPMAT00000010564.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.816e-16
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +   D V  W  SFE L++   G+  FR FL+ E+SE+N+LF+LACE+L++ T+   + E+ R IYE+YISI
Sbjct:    3 RAGADEVLAWGRSFERLVRSPTGRAHFRHFLRGEFSEDNLLFWLACEELRAGTDDTSLPERMRTIYEEYISI 74          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006812.1 (pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1 gene:ENSPMAG00000006145.1 transcript:ENSPMAT00000006812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.614e-11
Identity = 35/103 (33.98%), Postives = 49/103 (47.57%), Query Frame = 2
Query:  758 CLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            CL  H+ S    RP                 + + D    W+ES + L+    G   F+ FL+ E+SEENI F+LACED K       +  KAR I+ +YI+I
Sbjct:   10 CLLAHAPSSSPPRPV---------------HRPSQDEAHAWAESLDKLLVHKYGLAAFQAFLRTEFSEENINFWLACEDYKKTKSAAKLTSKARKIFSEYIAI 97          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 73.559 bits (179), Expect = 9.282e-16
Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 2
Query:  869 VKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYIS 1063
            + +W  SFE L+    G ++F EFLK EYSEEN+LF+LA E LK ETEP  V+  A+ IY DY+S
Sbjct:   30 INEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNLAQTIYNDYVS 94          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 62.7734 bits (151), Expect = 6.544e-12
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYIS 1063
            K T+D +K W   F  L+    G   F+EFL+ +Y EEN+ F+LA ED +   + +   + AR IYEDY+S
Sbjct:   33 KPTIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVS 103          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 61.2326 bits (147), Expect = 2.872e-10
Identity = 37/112 (33.04%), Postives = 63/112 (56.25%), Query Frame = 2
Query:  755 SCLNVHSSSEDSSRP-----QISNDLTSRIEAI--INE--EKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYIS 1063
            +CL+V S     + P      +S   TS  +++  +N    +T    V +W+  F+ L+   AG   F EFLK E+SEENI+F++ACE+ +S ++P  ++  A  I+E ++S
Sbjct:  604 NCLSVESLDHAGNGPGKPMDHLSPSRTSSTQSLHSVNSMSNETVEGRVSRWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLS 715          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 54.6842 bits (130), Expect = 2.123e-8
Identity = 36/97 (37.11%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  785 DSSRPQISNDLTSRIE----AIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYIS 1063
            + S P I++D+T   +     I+ +++     VK+W+ S   L++   G+K F  FL+ E+S EN+ F+LACE LK+ T    V EKA+ IY +Y+S
Sbjct:  243 EPSNPWITDDITFWEQDCSITIVPQKR-----VKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKA-TPIKQVPEKAQEIYTEYLS 333          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Match: rgs17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:101163433])

HSP 1 Score: 95.1301 bits (235), Expect = 1.219e-22
Identity = 40/75 (53.33%), Postives = 62/75 (82.67%), Query Frame = 2
Query:  842 NEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +E++ +L+ +  W+ SF+++++   G++IFREFL+ EYSE+N+LF+LACE+LK ET P +V+EKAR IYEDY+SI
Sbjct:   68 DEQRPSLEELLSWARSFDMMLRSFEGREIFREFLRSEYSEDNLLFWLACEELKKETNPSVVDEKARIIYEDYVSI 142          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Match: rgs17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:101163433])

HSP 1 Score: 95.1301 bits (235), Expect = 1.290e-22
Identity = 40/75 (53.33%), Postives = 62/75 (82.67%), Query Frame = 2
Query:  842 NEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +E++ +L+ +  W+ SF+++++   G++IFREFL+ EYSE+N+LF+LACE+LK ET P +V+EKAR IYEDY+SI
Sbjct:   71 DEQRPSLEELLSWARSFDMMLRSFEGREIFREFLRSEYSEDNLLFWLACEELKKETNPSVVDEKARIIYEDYVSI 145          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Match: ENSORLT00000022304.2 (regulator of G-protein signaling 20 [Source:NCBI gene;Acc:101161339])

HSP 1 Score: 93.2041 bits (230), Expect = 6.616e-22
Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K TL+ V  W +SF+ L+ C AG+  FR+FL+ E+SEEN+LF+LACE+   ET   ++EEKAR IYEDYISI
Sbjct:   82 KPTLEEVHSWGQSFDKLMGCPAGRNCFRQFLRTEFSEENMLFWLACEEFSKETNKSMIEEKARVIYEDYISI 153          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Match: ENSORLT00000035946.1 (regulator of G-protein signaling 20 [Source:NCBI gene;Acc:101161339])

HSP 1 Score: 93.2041 bits (230), Expect = 6.616e-22
Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K TL+ V  W +SF+ L+ C AG+  FR+FL+ E+SEEN+LF+LACE+   ET   ++EEKAR IYEDYISI
Sbjct:   82 KPTLEEVHSWGQSFDKLMGCPAGRNCFRQFLRTEFSEENMLFWLACEEFSKETNKSMIEEKARVIYEDYISI 153          
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Match: rgs19 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:101158610])

HSP 1 Score: 90.1225 bits (222), Expect = 1.235e-20
Identity = 41/72 (56.94%), Postives = 56/72 (77.78%), Query Frame = 2
Query:  851 KTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            K +++ ++ WS+SF+ L++  AG+ +FREFL+ EYSEEN+LF+LACEDLK E     +EEKA  IYEDYISI
Sbjct:   93 KPSVEEIRLWSQSFDKLMRNPAGRNVFREFLRTEYSEENMLFWLACEDLKQEANKSAIEEKACSIYEDYISI 164          
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Match: SMESG000073688.1 (SMESG000073688.1)

HSP 1 Score: 278.485 bits (711), Expect = 1.840e-133
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query:  271 MTTSLMPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRXXXXXXXXXXXXIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT 723
            MTTSLMPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRKKLFKTEKTKLKIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT
Sbjct:    1 MTTSLMPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRKKLFKTEKTKLKIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT 151          

HSP 2 Score: 216.853 bits (551), Expect = 1.840e-133
Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 2
Query:  746 CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI
Sbjct:  160 CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 266          
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Match: SMESG000073688.1 (SMESG000073688.1)

HSP 1 Score: 268.085 bits (684), Expect = 3.227e-130
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 1
Query:  286 MPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRXXXXXXXXXXXXIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT 723
            MPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRKKLFKTEKTKLKIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT
Sbjct:    1 MPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTFNENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRKKLFKTEKTKLKIFPNQFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLKT 146          

HSP 2 Score: 216.853 bits (551), Expect = 3.227e-130
Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 2
Query:  746 CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI
Sbjct:  155 CTFSCLNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 261          
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Match: SMESG000016675.1 (SMESG000016675.1)

HSP 1 Score: 124.79 bits (312), Expect = 5.973e-32
Identity = 71/164 (43.29%), Postives = 102/164 (62.20%), Query Frame = 2
Query:  599 IHQKIVF*Q*IIILKSQMSTTTFEIQVLTIXXXXXXXXXLKRVASVGVACTFSC--------LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            ++ ++VF    + L +Q +  T E+  L       ++  + R      AC F          LN+    E+  R QISND  S++EAI ++EK TLD  +KW  +F++L+Q SAG+K+F EFLKLEYSEENI+FY A E+L++ET  +++EEKAR IYEDYISI
Sbjct:  209 LNDRVVF----MSLHNQTTLDTTELSTLA-----SRSNPISRNNPSSRACYFCWCCCCSCSCLNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISI 363          
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Match: SMESG000048981.1 (SMESG000048981.1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.678e-12
Identity = 35/120 (29.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  722 RVASVGVACTFSCLNVHSSSEDSSRPQISNDLTSR------IEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYIS 1063
            ++ ++G+       N      D + P +S++ +++      IE ++   K   + +++W+ESFE L+    G  +F ++LK EYSEENI F++ACE+ K+ T P  +  +A+ I +D+++
Sbjct:  289 KIINIGIDEMKEKFNFLRKPGDPAVPPLSDNTSAKSIRLKEIEKLVRMGKLLNEQIQRWNESFEQLLNDKYGLALFHDYLKSEYSEENIEFWIACEEFKTITNPKKMASRAQKIIKDFVT 408          
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.309e-11
Identity = 29/80 (36.25%), Postives = 53/80 (66.25%), Query Frame = 2
Query:  827 IEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISI 1066
            +E ++   K++++ +KKWS SFE L+    G  +F EFL+ E+S+ENI F++ACE+ ++ T    ++ +A  IY D++ +
Sbjct:  283 MERLLRVGKSSIEQIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGV 362          
The following BLAST results are available for this feature:
BLAST of Regulator of G protein signaling 20 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS173.838e-2347.92regulator of G protein signaling 17 [Source:HGNC S... [more]
RGS173.838e-2347.92regulator of G protein signaling 17 [Source:HGNC S... [more]
RGS203.792e-2247.42regulator of G protein signaling 20 [Source:HGNC S... [more]
RGS201.373e-2147.42regulator of G protein signaling 20 [Source:HGNC S... [more]
RGS192.735e-2157.58regulator of G protein signaling 19 [Source:HGNC S... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs-26.287e-2445.61Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-24.687e-2158.67Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-27.339e-2158.67Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-28.274e-2158.67Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-11.840e-1852.63Regulator of G-protein signaling rgs-1 [Source:Un... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhit4.132e-2557.89gene:FBgn0028743 transcript:FBtr0340279[more]
Dhit5.257e-2557.89gene:FBgn0028743 transcript:FBtr0301142[more]
loco2.721e-744.44gene:FBgn0020278 transcript:FBtr0304669[more]
loco5.062e-744.44gene:FBgn0020278 transcript:FBtr0084273[more]
loco8.243e-744.44gene:FBgn0020278 transcript:FBtr0084276[more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs174.265e-2562.86regulator of G protein signaling 17 [Source:ZFIN;A... [more]
rgs195.412e-2358.33regulator of G protein signaling 19 [Source:ZFIN;A... [more]
rgs209.951e-2042.72regulator of G protein signaling 20 [Source:ZFIN;A... [more]
rgs202.376e-1951.39regulator of G protein signaling 20 [Source:ZFIN;A... [more]
rgs207.236e-1951.39regulator of G protein signaling 20 [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf19a2.467e-2146.67ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
rnf19a2.521e-2146.67ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
rnf19a3.186e-2146.67ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
RGS173.615e-2148.48regulator of G-protein signaling 17 [Source:NCBI g... [more]
RGS174.194e-2148.48regulator of G-protein signaling 17 [Source:NCBI g... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs172.286e-2358.90regulator of G-protein signaling 17 [Source:MGI Sy... [more]
Rgs171.096e-2255.81regulator of G-protein signaling 17 [Source:MGI Sy... [more]
Rgs171.096e-2255.81regulator of G-protein signaling 17 [Source:MGI Sy... [more]
Rgs171.857e-2255.81regulator of G-protein signaling 17 [Source:MGI Sy... [more]
Rgs202.509e-2147.42regulator of G-protein signaling 20 [Source:MGI Sy... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UGC6|RGS17_HUMAN1.843e-2247.92Regulator of G-protein signaling 17 OS=Homo sapien... [more]
sp|Q9PWA0|RGS17_CHICK2.687e-2246.88Regulator of G-protein signaling 17 OS=Gallus gall... [more]
sp|Q9QZB0|RGS17_MOUSE7.668e-2255.81Regulator of G-protein signaling 17 OS=Mus musculu... [more]
sp|Q9PWA1|RGS20_CHICK3.255e-2147.62Regulator of G-protein signaling 20 OS=Gallus gall... [more]
sp|Q08DC7|RGS19_BOVIN3.308e-2159.09Regulator of G-protein signaling 19 OS=Bos taurus ... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZJM16.460e-2957.84RGS domain-containing protein OS=Opisthorchis vive... [more]
A0A4S2L9E26.495e-2957.84RGS domain-containing protein OS=Opisthorchis feli... [more]
G7YDW37.291e-2957.84Regulator of G-protein signaling 20 (Fragment) OS=... [more]
A0A1S8XAC37.308e-2957.84Regulator of G protein signaling domain protein (F... [more]
A0A4S2LA628.324e-2957.84RGS domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs178.737e-2555.84regulator of G-protein signaling 17 [Source:NCBI g... [more]
rgs192.413e-2455.95regulator of G protein signaling 19 [Source:ZFIN;A... [more]
rgs201.775e-2054.29regulator of G protein signaling 20 [Source:NCBI g... [more]
rgs205.451e-2054.29regulator of G protein signaling 20 [Source:NCBI g... [more]
ENSAMXT00000052296.13.661e-1854.29regulator of G-protein signaling 20-like [Source:N... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003940.12.429e-2451.43pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-... [more]
ENSPMAT00000008468.14.283e-2454.12pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-... [more]
ENSPMAT00000000303.11.904e-2155.38pep scaffold:Pmarinus_7.0:GL477001:8680:13381:-1 g... [more]
ENSPMAT00000010564.11.816e-1645.83pep scaffold:Pmarinus_7.0:GL481967:17435:18590:-1 ... [more]
ENSPMAT00000006812.11.614e-1133.98pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO373709.282e-1653.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328046.544e-1240.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431262.872e-1033.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343512.123e-837.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs171.219e-2253.33regulator of G-protein signaling 17 [Source:NCBI g... [more]
rgs171.290e-2253.33regulator of G-protein signaling 17 [Source:NCBI g... [more]
ENSORLT00000022304.26.616e-2256.94regulator of G-protein signaling 20 [Source:NCBI g... [more]
ENSORLT00000035946.16.616e-2256.94regulator of G-protein signaling 20 [Source:NCBI g... [more]
rgs191.235e-2056.94regulator of G-protein signaling 17 [Source:NCBI g... [more]
back to top
BLAST of Regulator of G protein signaling 20 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073688.11.840e-133100.00SMESG000073688.1[more]
SMESG000073688.13.227e-130100.00SMESG000073688.1[more]
SMESG000016675.15.973e-3243.29SMESG000016675.1[more]
SMESG000048981.17.678e-1229.17SMESG000048981.1[more]
SMESG000011723.11.309e-1136.25SMESG000011723.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030374 ID=SMED30030374|Name=Regulator of G protein signaling 20|organism=Schmidtea mediterranea sexual|type=transcript|length=1066bp
TTTCCTGTGGGTAGTGAAGAAGCTTGCATAAGTTATCGATAAAGAGATTT
TATTGTGTACTGAAAACTAGGATTTTACCACCATTTTTTTAATAAATTTT
TATACATCTTATTTTGTAAATTTCTCTCAATGAAACCGTACTTTTGGATT
TTAACCATCTCGTGATGTTCAAAGTCAAACGATGAAAGGATTTAAAACCC
TCTAAGTCAATTTAATTTCAACATCTCATGAGAGGCTTTGGATTTGTTCT
TCTGAATTTGAAACGAAAATATGACCACGTCTTTGATGCCAGAATTTATT
CGATTGGAATCTCCCAATTATCTATCTGAATCGTGTTCGGATGACAAATC
GGCAGTTTTTCTACTTAACAATTCAAAGTATAAAGATTTCTATTTCAGTC
CCGGAAAACGCTTTACGTTTAATGAAAATCCACATGTTTATTACAATAGA
CATCACAAACCATCGAAAAAGAATTCCAATTCTGCTCCAGTGAGCATTAC
GAATACACCAGATTGGCAAAGGAAAAAACTGTTCAAAACGGAAAAAACAA
AATTAAAAATATTTCCTAATCAATTTGGTAACAAATTCCTATCGAAAAAT
TCATCAGAAAATAGTTTTCTAGCAATAAATTATAATTCTAAAAAGCCAAA
TGTCAACAACTACTTTCGAAATTCAAGTATTAACAATTCCGTAGCCAAAG
CCGAAGAATCCAAACTTAAAACGTGTTGCCTCTGTTGGTGTTGCTTGTAC
GTTTTCATGTTTGAATGTCCATTCATCATCAGAAGATTCTTCTCGGCCTC
AAATTTCAAATGACTTGACCAGTCGAATAGAAGCAATTATCAATGAAGAA
AAAACAACTTTAGATTTTGTGAAAAAATGGTCCGAATCTTTTGAAATACT
TATTCAATGTTCAGCTGGCCAAAAAATATTTCGAGAATTTTTAAAACTAG
AATACAGTGAAGAAAATATTTTATTTTACCTGGCCTGTGAAGACCTAAAA
AGTGAAACTGAACCTGATATTGTAGAAGAAAAAGCTAGATTTATTTATGA
AGATTACATATCTATT
back to top

protein sequence of SMED30030374-orf-1

>SMED30030374-orf-1 ID=SMED30030374-orf-1|Name=SMED30030374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
MTTSLMPEFIRLESPNYLSESCSDDKSAVFLLNNSKYKDFYFSPGKRFTF
NENPHVYYNRHHKPSKKNSNSAPVSITNTPDWQRKKLFKTEKTKLKIFPN
QFGNKFLSKNSSENSFLAINYNSKKPNVNNYFRNSSINNSVAKAEESKLK
TCCLCWCCLYVFMFECPFIIRRFFSASNFK*
back to top
Aliases
The feature 'Regulator of G protein signaling 20' has the following synonyms
Synonym
Smed_17028
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0045202synapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016137RGS
IPR024066RGS_subdom1/3
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0009968negative regulation of signal transduction
GO:0043547positive regulation of GTPase activity