Protein FAM161A

Overview
NameProtein FAM161A
Smed IDSMED30030365
Length (bp)2554
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM161A (SMED30030365) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM161A (SMED30030365) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM161A (SMED30030365) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM161A (SMED30030365) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030365

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030365SMESG000042541.1 SmedASXL_012862SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030365SMESG000042541.1 dd_Smed_v4_15201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030365SMESG000042541.1 dd_Smed_v4_15201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030365SMESG000042541.1 dd_Smed_v6_15201_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30030365SMESG000070776.1 SMESG000042541.1 Contig46845newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030365SMESG000070776.1 SMESG000042541.1 Contig46845uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030365SMESG000042541.1 SMESG000007100.1 Contig38349newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030365SMESG000042541.1 SMESG000007100.1 Contig38349uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30030365SMESG000042541.1 dd_Smed_v4_15201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM161A vs. Ensembl Human
Match: FAM161B (FAM161 centrosomal protein B [Source:HGNC Symbol;Acc:HGNC:19854])

HSP 1 Score: 90.8929 bits (224), Expect = 4.035e-18
Identity = 119/439 (27.11%), Postives = 210/439 (47.84%), Query Frame = 1
Query:  817 VAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKRE---MEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMP----GNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTE-----QRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN----HIKAVEQLAKKKREMDVSDKIR-RSLDI-ESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            V+ W   +TVP+PF MT+RE  K+         +   S    E + ++A+++ +E  E  +QFRA PVPA+VY+PLY+ + E S  RRQ   +  KE+L S  KPF+F ++E    E  RQ+   AT     +++ I  + ++ + P         K+I+            +  +K++E ELFR I+ +MR+  +L+ +  P     N A  Q     + +Q++L   + + R +       + N  VP++  ++K ++       +    T+ KPF L T      QRP      D     + Q S       +    + S LA+L           +T  RE+A+++ L   E KN     I+ +E   KK + M  S  +R +++D  +S+   E+  + K KE +  +  R + Y+++L+E+K++++  P L E
Sbjct:  225 VSSWASSITVPRPFRMTLREARKKA--------EWLGSPASFEQERQRAQRQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERSEARRQAGIQKRKELLLSSLKPFSFLEKEEQLKEAARQRDLAAT-----AEAKISKQKATRRIP---------KSIL----------EPALGDKLQEAELFRKIRIQMRALDMLQMASSPIASSSNRANPQPRTATRTQQEKLGFLHTNFRFQP------RVNPVVPDYEGLYKAFQRRAAKRRETQEATRNKPFLLRTANLRHPQRPC-----DAATTGRRQDSPQPPATPLPRSRSLSGLASLSANTLPVHITDATRKRESAVRSAL---EKKNKADESIQWLEIHKKKSQAMSKSVTLRAKAMDPHKSL---EEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFE 614          
BLAST of Protein FAM161A vs. Ensembl Human
Match: FAM161B (FAM161 centrosomal protein B [Source:HGNC Symbol;Acc:HGNC:19854])

HSP 1 Score: 90.5077 bits (223), Expect = 5.387e-18
Identity = 119/442 (26.92%), Postives = 208/442 (47.06%), Query Frame = 1
Query:  817 VAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKRE---MEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMP----GNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTE-----QRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN----HIKAVEQLAKKKREMDVSDKIR-RSLD----IESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            V+ W   +TVP+PF MT+RE  K+         +   S    E + ++A+++ +E  E  +QFRA PVPA+VY+PLY+ + E S  RRQ   +  KE+L S  KPF+F ++E    E  RQ+   AT     +++ I  + ++ + P         K+I+            +  +K++E ELFR I+ +MR+  +L+ +  P     N A  Q     + +Q++L   + + R +       + N  VP++  ++K ++       +    T+ KPF L T      QRP      D     + Q S       +    + S LA+L           +T  RE+A+++ L   E KN     I+ +E   KK + M  S  +R +++D    +E + K       K KE +  +  R + Y+++L+E+K++++  P L E
Sbjct:  162 VSSWASSITVPRPFRMTLREARKKA--------EWLGSPASFEQERQRAQRQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERSEARRQAGIQKRKELLLSSLKPFSFLEKEEQLKEAARQRDLAAT-----AEAKISKQKATRRIP---------KSIL----------EPALGDKLQEAELFRKIRIQMRALDMLQMASSPIASSSNRANPQPRTATRTQQEKLGFLHTNFRFQP------RVNPVVPDYEGLYKAFQRRAAKRRETQEATRNKPFLLRTANLRHPQRPC-----DAATTGRRQDSPQPPATPLPRSRSLSGLASLSANTLPVHITDATRKRESAVRSAL---EKKNKADESIQWLEIHKKKSQAMSKSVTLRAKAMDPHKSLEEVFKA------KLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFE 551          
BLAST of Protein FAM161A vs. Ensembl Human
Match: FAM161A (FAM161 centrosomal protein A [Source:HGNC Symbol;Acc:HGNC:25808])

HSP 1 Score: 77.0258 bits (188), Expect = 8.171e-14
Identity = 70/233 (30.04%), Postives = 127/233 (54.51%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLE-ESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADF 1521
            W   +TVP+PF+M +RE+ K++   K   +        +E  + KA K+++E  E KK+FRANPVPA+V++PLY  + ++  +RR+ ++E +KE L + +KPF F  RE E++R   E   + F      +  K  +N+               +A+  P+ +  ++T +K+KE+EL+R ++ ++R+++ L+  S +P   A   R      +  +LK K+   + R  + DF
Sbjct:  228 WVPTITVPEPFQMMIREQKKKEESMKSKSD--------IEM-VHKALKKQEEDPEYKKKFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIARE-EQKRAAREKQLRDF------LKYKKKTNR--------------FKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKCKH---KVRCPTPDF 427          
BLAST of Protein FAM161A vs. Ensembl Human
Match: FAM161A (FAM161 centrosomal protein A [Source:HGNC Symbol;Acc:HGNC:25808])

HSP 1 Score: 77.0258 bits (188), Expect = 8.529e-14
Identity = 68/233 (29.18%), Postives = 124/233 (53.22%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLE-ESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADF 1521
            W   +TVP+PF+M +RE+ K++   K   +     + L         K+++E  E KK+FRANPVPA+V++PLY  + ++  +RR+ ++E +KE L + +KPF F  RE E++R   E   + F      +  K  +N+               +A+  P+ +  ++T +K+KE+EL+R ++ ++R+++ L+  S +P   A   R      +  +LK K+   + R  + DF
Sbjct:  232 WVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKAL---------KKQEEDPEYKKKFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIARE-EQKRAAREKQLRDF------LKYKKKTNR--------------FKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKCKH---KVRCPTPDF 431          
BLAST of Protein FAM161A vs. Ensembl Human
Match: FAM161A (FAM161 centrosomal protein A [Source:HGNC Symbol;Acc:HGNC:25808])

HSP 1 Score: 76.6406 bits (187), Expect = 1.049e-13
Identity = 68/233 (29.18%), Postives = 124/233 (53.22%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLE-ESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADF 1521
            W   +TVP+PF+M +RE+ K++   K   +     + L         K+++E  E KK+FRANPVPA+V++PLY  + ++  +RR+ ++E +KE L + +KPF F  RE E++R   E   + F      +  K  +N+               +A+  P+ +  ++T +K+KE+EL+R ++ ++R+++ L+  S +P   A   R      +  +LK K+   + R  + DF
Sbjct:  232 WVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKAL---------KKQEEDPEYKKKFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIARE-EQKRAAREKQLRDF------LKYKKKTNR--------------FKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKCKH---KVRCPTPDF 431          
BLAST of Protein FAM161A vs. Ensembl Zebrafish
Match: fam161a (FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-GENE-110310-1])

HSP 1 Score: 110.923 bits (276), Expect = 1.701e-24
Identity = 89/272 (32.72%), Postives = 146/272 (53.68%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLT 1641
            W  +VTVP+PF+MTVRE   RK        K  KSR+ +E +     ++ +EL E +K+FRA+P+PA+V +PLYE +QE + +RR+   E+ ++ L   +KPF F +RE  K+ QK        D       L+ +  ++       ER+K   +AK  PK    A+  E+ KE+EL+R IK +MR++++L  + MP +M  RQ    EK+ QK +          ++     K N  VP+F   ++ + +++    +   +T  +PF+L T
Sbjct:  247 WHPRVTVPKPFQMTVREAEWRK--------KGVKSRSEIEQENADLRRQLEELSECQKKFRASPIPAHVRLPLYEDLQERNEERRRLHLEFEQQRLHISQKPFRFLERERLKKEQK--------DAKLREQTLQRNKEEE-------ERRKCPFKAKPVPKAVKEATLGERQKEEELYRAIKMQMRAREMLHTASMPPSMLARQ--LSEKQTQKIIVKD-------AEETHQPKINAEVPDFDASYRRFRKQLAKRKEVMPVTSCEPFQLRT 486          
BLAST of Protein FAM161A vs. Ensembl Zebrafish
Match: fam161b (FAM161 centrosomal protein B [Source:ZFIN;Acc:ZDB-GENE-120928-1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.161e-14
Identity = 99/371 (26.68%), Postives = 179/371 (48.25%), Query Frame = 1
Query: 1000 QFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFN-KSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQ-RPLHR----STNDLENVTQNQYSSTGNNNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIR-RSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKN 2091
            QFR  PVP ++   LY+ +  E  + RQ  RE  ++ L +++KPF F KRE EK+R++      + + S  T         QP+           +R K  PK  ++    E++KE +  R ++  +R++Q L+ +  P    + Q    +K+ +   K+K+  L    +   F  K N TVP+F K+H+ ++++   + +   +TQ KPF+L T   +P HR    S N  + VT  + SS G    ++ +   +      I   +  +S  +R +     L E+E  + +K   Q   + + M  +  +R +++D     K  +  ++K K+ ++ +  R ++YQR+L E+K +V   P L E   QKN
Sbjct:  158 QFRVAPVPEHISKALYDGLMHEQERLRQEGREQRRDFLLTMQKPFMFLKRE-EKKRERLREEKASANKSVKT---------QPVH----------VR-KPIPKSVSDPRFSERLKEQDQQRQMRIHLRAQQTLKAASAP---IQEQEASADKQPRSTQKSKSKMLGYLDQELSFRPKINTTVPDFDKLHQAFQQKSMETTERRDVTQCKPFQLRTSTLQPRHRSPENSKNSTDKVTIKRSSSFGGLTSLSMDTLPTY-----ITDAARKRSMAVRRSLELKDLKEQENADWMK---QHRIRSQAMSKAVAMRAKAMDPHKSLK--EVYQEKLKQHRLADLERIKDYQRELKEMKTRVTVRPYLFEQVSQKN 494          
BLAST of Protein FAM161A vs. Ensembl Xenopus
Match: fam161a (FAM161A, centrosomal protein [Source:NCBI gene;Acc:100144951])

HSP 1 Score: 121.324 bits (303), Expect = 1.067e-27
Identity = 128/447 (28.64%), Postives = 218/447 (48.77%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPG-NMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRS------TNDLENV--TQNQYSSTGNNNLINSE---WNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETK---------NHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKNKYVN 2103
            W HK+T+P+PF+MT+RE  K++   K        S++ +E +    +K+ +E  E +K+FRANPVP++VY+PLY+ + E + +RR F++E +K+IL + +KPF F +RE   +R+KT             +   N S   P  ++         +AK  PK     ST E++KE+EL+R I+  MR+++LL+ S  P   +A       +K K           + + K     K + T+P+   +H++ ++ +  S    ++T  +PF+L T   P H+         D EN+  T+  Y S      I+S     N    A   I  P + + +  RE+AI+ K  EE+ K            K  E+L KK+        I R    +S          K KEL+   + R ++Y ++L+ ++++V   PLL+E   Q+N  ++
Sbjct:  231 WSHKITIPEPFQMTIRESKKKEMNIK--------SKSEIELENNLLKKKLEEEAECQKKFRANPVPSSVYLPLYQEIVERNEERRSFVKEKSKDILLATQKPFQFIERE---ERKKT-----------LRLDFMNLSTSVPSANH--------FKAKPVPKSIYGTSTAERLKEEELYRGIRIHMRAQELLQNSSYPTITLAPGAHSGTKKGK---------CYKPKEKQKHKPKISATIPHSQTMHENQQKRLPESTSTKHVTVCEPFQLRTSNIPSHKEKIIMDIQADEENLKETRWPYKSPRAQARIHSSAGTLNPQGEALCNI--PRSTELSKRREHAIR-KATEEKEKLEADWKKRKAKQKQREKLLKKR-------IIAREKANDSYQNVSPTSHNKVKELRKREKQRTKDYMKELEAMEQRVLNKPLLIERVAQRNALMS 628          
BLAST of Protein FAM161A vs. Ensembl Xenopus
Match: fam161a (FAM161A, centrosomal protein [Source:NCBI gene;Acc:100144951])

HSP 1 Score: 117.472 bits (293), Expect = 1.492e-26
Identity = 86/280 (30.71%), Postives = 149/280 (53.21%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPG-NMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHR 1662
            W HK+T+P+PF+MT+RE  K++   K        S++ +E +    +K+ +E  E +K+FRANPVP++VY+PLY+ + E + +RR F++E +K+IL + +KPF F +RE   +R+KT             +   N S   P  ++         +AK  PK     ST E++KE+EL+R I+  MR+++LL+ S  P   +A       +K K           + + K     K + T+P+   +H++ ++ +  S    ++T  +PF+L T   P H+
Sbjct:  225 WSHKITIPEPFQMTIRESKKKEMNIK--------SKSEIELENNLLKKKLEEEAECQKKFRANPVPSSVYLPLYQEIVERNEERRSFVKEKSKDILLATQKPFQFIERE---ERKKT-----------LRLDFMNLSTSVPSANH--------FKAKPVPKSIYGTSTAERLKEEELYRGIRIHMRAQELLQNSSYPTITLAPGAHSGTKKGK---------CYKPKEKQKHKPKISATIPHSQTMHENQQKRLPESTSTKHVTVCEPFQLRTSNIPSHK 465          
BLAST of Protein FAM161A vs. Ensembl Xenopus
Match: fam161a (FAM161A, centrosomal protein [Source:NCBI gene;Acc:100144951])

HSP 1 Score: 117.087 bits (292), Expect = 2.176e-26
Identity = 86/280 (30.71%), Postives = 149/280 (53.21%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPG-NMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHR 1662
            W HK+T+P+PF+MT+RE  K++   K        S++ +E +    +K+ +E  E +K+FRANPVP++VY+PLY+ + E + +RR F++E +K+IL + +KPF F +RE   +R+KT             +   N S   P  ++         +AK  PK     ST E++KE+EL+R I+  MR+++LL+ S  P   +A       +K K           + + K     K + T+P+   +H++ ++ +  S    ++T  +PF+L T   P H+
Sbjct:  231 WSHKITIPEPFQMTIRESKKKEMNIK--------SKSEIELENNLLKKKLEEEAECQKKFRANPVPSSVYLPLYQEIVERNEERRSFVKEKSKDILLATQKPFQFIERE---ERKKT-----------LRLDFMNLSTSVPSANH--------FKAKPVPKSIYGTSTAERLKEEELYRGIRIHMRAQELLQNSSYPTITLAPGAHSGTKKGK---------CYKPKEKQKHKPKISATIPHSQTMHENQQKRLPESTSTKHVTVCEPFQLRTSNIPSHK 471          
BLAST of Protein FAM161A vs. Ensembl Xenopus
Match: FAM161B (FAM161B, centrosomal protein [Source:NCBI gene;Acc:100492844])

HSP 1 Score: 90.8929 bits (224), Expect = 2.412e-18
Identity = 117/424 (27.59%), Postives = 209/424 (49.29%), Query Frame = 1
Query:  838 VTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKS-NKTVPNFSKIHKDWEEE--IRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALEI-AKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDK--IRRSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKN 2091
            VTVP+PF+MT+RE + RK +   D        T ++ +         E  E  KQFRA PVP+ V++PLY+ + EE   +R+      KE+L S +KPF F  +E E++++KT + ++   P       +    +    SY     +TI+          + +  +K+KE EL R I +++R+K +LE S  P  +  R+R   + +    LK K   L    ++  F  + N  VP+F K++K ++ E  +  + KEP  T+ KPF L T +R   R       +  +  S T + ++ N + +   L  L +    STN+    R+ AI++ L EE+   + K+ E   K+K++  ++ +   RR+  ++      D  + K    +  +  R + Y+ +L+++K +V++ P L E   ++N
Sbjct:  138 VTVPRPFQMTLRE-ADRKIKLNLD--AFCNMDTTIDTE-------SMEDPECLKQFRAQPVPSKVFMPLYDELVEEHEAKRKAHILKRKELLLSTQKPFRFLTKE-EERKKKTVLRSETAPPG------QQQQQRIKCNSY-----RTIL----------DPALSDKLKETELLRKINSQIRAKDMLENSAAPIPVTRRER---DPQTSTLLKTKQEHLGYLQQNLTFQPNINTAVPDFQKLYKMFQRESLLNQNVKEP--TRNKPFTLHTSRRSEQRKQRQTP-MEASADSKTPSRSISNMDLSSLSLNTLPVYITDSTNR----RKLAIRSSL-EEKHHQNTKSAEWSKKQKKKGQLTQRSLSRRAKALDPHLSLADTIKDKLNYNRQSDLRRAKEYREELEQMKSRVKERPYLFEHVTKRN 518          
BLAST of Protein FAM161A vs. Ensembl Mouse
Match: Fam161b (family with sequence similarity 161, member B [Source:MGI Symbol;Acc:MGI:2443027])

HSP 1 Score: 82.0333 bits (201), Expect = 1.488e-15
Identity = 139/541 (25.69%), Postives = 239/541 (44.18%), Query Frame = 1
Query:  499 PQIPKFKTNHPSQGYFKDVKNHFDMYP----NDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLY-ETMQEESNQRRQFIREYNKEILKSVEKPFNFY-KREMEK----QRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLS-LRTRSKSADFN-KSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN-HIKAVEQLAKKKREMDVSDKIR-RSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            PQ+PK       +G +  +++ F   P    ND +D   ++SF    +           G    +D  + R  + +R ++M  L  S    ++ +  S+ G    S    V  W   +TVPQPF MT+RE  K+         +   S    E +  +A+K+ +E  E  +QFRA PVPA+VY+PLY E M+    +RR  IR+  KE+L S  KPF+F  K+E +K    QR    +A     P K+T                         +++ PK     +  +K++E EL R I+ +MR+   L  +  P + A  +  +   R Q+E     LS L+T     +F  K N  VP++  ++K +++      +    T+ KPF L T        + D       + S       +    + S LA+            +T  RE+A++  L +++  +  I+ +E   K  + M  S  +R +++D       E+  + K KE +  +  R + Y+++L+E+KK+++  P L E
Sbjct:   72 PQVPK------QRGRWDVLESLFQSDPDSDLNDAEDEEDLESFFQDKS----------RGKPQVQDPPSLRHGSMRRCSSMTSLP-SDIPKARILPTSDSGPP--SQHRSVCSWASSITVPQPFRMTLREARKK--------AQWLASPASFEQERLQAQKQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERREARRRAGIRK-RKELLLSSLKPFSFLEKKEQQKEDAPQRDSAAVAQTKVSPKKAT-------------------------SRKIPKSILEPALGDKLQEAELLRKIRIQMRAMDTLRMASSPVSTARNRAPRTAARTQEE----KLSFLQT---EFEFQPKVNPVVPDYEGLYKAFQKRAAERRETRETTRNKPFLLRTANLSHTPRSCDAATAGGGKKSPQPTATPLPRSRSLSGLASFSANTLPVHITDATRKRESAVRMSLEKKDKSDMSIQWLEVHKKNCQAMSKSVTLRAKAMDPHK--SLEEVFKAKLKENRSNDRKRAKEYKKELEEMKKRIQTRPYLFE 550          
BLAST of Protein FAM161A vs. Ensembl Mouse
Match: Fam161b (family with sequence similarity 161, member B [Source:MGI Symbol;Acc:MGI:2443027])

HSP 1 Score: 82.0333 bits (201), Expect = 1.488e-15
Identity = 139/541 (25.69%), Postives = 239/541 (44.18%), Query Frame = 1
Query:  499 PQIPKFKTNHPSQGYFKDVKNHFDMYP----NDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLY-ETMQEESNQRRQFIREYNKEILKSVEKPFNFY-KREMEK----QRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLS-LRTRSKSADFN-KSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN-HIKAVEQLAKKKREMDVSDKIR-RSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            PQ+PK       +G +  +++ F   P    ND +D   ++SF    +           G    +D  + R  + +R ++M  L  S    ++ +  S+ G    S    V  W   +TVPQPF MT+RE  K+         +   S    E +  +A+K+ +E  E  +QFRA PVPA+VY+PLY E M+    +RR  IR+  KE+L S  KPF+F  K+E +K    QR    +A     P K+T                         +++ PK     +  +K++E EL R I+ +MR+   L  +  P + A  +  +   R Q+E     LS L+T     +F  K N  VP++  ++K +++      +    T+ KPF L T        + D       + S       +    + S LA+            +T  RE+A++  L +++  +  I+ +E   K  + M  S  +R +++D       E+  + K KE +  +  R + Y+++L+E+KK+++  P L E
Sbjct:   72 PQVPK------QRGRWDVLESLFQSDPDSDLNDAEDEEDLESFFQDKS----------RGKPQVQDPPSLRHGSMRRCSSMTSLP-SDIPKARILPTSDSGPP--SQHRSVCSWASSITVPQPFRMTLREARKK--------AQWLASPASFEQERLQAQKQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERREARRRAGIRK-RKELLLSSLKPFSFLEKKEQQKEDAPQRDSAAVAQTKVSPKKAT-------------------------SRKIPKSILEPALGDKLQEAELLRKIRIQMRAMDTLRMASSPVSTARNRAPRTAARTQEE----KLSFLQT---EFEFQPKVNPVVPDYEGLYKAFQKRAAERRETRETTRNKPFLLRTANLSHTPRSCDAATAGGGKKSPQPTATPLPRSRSLSGLASFSANTLPVHITDATRKRESAVRMSLEKKDKSDMSIQWLEVHKKNCQAMSKSVTLRAKAMDPHK--SLEEVFKAKLKENRSNDRKRAKEYKKELEEMKKRIQTRPYLFE 550          
BLAST of Protein FAM161A vs. Ensembl Mouse
Match: Fam161a (family with sequence similarity 161, member A [Source:MGI Symbol;Acc:MGI:1921123])

HSP 1 Score: 75.485 bits (184), Expect = 9.264e-14
Identity = 62/201 (30.85%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  835 KVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQ 1437
            K+TVP PFEMTVRE+++R+        K   +R+ LE ++ K +++  E ++   +FRANPVP+ V +PLYE + ++S +RR+  RE N+  L +  KPF F  RE +KQ  + +     F                       +R+    +AK  P+     +  +K KE+EL+   +   + + LL+ S  P   A R+
Sbjct:  124 KITVPVPFEMTVREQNRRE--------KALSARSDLETKLLKRDEDDAECKK---KFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFKFIAREEQKQAVREKKLRDLF---------------------RAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRMLPKVRDLLQNSPWPSRSACRR 292          
BLAST of Protein FAM161A vs. Ensembl Mouse
Match: Fam161a (family with sequence similarity 161, member A [Source:MGI Symbol;Acc:MGI:1921123])

HSP 1 Score: 75.485 bits (184), Expect = 9.264e-14
Identity = 62/201 (30.85%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  835 KVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQ 1437
            K+TVP PFEMTVRE+++R+        K   +R+ LE ++ K +++  E ++   +FRANPVP+ V +PLYE + ++S +RR+  RE N+  L +  KPF F  RE +KQ  + +     F                       +R+    +AK  P+     +  +K KE+EL+   +   + + LL+ S  P   A R+
Sbjct:  124 KITVPVPFEMTVREQNRRE--------KALSARSDLETKLLKRDEDDAECKK---KFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFKFIAREEQKQAVREKKLRDLF---------------------RAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRMLPKVRDLLQNSPWPSRSACRR 292          
BLAST of Protein FAM161A vs. Ensembl Mouse
Match: Fam161a (family with sequence similarity 161, member A [Source:MGI Symbol;Acc:MGI:1921123])

HSP 1 Score: 75.485 bits (184), Expect = 9.264e-14
Identity = 62/201 (30.85%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  835 KVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQ 1437
            K+TVP PFEMTVRE+++R+        K   +R+ LE ++ K +++  E ++   +FRANPVP+ V +PLYE + ++S +RR+  RE N+  L +  KPF F  RE +KQ  + +     F                       +R+    +AK  P+     +  +K KE+EL+   +   + + LL+ S  P   A R+
Sbjct:  124 KITVPVPFEMTVREQNRRE--------KALSARSDLETKLLKRDEDDAECKK---KFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFKFIAREEQKQAVREKKLRDLF---------------------RAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRMLPKVRDLLQNSPWPSRSACRR 292          
BLAST of Protein FAM161A vs. UniProt/SwissProt
Match: sp|Q66KE9|F161A_XENLA (Protein FAM161A OS=Xenopus laevis OX=8355 GN=fam161a PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.592e-28
Identity = 108/363 (29.75%), Postives = 191/363 (52.62%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKT-EIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMP-GNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRS------TNDLENV--TQNQYSSTGNNNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKK 1884
            W HK+T+P+PF+MTVRE  KR+   K        S++ +E +    +++ +E  E +K+FRANPVP++VY+PLY+ + E + +RR+F++E +KEIL + +KPF F +RE   +R+KT  +    F  S+++                     +  +AK  PK     S  E++KE+EL+R I+  MR+++LL+ S  P   +A       +K +  +LK K      + K +D      T+P+F  IH++ ++ +  S    ++T  +PF+L T     H+         D EN+  T+  Y S   +  I+S    ++        P + +S+  RE AI+ K  ++ TK+++K +E + ++
Sbjct:  219 WSHKITIPEPFQMTVRESKKREMNIK--------SKSEIELENNLLKEKLEEEAECQKKFRANPVPSSVYLPLYQEIVERNEERRRFVKEKSKEILLATQKPFQFIERE---ERKKTLRLDLMQFSTSETST--------------------SHFKAKPVPKSIYGTSIVERLKEEELYRGIRTHMRAQELLQSSSYPTSTLASGAHSGTKKGRCYKLKGKQ---EHKPKISD------TIPHFQTIHENQQKRLLESKSAKHVTLCEPFQLRTSNITSHKEKIEMDIQADEENLKETRWPYKSPRASAQIHSAGTMNLRLETLSQTPRSTESSKRREYAIR-KREKQRTKDYMKELEAMEQR 540          
BLAST of Protein FAM161A vs. UniProt/SwissProt
Match: sp|B0BM24|F161A_XENTR (Protein FAM161A OS=Xenopus tropicalis OX=8364 GN=fam161a PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.153e-25
Identity = 86/280 (30.71%), Postives = 149/280 (53.21%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPG-NMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHR 1662
            W HK+T+P+PF+MT+RE  K++   K        S++ +E +    +K+ +E  E +K+FRANPVP++VY+PLY+ + E + +RR F++E +K+IL + +KPF F +RE   +R+KT             +   N S   P  ++         +AK  PK     ST E++KE+EL+R I+  MR+++LL+ S  P   +A       +K K           + + K     K + T+P+   +H++ ++ +  S    ++T  +PF+L T   P H+
Sbjct:  231 WSHKITIPEPFQMTIRESKKKEMNIK--------SKSEIELENNLLKKKLEEEAECQKKFRANPVPSSVYLPLYQEIVERNEERRSFVKEKSKDILLATQKPFQFIERE---ERKKT-----------LRLDFMNLSTSVPSANH--------FKAKPVPKSIYGTSTAERLKEEELYRGIRIHMRAQELLQNSSYPTITLAPGAHSGTKKGK---------CYKPKEKQKHKPKISATIPHSQTMHENQQKRLPESTSTKHVTVCEPFQLRTSNIPSHK 471          
BLAST of Protein FAM161A vs. UniProt/SwissProt
Match: sp|Q96MY7|F161B_HUMAN (Protein FAM161B OS=Homo sapiens OX=9606 GN=FAM161B PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.587e-17
Identity = 119/442 (26.92%), Postives = 208/442 (47.06%), Query Frame = 1
Query:  817 VAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKRE---MEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMP----GNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTE-----QRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN----HIKAVEQLAKKKREMDVSDKIR-RSLD----IESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            V+ W   +TVP+PF MT+RE  K+         +   S    E + ++A+++ +E  E  +QFRA PVPA+VY+PLY+ + E S  RRQ   +  KE+L S  KPF+F ++E    E  RQ+   AT     +++ I  + ++ + P         K+I+            +  +K++E ELFR I+ +MR+  +L+ +  P     N A  Q     + +Q++L   + + R +       + N  VP++  ++K ++       +    T+ KPF L T      QRP      D     + Q S       +    + S LA+L           +T  RE+A+++ L   E KN     I+ +E   KK + M  S  +R +++D    +E + K       K KE +  +  R + Y+++L+E+K++++  P L E
Sbjct:  162 VSSWASSITVPRPFRMTLREARKKA--------EWLGSPASFEQERQRAQRQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERSEARRQAGIQKRKELLLSSLKPFSFLEKEEQLKEAARQRDLAAT-----AEAKISKQKATRRIP---------KSIL----------EPALGDKLQEAELFRKIRIQMRALDMLQMASSPIASSSNRANPQPRTATRTQQEKLGFLHTNFRFQP------RVNPVVPDYEGLYKAFQRRAAKRRETQEATRNKPFLLRTANLRHPQRPC-----DAATTGRRQDSPQPPATPLPRSRSLSGLASLSANTLPVHITDATRKRESAVRSAL---EKKNKADESIQWLEIHKKKSQAMSKSVTLRAKAMDPHKSLEEVFKA------KLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFE 551          
BLAST of Protein FAM161A vs. UniProt/SwissProt
Match: sp|Q8CB59|F161B_MOUSE (Protein FAM161B OS=Mus musculus OX=10090 GN=Fam161b PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.041e-14
Identity = 139/541 (25.69%), Postives = 239/541 (44.18%), Query Frame = 1
Query:  499 PQIPKFKTNHPSQGYFKDVKNHFDMYP----NDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLY-ETMQEESNQRRQFIREYNKEILKSVEKPFNFY-KREMEK----QRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLS-LRTRSKSADFN-KSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALE--IAKPSTNKSTILRENAIKTKLIEEETKN-HIKAVEQLAKKKREMDVSDKIR-RSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLE 2073
            PQ+PK       +G +  +++ F   P    ND +D   ++SF    +           G    +D  + R  + +R ++M  L  S    ++ +  S+ G    S    V  W   +TVPQPF MT+RE  K+         +   S    E +  +A+K+ +E  E  +QFRA PVPA+VY+PLY E M+    +RR  IR+  KE+L S  KPF+F  K+E +K    QR    +A     P K+T                         +++ PK     +  +K++E EL R I+ +MR+   L  +  P + A  +  +   R Q+E     LS L+T     +F  K N  VP++  ++K +++      +    T+ KPF L T        + D       + S       +    + S LA+            +T  RE+A++  L +++  +  I+ +E   K  + M  S  +R +++D       E+  + K KE +  +  R + Y+++L+E+KK+++  P L E
Sbjct:   72 PQVPK------QRGRWDVLESLFQSDPDSDLNDAEDEEDLESFFQDKS----------RGKPQVQDPPSLRHGSMRRCSSMTSLP-SDIPKARILPTSDSGPP--SQHRSVCSWASSITVPQPFRMTLREARKK--------AQWLASPASFEQERLQAQKQGEEEAECHRQFRAQPVPAHVYLPLYQEIMERREARRRAGIRK-RKELLLSSLKPFSFLEKKEQQKEDAPQRDSAAVAQTKVSPKKAT-------------------------SRKIPKSILEPALGDKLQEAELLRKIRIQMRAMDTLRMASSPVSTARNRAPRTAARTQEE----KLSFLQT---EFEFQPKVNPVVPDYEGLYKAFQKRAAERRETRETTRNKPFLLRTANLSHTPRSCDAATAGGGKKSPQPTATPLPRSRSLSGLASFSANTLPVHITDATRKRESAVRMSLEKKDKSDMSIQWLEVHKKNCQAMSKSVTLRAKAMDPHK--SLEEVFKAKLKENRSNDRKRAKEYKKELEEMKKRIQTRPYLFE 550          
BLAST of Protein FAM161A vs. UniProt/SwissProt
Match: sp|Q3B820|F161A_HUMAN (Protein FAM161A OS=Homo sapiens OX=9606 GN=FAM161A PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.096e-13
Identity = 68/233 (29.18%), Postives = 124/233 (53.22%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLE-ESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADF 1521
            W   +TVP+PF+M +RE+ K++   K   +     + L         K+++E  E KK+FRANPVPA+V++PLY  + ++  +RR+ ++E +KE L + +KPF F  RE E++R   E   + F      +  K  +N+               +A+  P+ +  ++T +K+KE+EL+R ++ ++R+++ L+  S +P   A   R      +  +LK K+   + R  + DF
Sbjct:  232 WVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKAL---------KKQEEDPEYKKKFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIARE-EQKRAAREKQLRDF------LKYKKKTNR--------------FKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKCKH---KVRCPTPDF 431          
BLAST of Protein FAM161A vs. TrEMBL
Match: A0A267E5C8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008764g2 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.516e-39
Identity = 141/499 (28.26%), Postives = 254/499 (50.90%), Query Frame = 1
Query:  199 SIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEP-----GNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLD--DTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERN----YKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYH----GERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQR 1650
            +I+ +L ++ GD +K SQ+LD+++S  NR+I++L+E+  +L ++ F +++  LK+ +  T+ + ++ R  A         FD     P     G+  S +   +P      +     Q   + +++      +D D  ++RS     +A+  +  + L R  G   S     RR       ++R     R   S+S  +   D        F      + WRH+VT+P+PF MT+REE+    +      +LRKSR++   + +   +   +  E + + RA PVPA+VY PL   ++++  +RR+ +RE++ E+L++ E+PF+F KRE E++RQ  E AT+A              +K+  + YH    G+R+ T+I AK AP  S +A    +++ +   R  +A  RS+  L  + +PGNMA+RQR  E +R  +     + S R +S +A      + VP+F ++H+ +E  +        +T+P+PF+LLT+QR
Sbjct:   53 AIHSILEKSGGDLEKASQLLDERLSVANRMIRELSESGDSLSHEEFRQRMRLLKSQHRNTVEMTEDLRAAAKNGAGRSVAFDDSKKPPLPPSAGHGGSARRGGQPAAENNEEEARAHQEQQEQLRSRVKALWSDFDVHNSRSQRPRRSASLDRGGVALRRP-GSAASAPGDRRRHSGAIAQFRR-----RRGGSQSGGASDDDRVSLDDSEFDDFEDGSSWRHRVTIPRPFSMTLREEAAADGEAG-QQQQLRKSRSMRIVEADVQRQREAQEAECRVRPRAAPVPAHVYQPLLRELEQQREERRRQVREHSAELLRATERPFSFTKREAERKRQGRERATEA--------------DKR--RGYHRSASGDRESTVICAKPAPA-SCSAERARQLRAEAELRREQARARSEANLRRAALPGNMAQRQRSMEARRDARLAAAASSSTRGQSAAA----VGRDVPDFDRLHRQFELGMLERQAGVRVTRPEPFRLLTQQR 523          
BLAST of Protein FAM161A vs. TrEMBL
Match: A0A267F6W2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014358g1 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.647e-39
Identity = 141/499 (28.26%), Postives = 254/499 (50.90%), Query Frame = 1
Query:  199 SIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEP-----GNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLD--DTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERN----YKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYH----GERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQR 1650
            +I+ +L ++ GD +K SQ+LD+++S  NR+I++L+E+  +L ++ F +++  LK+ +  T+ + ++ R  A         FD     P     G+  S +   +P      +     Q   + +++      +D D  ++RS     +A+  +  + L R  G   S     RR       ++R     R   S+S  +   D        F      + WRH+VT+P+PF MT+REE+    +      +LRKSR++   + +   +   +  E + + RA PVPA+VY PL   ++++  +RR+ +RE++ E+L++ E+PF+F KRE E++RQ  E AT+A              +K+  + YH    G+R+ T+I AK AP  S +A    +++ +   R  +A  RS+  L  + +PGNMA+RQR  E +R  +     + S R +S +A      + VP+F ++H+ +E  +        +T+P+PF+LLT+QR
Sbjct:   53 AIHSILEKSGGDLEKASQLLDERLSVANRMIRELSESGDSLSHEEFRQRMRLLKSQHRNTVEMTEDLRAAAKNGAGRSVAFDDSKKPPLPPSAGHGGSARRGGQPAAENNEEEARAHQEQQEQLRSRVKALWSDFDVHNSRSQRPRRSASLDRGGVALRRP-GSAASAPGDRRRHSGAIAQFRR-----RRGGSQSGGASDDDRVSLDDSEFDDFEDGSSWRHRVTIPRPFSMTLREEAAADGEAG-QQQQLRKSRSMRIVEADVQRQREAQEAECRVRPRAAPVPAHVYQPLLRELEQQREERRRQVREHSAELLRATERPFSFTKREAERKRQGRERATEA--------------DKR--RGYHRSASGDRESTVICAKPAPA-SCSAERARQLRAEAELRREQARARSEANLRRAALPGNMAQRQRSMEARRDARLAAAASSSTRGQSAAA----VGRDVPDFDRLHRQFELGMLERQAGVRVTRPEPFRLLTQQR 523          
BLAST of Protein FAM161A vs. TrEMBL
Match: A0A267EBA3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008764g1 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.711e-39
Identity = 141/499 (28.26%), Postives = 254/499 (50.90%), Query Frame = 1
Query:  199 SIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEP-----GNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLD--DTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERN----YKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYH----GERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQR 1650
            +I+ +L ++ GD +K SQ+LD+++S  NR+I++L+E+  +L ++ F +++  LK+ +  T+ + ++ R  A         FD     P     G+  S +   +P      +     Q   + +++      +D D  ++RS     +A+  +  + L R  G   S     RR       ++R     R   S+S  +   D        F      + WRH+VT+P+PF MT+REE+    +      +LRKSR++   + +   +   +  E + + RA PVPA+VY PL   ++++  +RR+ +RE++ E+L++ E+PF+F KRE E++RQ  E AT+A              +K+  + YH    G+R+ T+I AK AP  S +A    +++ +   R  +A  RS+  L  + +PGNMA+RQR  E +R  +     + S R +S +A      + VP+F ++H+ +E  +        +T+P+PF+LLT+QR
Sbjct:   53 AIHSILEKSGGDLEKASQLLDERLSVANRMIRELSESGDSLSHEEFRQRMRLLKSQHRNTVEMTEDLRAAARNGAGRSVAFDDSKKPPLPPSAGHGGSARRGGQPAAENNEEEARAHQEQQEQLRSRVKALWSDFDVHNSRSQRPRRSASLDRGGVALRRP-GSAASAPGDRRRHSGAIAQFRR-----RRGGSQSGGASDDDRVSLDDSEFDDFDDGSSWRHRVTIPRPFSMTLREEAAADGEAG-QQQQLRKSRSMRIVEADVQRQREAQEAECRVRPRAAPVPAHVYQPLLRELEQQREERRRQVREHSAELLRATERPFSFTKREAERKRQGRERATEA--------------DKR--RGYHRSASGDRESTVICAKPAPA-SCSAERARQLRAEAELRREQARARSEANLRRAALPGNMAQRQRSMEARRDARLAAAASSSTRGQSAAA----VGRDVPDFDRLHRQFELGMLERQAGVRVTRPEPFRLLTQQR 523          
BLAST of Protein FAM161A vs. TrEMBL
Match: A0A2C9M0A6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057055 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 5.973e-38
Identity = 139/440 (31.59%), Postives = 236/440 (53.64%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNN--NLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLI----EEETKNHIKAVEQLAKKKREMDVSDKIRRSL----DIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKNKYVNEPVK 2115
            WRH++T+PQPF M++RE  K K          +K++   E +  + EK++QE  E +K+F+A PVP++VY+P YE + E++  RRQ++++Y KE+L+S  KPF+F  RE EK+ Q+   A     P K T V                  KT  +AK  PKH  +    EK  E+E  R I+  MR+K+LL E+ +P +MAER++++E    +K+ K K + +  + KS  +  +   +P++  ++KD+++E+         T  +PF   TE+  LH++ N + ++ Q++ +S  N+  + I+    +S L  L     S +    L   A   + I    E+E  NH +  E+   +KR      K+R+ L    +   IP   D   ++ K+ + E+ +R+E YQR+++E+K K+E+ PLL+E      KY+ E  K
Sbjct:  288 WRHRITIPQPFTMSLREALKEK----------KKTKAQQELEERRLEKQKQEEAECEKKFKAQPVPSHVYLPKYEEIMEKNESRRQYVKQYCKELLESQVKPFHFETREKEKKMQRAHSA-----PVKRTQVF-----------------KTTFKAKPVPKHIFSPEIDEKFLEEEELRKIRVRMRAKELLHEAALPPSMAEREKLKE---IEKQEKAKQIKMAAKKKSVRYAHN---IPDYDALYKDFQKELSRHKATKEGTVVEPFNFETERVHLHQAKN-INDIDQDERNSKENHFPHQISRTTPRSALKYLGALSNSLDSIPALSSKAADLRTIRAKKEQERINH-RLAEEEEAEKRRKARESKLRQYLKEKTNANDIPNPRDSIAERLKKKRQEDRIRQEAYQREIEEMKHKIEKSPLLVE------KYMAEKAK 681          
BLAST of Protein FAM161A vs. TrEMBL
Match: A0A419PJS0 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=fam161a PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.367e-36
Identity = 171/648 (26.39%), Postives = 305/648 (47.07%), Query Frame = 1
Query:  211 LLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEPGNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLDDTRSMDSFGNA--NNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRK-FQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKEL---KNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYK-EPYITQPKPFKLLTEQRPLHRSTNDLENVTQ----NQYSSTGNNNLI----------NSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIENELRKE-------NYQRQLDEIKKKVEQLPLLL 2070
            LL  T+GD  + +++LD  ++ET   IK LTE  +N+ +  F EKL++LK ++ ET+ + +                           S+ L +K  +  +  TN+P +       +      ND   +    + GN     +K  +  +R Y  +   D I    R+   E A               +E   G +        ++WRH VT+P+PF MT REE K++         +L+  +  +E  + + E           QFRA P+PANVY+P YE + EE+ +RR+ ++ Y++EILK  EKPF F  RE  +   ++  A++     K+   L+  S ++P      ER+++     +  +H +   +  KM++D+L R IK  +R+++LL+ + +P  M ERQ I+ + R+ + +   + + L +    +   F    +  P+F K+H + E+ +R  ++  P  T PKPFKL T +R   RS++   + TQ      YS  G++  +           S  ++ +  A ++  P+ +  T+LREN I+  + +   +   +   +LA + R+ ++S  I  SLD        D+  Q  K +    E RK+       +YQR+++E++K+V   PLL+
Sbjct:   34 LLSVTKGDLAQTAKLLDAILNETQTKIKKLTEE-ENISDSEFYEKLSQLKKNHKETLEIVEHLYL----------------------GSETLVEKTDKQKEGVTNNPEKPNVNISNDQRRASENDDPSSYLPLTIGNMERGAAKNPISEFRLYSPLKYSDPIRPNVRSISAEKA---------------NECMNGGDVLFCGSASSEWRHHVTIPKPFNMTKREELKKQEACASCTSCRLQDGKQKIEHHIREGECGGTG------QFRAQPIPANVYLPRYEQITEENARRRETVKAYSQEILKQTEKPFRFTLREKFRN-DRSASASEVMKVDKARNQLRCQSARKP------ERERSRTAEPKVREHVSQGRS-SKMEDDKLLREIKRHLRAERLLQSAALPPGMEERQ-IRSQLRRAERMARAQERGLPMSETDQRKPFKA--RPAPDFKKVHWESEKALRRIWQPPPDPTCPKPFKLRTTER---RSSSSGRHTTQYSEPGAYSVPGDSFCVKKEDPFIRKRTSSESRYLQHAYDMPLPAKSHGTMLRENHIRQSIEKMRFQTEKEKEAELATRTRQKEISRAISESLD--------DRVLQPRKVIDAMTEQRKQTLIHQDADYQREMEEMRKRVASKPLLI 615          
BLAST of Protein FAM161A vs. Ensembl Cavefish
Match: fam161a (FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-GENE-110310-1])

HSP 1 Score: 104.76 bits (260), Expect = 1.062e-22
Identity = 91/285 (31.93%), Postives = 149/285 (52.28%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSV-EKPFNFYKRE-MEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFN----------KSNKTVPNFSKIHKDWEEEIRMS-YKEPYITQPKPFKLLT 1641
            WR +VTVP+PF M +RE + +        +K  KSR+ +E +  +  ++ +EL E +++FRA+PVPA+V +PLYE +QE+  +RR+ +R   ++ L S+ +KPF+F +RE ++K++++ ++  Q    SK     +                    RAK  PK    A+T E  KE++L+R IK +MR+++LL+ S MP +M                  K LS R   KSA  N          K N  VP+F   +K ++ ++    Y  P +T  +PF+L T
Sbjct:  242 WRPQVTVPKPFRMMLREAALK--------SKGVKSRSEIERENTELRQQLEELTECQRKFRASPVPAHVRLPLYEELQEKDEERRRQLRTREQQHLLSITQKPFSFLERERLKKEQKEVQLQEQMLLISKEEEERRRRP----------------FRAKPVPKVVKEAATGELQKEEQLYRSIKMQMRARELLQSSSMPPSML----------------AKRLSDRQAQKSASQNDQEAEQSHRPKINAQVPDFDATYKRFQNQLASKRYLRP-LTACEPFQLRT 485          
BLAST of Protein FAM161A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001206.1 (pep scaffold:Pmarinus_7.0:GL478099:4085:4897:1 gene:ENSPMAG00000001084.1 transcript:ENSPMAT00000001206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.537e-14
Identity = 60/205 (29.27%), Postives = 100/205 (48.78%), Query Frame = 1
Query:  826 WRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKRE--MEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAER 1434
            W  K+T+P+PF MTVREE +R+        K R +R L +   E+ ++E +     KKQFRA PVPA+ + PL+  M +++       R+ NK+         N   R+     + Q+ E+  +  D                     GE++    +AK  P+   + +  E+++E+EL+R I+  +R+ + L ES +PG MA R
Sbjct:   33 WTPKITIPEPFGMTVREEERRRH-----GVKSRSARRLEKLVQEQQKQEAELEALRKKQFRATPVPAHTFKPLFTAMHQDN-------RQPNKK--------SNTASRDDRSTTKMQQAEVTGKGGD--------------------TGEQRG--FKAKPVPRSVYDPAVAERIREEELYRRIRMRVRADETLRESALPGGMARR 195          
BLAST of Protein FAM161A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005022.1 (pep scaffold:Pmarinus_7.0:GL476553:7378:19265:-1 gene:ENSPMAG00000004560.1 transcript:ENSPMAT00000005022.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.110e-10
Identity = 41/142 (28.87%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 1000 QFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNM 1425
            + RA PVPA   +PLY  ++E + +R    R   KE L++  KPF F +RE  K+   T   + A   + +    + +          G  ++  +RA   P      S  E++  DEL R ++A MR+++LLE++ +P  +
Sbjct:   20 RVRAAPVPARSLLPLYHELRERAQRRSHDNRAARKEELRASLKPFEFAEREENKREDVTRRVSAAISATDTATESRRA----------GSAERPALRAVLDP------SVSERLAADELLRRVRAGMRAQELLEKAAIPPGL 145          
BLAST of Protein FAM161A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005025.1 (pep scaffold:Pmarinus_7.0:GL476553:18532:23692:-1 gene:ENSPMAG00000004560.1 transcript:ENSPMAT00000005025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 5.309e-7
Identity = 35/106 (33.02%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  835 KVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKRE 1152
            KVT+P+PF +  RE  +   +        R+ R   E      E+ ++E  E   + RA PVPA   +PLY  ++E + +R    R   KE L++  KPF F +RE
Sbjct:  104 KVTIPKPFSLVQREVEREAARGT------RRRRLAEELARLALERRQREEAECAVRVRAAPVPARSLLPLYHELRERAQRRSHDNRAARKEELRASLKPFEFAERE 203          
BLAST of Protein FAM161A vs. Ensembl Nematostella
Match: EDO40222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7M5])

HSP 1 Score: 117.087 bits (292), Expect = 9.617e-27
Identity = 157/681 (23.05%), Postives = 285/681 (41.85%), Query Frame = 1
Query:  274 ETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEPGNDNSKKLSDKPPQ--IPKFKTNHPSQGYFKD------------VKNHF-DMYPNDLDDTRSMDSFGNANNSKQNLKLYREYGD--------------------VDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKS-NKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRP---LHRSTNDLENVTQNQYSSTGN-------------------------------NNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIE-----NELRKENYQRQLDEIKKKVEQLPLLLETAVQKN 2091
            +T + I+D  + ++      F + L  LK +   T+   ++     S  EK++  FD       ++N++   D  PQ  IP  ++  P +  ++D            V++   DM   +    R +D  G     K+NL+  R YGD                    + SE  +  +E   +R AA++ +       S Y    ++      P      W   +T+P PF MT+RE  K   QK        +S+ +LE ++   + + +       +FRA PVPA  ++PL++ +  +   RR  +RE +K ILKS EKPF+F KRE EK+R                  +  S +   L     +++K   RA   P    + +  +K+ E E +R IK  MRS+++L  S++P NM  R R     + + + + +       +K   F  + N  VP+F ++ + +E+E+R   +E   T  +PF+L T       L +ST  L+   +   S +                                 + +++S W+             T ++T +RE  I+  L E   +   +  E+  ++K+   +   + R +    +      + +KT ++KI+     +  R+E Y+++L +++ +V Q PLL E   Q N
Sbjct:   65 QTPKSIRDSLKQLQTADQADFYKHLVALKKEQKRTLKTVEKM--YYSELEKQRSGFDL------DENTRISLDYEPQLDIPHHESFDPFEKGYEDEYIEGTQQSRSPVRDFLRDMSSREPTYNREIDDIGQQAEDKENLR--RSYGDMSDNDSWHGDEVEDVPRKRTLSSEGRVLYKEMFPRRSAALDVVEDMWKDFSVYDYPRDREDSPQKPTQEKDTWSPCITIPNPFSMTIREAKKTAKQKT-------RSQRILEEELRAKKAQEEAEIRK--KFRAQPVPATTFLPLHDELMRQEELRRHEVREMSKAILKSTEKPFSFMKREEEKKR------------------MWRSKSLSSLNDLTPKKEKKTFRANPFPAKLFDLTLKDKLAEQEEYRTIKNRMRSEEMLASSRLPMNMESRGRHYNIGKLRSKQQKEKEKKAFMTKEHTFRPNINPDVPDFDELQRQFEKEMRRKKREKEPTVVEPFQLRTAHLSAARLSKSTQSLDRGLRGSRSQSRERPSSARARDRPRERSRDSCSSARSSSRERPLSAMLSSSWDTLPFG--------TTEATRMREGRIRESLKERRAREQAELKEEQQRQKKLKSMRPHVARKV----MANDSSWQLKKTSDVKIKSFREADRARREEYEQELRDMQSRVSQRPLLFERQSQLN 696          
BLAST of Protein FAM161A vs. Ensembl Medaka
Match: fam161a (FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-GENE-110310-1])

HSP 1 Score: 106.301 bits (264), Expect = 2.138e-23
Identity = 92/279 (32.97%), Postives = 156/279 (55.91%), Query Frame = 1
Query:  829 RHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFN-KSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHR 1662
            +H+VTVP+PF MT+RE  +RK   K        +R+ +E +  +  ++ +E+ E +++FRA+PVPA+V++PLYE ++E S +RR+ ++E  ++ L +V+KPF+F +RE  K+ QK     Q   PS    V       +P K            AK  PK    A++ E++KE++L+R IK +MR++++L+ S MP +M  R R+ + K      KNK+ S    + S     + NK VP+F   H+ +++ +    +    T  +PF+L T Q   H+
Sbjct:  241 KHRVTVPKPFHMTLREAQRRKLGIK--------TRSEIELENMELRRQLEEVTECQRKFRASPVPAHVHLPLYEELRERSEERRRTLQEREEKHLGTVQKPFSFIERERLKKEQK-----QQGQPSDQEKV-------KPFK------------AKPVPKSVYAAASGEQLKEEQLYRSIKIQMRAQEMLQSSSMPPSMLTR-RLSDRK------KNKDGSAAEGAGSFSHRPQINKEVPDFDAKHRRFQKHLEKRKEVKPTTTCEPFELRTSQISSHK 480          
BLAST of Protein FAM161A vs. Ensembl Medaka
Match: ENSORLT00000032804.1 (protein FAM161A-like [Source:NCBI gene;Acc:101164426])

HSP 1 Score: 68.5514 bits (166), Expect = 1.001e-11
Identity = 46/126 (36.51%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  820 AKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAF 1197
            A+ R KVTVP+PF+M +REE K+K Q         ++R+ +E +     +E +EL E +K+FRA P PA++++PLYE +    ++R++ IRE  +       KPF+F +RE  K+  + E     F
Sbjct:  185 ARGRSKVTVPKPFQMMLREEEKKKHQV--------RTRSEIELENTLLRQELEELRECQKKFRATPAPAHIHLPLYEVI----SRRQKNIRENIRGSAAVFPKPFHFLEREKRKREARMEAELGTF 298          
BLAST of Protein FAM161A vs. Ensembl Medaka
Match: ENSORLT00000003204.2 (protein FAM161A-like [Source:NCBI gene;Acc:101164426])

HSP 1 Score: 68.5514 bits (166), Expect = 1.072e-11
Identity = 46/126 (36.51%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  820 AKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAF 1197
            A+ R KVTVP+PF+M +REE K+K Q         ++R+ +E +     +E +EL E +K+FRA P PA++++PLYE +    ++R++ IRE  +       KPF+F +RE  K+  + E     F
Sbjct:  203 ARGRSKVTVPKPFQMMLREEEKKKHQV--------RTRSEIELENTLLRQELEELRECQKKFRATPAPAHIHLPLYEVI----SRRQKNIRENIRGSAAVFPKPFHFLEREKRKREARMEAELGTF 316          
BLAST of Protein FAM161A vs. Planmine SMEST
Match: SMESG000042541.1 (SMESG000042541.1)

HSP 1 Score: 1461.82 bits (3783), Expect = 0.000e+0
Identity = 738/741 (99.60%), Postives = 739/741 (99.73%), Query Frame = 1
Query:  121 MFNRRIFKEPNIISFPDDKEIPTKNTSIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEPGNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMXXXXXXXXXXXXXXXQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKNKYVNEPVKVPQSSHKPSSNKPDLFNNYDERNNFGDPSSNRSSTDVSGSMEELNSYQRNNHSKKWQNEDEPFHPNYDQNNHSNKY 2343
            MFNRRIFKEPNIISFPDDKEIPTKNTSIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEPGNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMEKAEKERQELEETKKQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKNKY N PVKVPQSSHKPSSNKPDLFNNYDERNNFGDPSSNRSSTDVSGSMEELNSYQRNNHSKKWQNEDEPFHPNY+QNNHSNKY
Sbjct:    1 MFNRRIFKEPNIISFPDDKEIPTKNTSIYELLLQTEGDYKKVSQILDQKISETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRKEKEQENFDFRNFEPGNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFDMYPNDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKREAAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTVREESKRKFQKKFDDNKLRKSRTLLEFQMEKAEKERQELEETKKQFRANPVPANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQKTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNNASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKELKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQPKPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALEIAKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRRSLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLLETAVQKNKYANGPVKVPQSSHKPSSNKPDLFNNYDERNNFGDPSSNRSSTDVSGSMEELNSYQRNNHSKKWQNEDEPFHPNYNQNNHSNKY 741          
The following BLAST results are available for this feature:
BLAST of Protein FAM161A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM161B4.035e-1827.11FAM161 centrosomal protein B [Source:HGNC Symbol;A... [more]
FAM161B5.387e-1826.92FAM161 centrosomal protein B [Source:HGNC Symbol;A... [more]
FAM161A8.171e-1430.04FAM161 centrosomal protein A [Source:HGNC Symbol;A... [more]
FAM161A8.529e-1429.18FAM161 centrosomal protein A [Source:HGNC Symbol;A... [more]
FAM161A1.049e-1329.18FAM161 centrosomal protein A [Source:HGNC Symbol;A... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM161A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM161A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam161a1.701e-2432.72FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-... [more]
fam161b2.161e-1426.68FAM161 centrosomal protein B [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam161a1.067e-2728.64FAM161A, centrosomal protein [Source:NCBI gene;Acc... [more]
fam161a1.492e-2630.71FAM161A, centrosomal protein [Source:NCBI gene;Acc... [more]
fam161a2.176e-2630.71FAM161A, centrosomal protein [Source:NCBI gene;Acc... [more]
FAM161B2.412e-1827.59FAM161B, centrosomal protein [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam161b1.488e-1525.69family with sequence similarity 161, member B [Sou... [more]
Fam161b1.488e-1525.69family with sequence similarity 161, member B [Sou... [more]
Fam161a9.264e-1430.85family with sequence similarity 161, member A [Sou... [more]
Fam161a9.264e-1430.85family with sequence similarity 161, member A [Sou... [more]
Fam161a9.264e-1430.85family with sequence similarity 161, member A [Sou... [more]
back to top
BLAST of Protein FAM161A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66KE9|F161A_XENLA3.592e-2829.75Protein FAM161A OS=Xenopus laevis OX=8355 GN=fam16... [more]
sp|B0BM24|F161A_XENTR1.153e-2530.71Protein FAM161A OS=Xenopus tropicalis OX=8364 GN=f... [more]
sp|Q96MY7|F161B_HUMAN2.587e-1726.92Protein FAM161B OS=Homo sapiens OX=9606 GN=FAM161B... [more]
sp|Q8CB59|F161B_MOUSE1.041e-1425.69Protein FAM161B OS=Mus musculus OX=10090 GN=Fam161... [more]
sp|Q3B820|F161A_HUMAN4.096e-1329.18Protein FAM161A OS=Homo sapiens OX=9606 GN=FAM161A... [more]
back to top
BLAST of Protein FAM161A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E5C83.516e-3928.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F6W23.647e-3928.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EBA34.711e-3928.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9M0A65.973e-3831.59Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A419PJS02.367e-3626.39Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam161a1.062e-2231.93FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001206.11.537e-1429.27pep scaffold:Pmarinus_7.0:GL478099:4085:4897:1 gen... [more]
ENSPMAT00000005022.11.110e-1028.87pep scaffold:Pmarinus_7.0:GL476553:7378:19265:-1 g... [more]
ENSPMAT00000005025.15.309e-733.02pep scaffold:Pmarinus_7.0:GL476553:18532:23692:-1 ... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM161A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO402229.617e-2723.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM161A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fam161a2.138e-2332.97FAM161 centrosomal protein A [Source:ZFIN;Acc:ZDB-... [more]
ENSORLT00000032804.11.001e-1136.51protein FAM161A-like [Source:NCBI gene;Acc:1011644... [more]
ENSORLT00000003204.21.072e-1136.51protein FAM161A-like [Source:NCBI gene;Acc:1011644... [more]
back to top
BLAST of Protein FAM161A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042541.10.000e+099.60SMESG000042541.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030365 ID=SMED30030365|Name=Protein FAM161A|organism=Schmidtea mediterranea sexual|type=transcript|length=2554bp
GCATTTTTGATAACATATCAAATTCAAATATTCTTTTAATTTAATTATCT
AAATTTGGATTATTTAACATTCAACGAAACTTGTTACGTATAGAATATCC
AAATTTTTTATTCATTCCTAATGTTTAACAGAAGAATTTTTAAAGAACCC
AATATAATTAGTTTCCCGGACGATAAAGAAATCCCAACTAAAAACACAAG
CATTTATGAGTTGCTTCTTCAAACAGAAGGCGATTACAAAAAGGTAAGTC
AGATATTAGATCAAAAAATTTCGGAAACCAATCGTCTTATTAAAGACTTA
ACAGAAAACATTAAAAATCTACCAAATGATTCATTTGAAGAGAAATTAAA
TAAATTAAAAAATGATAATTTAGAAACAATGCTTTTATGCGATGAATTTC
GTAAGATAGCCTCTCGAAAGGAGAAAGAGCAAGAAAATTTTGATTTCAGG
AATTTCGAACCTGGCAATGATAATTCAAAAAAGCTTTCTGACAAACCTCC
TCAAATTCCTAAATTTAAAACCAATCATCCTAGTCAAGGATATTTCAAAG
ATGTCAAAAATCATTTCGATATGTATCCAAATGATTTAGATGATACAAGA
TCAATGGATTCATTTGGAAATGCTAATAATTCTAAACAAAATCTCAAATT
GTATAGGGAATATGGTGATGTAGATAGTGAAGATGAGATCAATAGGCGCG
AAAGGAATTATAAAAGAGAAGCAGCTATGGAAAGATTAACTCGTTCCAAA
TCTTCTCTATCTAAATATATTGATGAGTCAGAAAAAGGCCAAGAGACATT
TAGTCCTGATTATCTTGTAGCTAAATGGCGACATAAAGTAACAGTGCCTC
AGCCTTTTGAAATGACTGTAAGAGAAGAATCCAAAAGGAAATTTCAAAAA
AAATTTGATGATAATAAACTTCGAAAAAGCCGTACACTTTTAGAATTTCA
AATGGAAAAGGCAGAAAAAGAAAGACAGGAATTAGAAGAAACTAAAAAAC
AATTTAGAGCTAATCCTGTTCCAGCCAATGTATATATACCACTCTATGAA
ACGATGCAAGAAGAATCGAACCAAAGACGACAATTCATTCGAGAATACAA
TAAAGAAATATTAAAATCAGTAGAAAAACCTTTTAATTTTTATAAGCGAG
AAATGGAAAAGCAGAGACAAAAAACTGAAATTGCAACTCAGGCCTTTGAT
CCTTCAAAATCTACGATTGTACTTAAAAATTCATCAAACAAACAACCTTT
GAAAAGTTATCATGGAGAAAGACAGAAGACCATTATACGAGCAAAAGAAG
CTCCAAAGCATTCAAACAATGCTTCGACATTTGAAAAAATGAAGGAAGAT
GAACTTTTTCGACTTATTAAAGCTGAAATGCGATCAAAACAACTATTAGA
AGAATCAAAAATGCCCGGAAATATGGCTGAACGACAAAGAATACAAGAAG
AAAAGCGAAAACAGAAAGAACTTAAAAATAAAAATCTCTCTTTGCGCACC
AGATCCAAATCGGCTGATTTTAATAAATCCAATAAAACTGTTCCGAATTT
TTCGAAAATTCATAAAGACTGGGAAGAAGAAATCCGAATGAGCTATAAAG
AACCTTATATAACTCAACCGAAACCTTTTAAATTACTCACTGAGCAAAGA
CCTCTTCACCGTTCAACGAATGATCTTGAGAATGTAACACAAAATCAGTA
CAGTTCTACAGGCAATAACAATTTGATCAATTCTGAATGGAATAAATCAA
TTCTAGCTGCATTGGAAATCGCGAAACCTTCGACAAACAAGTCTACAATA
CTCCGAGAAAACGCTATCAAGACAAAGCTTATTGAAGAGGAAACGAAAAA
TCATATTAAAGCCGTCGAGCAGTTAGCTAAAAAGAAAAGAGAAATGGATG
TTTCAGATAAAATTCGTAGATCTCTTGATATTGAATCTATTCCTAAAGGC
GAAGATAAGCGAAGGCAGAAAACAAAAGAATTGAAAATTGAGAATGAATT
ACGGAAAGAAAATTATCAACGACAGCTTGATGAAATTAAAAAGAAAGTTG
AACAGTTACCTCTTTTGCTGGAAACTGCTGTACAAAAAAATAAATATGTC
AATGAACCTGTTAAAGTTCCCCAAAGCAGTCATAAACCATCAAGTAACAA
ACCAGATCTTTTTAATAATTATGATGAACGGAACAATTTTGGTGATCCCT
CCAGTAATAGGAGCTCAACAGATGTCAGCGGTTCAATGGAAGAGTTGAAT
TCATATCAAAGAAATAATCATTCGAAAAAGTGGCAGAACGAAGATGAACC
ATTCCATCCTAATTACGATCAAAATAATCATTCAAACAAATATTAAATAT
CAAAAAAATAATTTTATCAACGGAAATTCGATAATTTGATGTTTTTATGA
ATTTCTCAATTTCTATAAAAAATTTTTCCAATTATTAAATTCAAGTTTTC
AATTTTTCAATAATTTTCATTTTATGAAATTAATTCTACGATTTATTATC
TAAATGTTCTATCAACAGATTATTTCCAGAAATAACTATTTTTTGCTATT
GGGC
back to top

protein sequence of SMED30030365-orf-1

>SMED30030365-orf-1 ID=SMED30030365-orf-1|Name=SMED30030365-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=742bp
MFNRRIFKEPNIISFPDDKEIPTKNTSIYELLLQTEGDYKKVSQILDQKI
SETNRLIKDLTENIKNLPNDSFEEKLNKLKNDNLETMLLCDEFRKIASRK
EKEQENFDFRNFEPGNDNSKKLSDKPPQIPKFKTNHPSQGYFKDVKNHFD
MYPNDLDDTRSMDSFGNANNSKQNLKLYREYGDVDSEDEINRRERNYKRE
AAMERLTRSKSSLSKYIDESEKGQETFSPDYLVAKWRHKVTVPQPFEMTV
REESKRKFQKKFDDNKLRKSRTLLEFQMEKAEKERQELEETKKQFRANPV
PANVYIPLYETMQEESNQRRQFIREYNKEILKSVEKPFNFYKREMEKQRQ
KTEIATQAFDPSKSTIVLKNSSNKQPLKSYHGERQKTIIRAKEAPKHSNN
ASTFEKMKEDELFRLIKAEMRSKQLLEESKMPGNMAERQRIQEEKRKQKE
LKNKNLSLRTRSKSADFNKSNKTVPNFSKIHKDWEEEIRMSYKEPYITQP
KPFKLLTEQRPLHRSTNDLENVTQNQYSSTGNNNLINSEWNKSILAALEI
AKPSTNKSTILRENAIKTKLIEEETKNHIKAVEQLAKKKREMDVSDKIRR
SLDIESIPKGEDKRRQKTKELKIENELRKENYQRQLDEIKKKVEQLPLLL
ETAVQKNKYVNEPVKVPQSSHKPSSNKPDLFNNYDERNNFGDPSSNRSST
DVSGSMEELNSYQRNNHSKKWQNEDEPFHPNYDQNNHSNKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR019579UPF0564
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 434..461
NoneNo IPR availableCOILSCoilCoilcoord: 43..63
NoneNo IPR availableCOILSCoilCoilcoord: 571..591
NoneNo IPR availableCOILSCoilCoilcoord: 271..298
NoneNo IPR availableCOILSCoilCoilcoord: 622..649
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 433..450
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 431..450
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 727..741
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 660..741
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 662..717
NoneNo IPR availablePANTHERPTHR21501UNCHARACTERIZEDcoord: 36..657
IPR019579Uncharacterised protein family UPF0564PFAMPF10595UPF0564coord: 239..636
e-value: 4.0E-40
score: 138.0