PDZ domain-containing protein

Overview
NamePDZ domain-containing protein
Smed IDSMED30030352
Length (bp)989
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PDZ domain-containing protein (SMED30030352) t-SNE clustered cells

Violin plots show distribution of expression levels for PDZ domain-containing protein (SMED30030352) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PDZ domain-containing protein (SMED30030352) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PDZ domain-containing protein (SMED30030352) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030352

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030352h1SMcG0021569 Contig14518newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030352h1SMcG0021569 Contig14518uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30030352h1SMcG0021569 dd_Smed_v4_2888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030352h1SMcG0021569 dd_Smed_v4_2888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030352h1SMcG0021569 dd_Smed_v4_2888_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030352h1SMcG0021569 dd_Smed_v6_2888_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030352h1SMcG0021569 dd_Smed_v6_2888_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PDZ domain-containing protein vs. Ensembl Human
Match: PDLIM2 (PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:13992])

HSP 1 Score: 51.2174 bits (121), Expect = 2.330e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            PWGF + GG D   P+ V KV   G A  + L PGD+I+ I      G  HA+ +++I
Sbjct:   12 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. Ensembl Human
Match: PDLIM2 (PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:13992])

HSP 1 Score: 51.6026 bits (122), Expect = 2.558e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            PWGF + GG D   P+ V KV   G A  + L PGD+I+ I      G  HA+ +++I
Sbjct:   12 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. Ensembl Human
Match: PDLIM2 (PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:13992])

HSP 1 Score: 51.2174 bits (121), Expect = 3.394e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            PWGF + GG D   P+ V KV   G A  + L PGD+I+ I      G  HA+ +++I
Sbjct:   12 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. Ensembl Human
Match: PDLIM2 (PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:13992])

HSP 1 Score: 51.6026 bits (122), Expect = 5.634e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            PWGF + GG D   P+ V KV   G A  + L PGD+I+ I      G  HA+ +++I
Sbjct:   12 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. Ensembl Human
Match: PDLIM2 (PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:13992])

HSP 1 Score: 51.9878 bits (123), Expect = 6.553e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            PWGF + GG D   P+ V KV   G A  + L PGD+I+ I      G  HA+ +++I
Sbjct:   12 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0329910)

HSP 1 Score: 59.6918 bits (143), Expect = 3.746e-10
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0342711)

HSP 1 Score: 61.2326 bits (147), Expect = 6.370e-10
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0392901)

HSP 1 Score: 61.2326 bits (147), Expect = 6.445e-10
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0100388)

HSP 1 Score: 61.2326 bits (147), Expect = 6.696e-10
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0087315)

HSP 1 Score: 60.8474 bits (146), Expect = 7.077e-10
Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALE 570
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++       + +    + +      PNSP L+
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRGGSTWRPHVTPTGNVPQ------PNSPYLQ 112          
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813])

HSP 1 Score: 53.1434 bits (126), Expect = 2.135e-7
Identity = 31/116 (26.72%), Postives = 58/116 (50.00%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNV--AAYNSTMNQINEPMHQMSPNS 558
            MNI  + L+        PWGF LQGG D   P+ V ++T  G A ++G+  GD ++ I ++     TH + + +I  A + +  T+ +       A  +S  +  ++P +  +P++
Sbjct:    1 MNIYCVTLN-----GPAPWGFRLQGGKDFNTPLTVSRLTPGGKAAQAGVGVGDWVVSIFDANAEEMTHVEAQNKIRAATDSLKLTLSRYTHTTGFAKKDSLTSSSSQPKYSFAPST 111          
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Match: pdlim5b (PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-040426-908])

HSP 1 Score: 50.8322 bits (120), Expect = 3.389e-7
Identity = 42/155 (27.10%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPM-------------HQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQS 693
            PWGF LQGG D  +P+ + K+T  G A K+ +  GDV++ I        TH + + +I      ++ ++ +    +           EPM             + +SP S A + R  +IE+    H  P+    Q +S++IL  Q+  TE +Q+
Sbjct:   14 PWGFRLQGGKDFSMPLTISKLTDGGKAAKAKISVGDVVLSIDGIHTERMTHLEAQNKIKACSGNLNLSLMRPSSVIKVETPK----EEPMTKTARKPVLETEVNHVSPLSDASKKR--LIEDTEDWH--PRTGTTQSRSFRIL-AQITGTENDQA 159          
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Match: ldb3a (LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-040121-6])

HSP 1 Score: 49.6766 bits (117), Expect = 5.332e-7
Identity = 25/71 (35.21%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ V ++T    A  S L  GD+I+ I      G TH + + +I  A   +  T+++
Sbjct:   13 PWGFRLQGGKDFNMPLTVSRITPGSKAASSNLIQGDIIVAIDGVSTDGMTHLEAQNKIKSANFNLALTMQR 83          
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Match: ldb3a (LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-040121-6])

HSP 1 Score: 50.447 bits (119), Expect = 5.354e-7
Identity = 25/71 (35.21%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ V ++T    A  S L  GD+I+ I      G TH + + +I  A   +  T+++
Sbjct:   13 PWGFRLQGGKDFNMPLTVSRITPGSKAASSNLIQGDIIVAIDGVSTDGMTHLEAQNKIKSANFNLALTMQR 83          
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Match: ldb3a (LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-040121-6])

HSP 1 Score: 50.8322 bits (120), Expect = 5.977e-7
Identity = 25/71 (35.21%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ V ++T    A  S L  GD+I+ I      G TH + + +I  A   +  T+++
Sbjct:   13 PWGFRLQGGKDFNMPLTVSRITPGSKAASSNLIQGDIIVAIDGVSTDGMTHLEAQNKIKSANFNLALTMQR 83          
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Match: gsx2 (GS homeobox 2 [Source:Xenbase;Acc:XB-GENE-492505])

HSP 1 Score: 56.225 bits (134), Expect = 4.254e-8
Identity = 33/98 (33.67%), Postives = 45/98 (45.92%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK---------RDFNVAAYNSTMNQINEP 534
            PWGF LQGGS++ LP+ V KV +   A + GL   D ++ I      G THAQ    I   G  +   V++         R   V    S+ N+I  P
Sbjct:   16 PWGFRLQGGSEKNLPLIVSKVRKRSKACRGGLRENDELVSINGKACAGLTHAQAMLMIDSIGGSLHIHVRRAAAGAQTAPRTQRVLPSPSSPNRIRSP 113          
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 55.4546 bits (132), Expect = 4.787e-8
Identity = 30/105 (28.57%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK----------RDFNVAAYNSTMNQINEPMHQMSP 552
            PWGF LQGG D  +P+ + ++T  G A  +G+  GD ++QI     T  TH + + +I  + N++   + +          R +N A  ++ +N+I  P    +P
Sbjct:   13 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLVLSRYGVHTPESQGRKYNFAP-STALNKIARPFGTGTP 116          
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 51.9878 bits (123), Expect = 2.162e-7
Identity = 30/113 (26.55%), Postives = 53/113 (46.90%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK------------------RDFNVAAYNSTMNQINEPMHQMSP 552
            PWGF LQGG D  +P+ + ++T  G A  +G+  GD ++QI     T  TH + + +I  + N++   + +                  R +N A  ++ +N+I  P    +P
Sbjct:   13 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLVLSRFAVGVNQAKGVHTPESQGRKYNFAP-STALNKIARPFGTGTP 124          
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 52.373 bits (124), Expect = 3.651e-7
Identity = 23/71 (32.39%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ + ++T  G A  +G+  GD ++QI     T  TH + + +I  + N++   + +
Sbjct:  113 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLVLSR 183          
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 52.373 bits (124), Expect = 3.968e-7
Identity = 30/113 (26.55%), Postives = 53/113 (46.90%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK------------------RDFNVAAYNSTMNQINEPMHQMSP 552
            PWGF LQGG D  +P+ + ++T  G A  +G+  GD ++QI     T  TH + + +I  + N++   + +                  R +N A  ++ +N+I  P    +P
Sbjct:  113 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLVLSRFAVGVNQAKGVHTPESQGRKYNFAP-STALNKIARPFGTGTP 224          
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Match: Pdlim2 (PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:2384850])

HSP 1 Score: 51.9878 bits (123), Expect = 2.160e-7
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I ++ + +   + +
Sbjct:   12 PWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQSASPLRLQLDR 82          
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Match: Pdlim2 (PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:2384850])

HSP 1 Score: 52.373 bits (124), Expect = 3.009e-7
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I ++ + +   + +
Sbjct:   12 PWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQSASPLRLQLDR 82          
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Match: Pdlim2 (PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:2384850])

HSP 1 Score: 52.373 bits (124), Expect = 3.009e-7
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I ++ + +   + +
Sbjct:   12 PWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQSASPLRLQLDR 82          
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Match: Pdlim5 (PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:1927489])

HSP 1 Score: 49.2914 bits (116), Expect = 1.550e-6
Identity = 39/159 (24.53%), Postives = 66/159 (41.51%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMH--------QMSPNSPALEPRAEIIEE-----HVWKHGG--------------PKFKNVQPKSYKILEQ 663
            PWGF LQGG D  +P+ +  +   G A ++ +  GDV++ I      G TH + + +I      ++ T+++     AA  S    + +  H        ++ P  P   PR  I+E      H+  H                P+    Q +S++IL Q
Sbjct:   13 PWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS---AAAKSEPVSVQKKTHVTNNPGTVKIPPKRP---PRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQ 165          
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Match: Ldb3 (LIM domain binding 3 [Source:MGI Symbol;Acc:MGI:1344412])

HSP 1 Score: 49.6766 bits (117), Expect = 2.112e-6
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ + ++T    A +S L  GD+++ I        TH + + +I  A   +  T++K
Sbjct:   12 PWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK 82          
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Match: sp|A1ZA47|ZASP_DROME (PDZ and LIM domain protein Zasp OS=Drosophila melanogaster OX=7227 GN=Zasp52 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 6.712e-9
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  265 KPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +PWGF LQGG+D   P+ V KV    ++ ++GL+PGD +++I +  +    H   +  ++R+GN    TV++
Sbjct:   17 QPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AYD6|PDLI2_RAT (PDZ and LIM domain protein 2 OS=Rattus norvegicus OX=10116 GN=Pdlim2 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.415e-6
Identity = 24/75 (32.00%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  256 VTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            V   PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I ++ + +   + +
Sbjct:    8 VGPAPWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGESAESMLHAEAQSKIRQSASPLRLQLDR 82          
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P7E4|PDLI7_DANRE (PDZ and LIM domain protein 7 OS=Danio rerio OX=7955 GN=pdlim7 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.860e-6
Identity = 33/117 (28.21%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAA---YNSTMNQINEPMHQMSPNS 558
            MNI  + L+        PWGF LQGG D   P+ V ++T  G A ++G+  GD ++ I ++     TH + + +I  A + +  T+  R F+ A     +S  +  ++P +  +P++
Sbjct:    1 MNIYCVTLN-----GPAPWGFRLQGGKDFNTPLTVSRLTPGGKAAQAGVGVGDWVVSIFDANAEEMTHVEAQNKIRAATDSLKLTL-SRAFHPAGGEQKDSLTSSSSQPKYSFAPST 111          
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R1G6|PDLI2_MOUSE (PDZ and LIM domain protein 2 OS=Mus musculus OX=10090 GN=Pdlim2 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.104e-6
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I ++ + +   + +
Sbjct:   12 PWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQSASPLRLQLDR 82          
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3T0C8|PDLI2_BOVIN (PDZ and LIM domain protein 2 OS=Bos taurus OX=9913 GN=PDLIM2 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.255e-6
Identity = 24/62 (38.71%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  256 VTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEI 441
            V   PWGF + GG D   P+ V KVT  G A  + L PGD+I+ I         HA+ +++I
Sbjct:    8 VGPAPWGFRISGGRDFHTPIMVTKVTERGKAEAADLRPGDIIVSINGESAKDMLHAEAQSKI 69          
BLAST of PDZ domain-containing protein vs. TrEMBL
Match: G4V895 (PDZ domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_006860.2 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.298e-94
Identity = 133/190 (70.00%), Postives = 156/190 (82.11%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            M +E +V+SLRR  +DK WGFVLQGG DQGLPVFVHKVTRNGIAHKSGLEPGDVI++I  + +TG  HAQ+KAEILRAGN++DF VKKRDFNV AYN TM QI      +  NS + EPRAEI+EEH+W+HGGP FKNVQPKSYKILEQQLPQ+      P SV+DR +DERSPYL+ATE+TIQ+AYGE+
Sbjct:    1 MALEPVVISLRRATSDKSWGFVLQGGVDQGLPVFVHKVTRNGIAHKSGLEPGDVILKICATPITGMVHAQVKAEILRAGNDLDFMVKKRDFNVVAYNQTMQQIAASNRPIDVNSNSPEPRAEIVEEHLWRHGGPTFKNVQPKSYKILEQQLPQSSMGGPAPGSVFDRSMDERSPYLQATEQTIQKAYGES 190          
BLAST of PDZ domain-containing protein vs. TrEMBL
Match: A0A183LQ31 (PDZ domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS5906 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.835e-93
Identity = 136/193 (70.47%), Postives = 160/193 (82.90%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQI---NEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            M +E +V+SLRR  +DK WGFVLQGG DQGLPVFVHKVTRNGIAHKSGLEPGDVI++I  + +TG  HAQ+KAEILRAGN++DF VKKRDFNV AYN TM QI   N P+  ++ NSP  EPRAEI+EEH+W+HGGP FKNVQPKSYKILEQQLPQ+      P SV+DR +DERSPYL+ATE+TIQ+AYGE+
Sbjct:    1 MALEPVVISLRRATSDKSWGFVLQGGVDQGLPVFVHKVTRNGIAHKSGLEPGDVILKICATPITGMIHAQVKAEILRAGNDLDFMVKKRDFNVVAYNQTMQQIAASNRPI-DVASNSP--EPRAEIVEEHLWRHGGPTFKNVQPKSYKILEQQLPQSSMGGPAPGSVFDRSMDERSPYLQATEQTIQKAYGES 190          
BLAST of PDZ domain-containing protein vs. TrEMBL
Match: Q86EC1 (Clone ZZD551 mRNA sequence OS=Schistosoma japonicum OX=6182 GN=EWB00_006190 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 7.027e-93
Identity = 130/190 (68.42%), Postives = 155/190 (81.58%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            M +E +V+SLRR  +DK WGF LQGG DQGLPVFVHKVTRNGIAHKSGLEPGDV+++I  + +TG THAQ+KAEILRAGN++DF VKKRDFNV AYN TM Q+      +   S   EPRAEI+EEH+W+HGGP FKNVQPKSYKILEQQLPQ+    + P SV+DR +DERSPYL+ATE+TIQ+AYGE+
Sbjct:    1 MALEPVVISLRRQTSDKSWGFALQGGVDQGLPVFVHKVTRNGIAHKSGLEPGDVVLKICATPITGMTHAQVKAEILRAGNDLDFMVKKRDFNVVAYNQTMQQLAAANRSIDIASGEPEPRAEIVEEHLWRHGGPTFKNVQPKSYKILEQQLPQSSMGGAAPGSVFDRSMDERSPYLQATEQTIQKAYGES 190          
BLAST of PDZ domain-containing protein vs. TrEMBL
Match: G4V896 (PDZ domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_006860.1 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 5.347e-92
Identity = 134/197 (68.02%), Postives = 157/197 (79.70%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQT-------EQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            M +E +V+SLRR  +DK WGFVLQGG DQGLPVFVHKVTRNGIAHKSGLEPGDVI++I  + +TG  HAQ+KAEILRAGN++DF VKKRDFNV AYN TM QI      +  NS + EPRAEI+EEH+W+HGGP FKNVQPKSYKILEQQLPQ+       E     P SV+DR +DERSPYL+ATE+TIQ+AYGE+
Sbjct:    1 MALEPVVISLRRATSDKSWGFVLQGGVDQGLPVFVHKVTRNGIAHKSGLEPGDVILKICATPITGMVHAQVKAEILRAGNDLDFMVKKRDFNVVAYNQTMQQIAASNRPIDVNSNSPEPRAEIVEEHLWRHGGPTFKNVQPKSYKILEQQLPQSSMGANNYEMTGPAPGSVFDRSMDERSPYLQATEQTIQKAYGES 197          
BLAST of PDZ domain-containing protein vs. TrEMBL
Match: A0A183QUV9 (PDZ domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 5.835e-92
Identity = 134/197 (68.02%), Postives = 157/197 (79.70%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQT-------EQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            M +E +V+SLRR  +DK WGFVLQGG DQGLPVFVHKVTRNGIAHKSGLEPGDVI++I  + +TG  HAQ+KAEILRAGN++DF VKKRDFNV AYN TM QI      +  NS + EPRAEI+EEH+W+HGGP FKNVQPKSYKILEQQLPQ+       E     P SV+DR +DERSPYL+ATE+TIQ+AYGE+
Sbjct:    1 MALEPVVISLRRATSDKSWGFVLQGGVDQGLPVFVHKVTRNGIAHKSGLEPGDVILKICATPITGMVHAQVKAEILRAGNDLDFMVKKRDFNVVAYNQTMQQIAASNRPVDVNSNSPEPRAEIVEEHLWRHGGPTFKNVQPKSYKILEQQLPQSSMGANNYEMTGPAPGSVFDRSMDERSPYLQATEQTIQKAYGES 197          
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:103047884])

HSP 1 Score: 52.373 bits (124), Expect = 1.059e-7
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            MNI  + L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I  +     TH + + +I  A + +  T+ +
Sbjct:    9 MNIYCVTLA-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSISETNAEEMTHVEAQNKIRAATDSLTLTLSR 91          
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:103047884])

HSP 1 Score: 53.1434 bits (126), Expect = 1.133e-7
Identity = 28/93 (30.11%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  202 DLYFIMNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            D    MNI  + L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I  +     TH + + +I  A + +  T+ +
Sbjct:    4 DTKEAMNIYCVTLA-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSISETNAEEMTHVEAQNKIRAATDSLTLTLSR 91          
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Match: ldb3b (LIM domain-binding protein 3-like [Source:NCBI gene;Acc:103025742])

HSP 1 Score: 52.7582 bits (125), Expect = 1.459e-7
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ + ++T N  A    L  GD+I+ I      G TH + + +I  A +++  T++K
Sbjct:   13 PWGFRLQGGKDFNMPLTISRITPNSKASTGNLTQGDIIMAIDGVSTEGMTHLEAQNKIKLAIHKLSLTMQK 83          
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Match: ldb3b (LIM domain-binding protein 3-like [Source:NCBI gene;Acc:103025742])

HSP 1 Score: 52.7582 bits (125), Expect = 2.014e-7
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ + ++T N  A    L  GD+I+ I      G TH + + +I  A +++  T++K
Sbjct:   13 PWGFRLQGGKDFNMPLTISRITPNSKASTGNLTQGDIIMAIDGVSTEGMTHLEAQNKIKLAIHKLSLTMQK 83          
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:103047884])

HSP 1 Score: 53.1434 bits (126), Expect = 2.095e-7
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            MNI  + L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I  +     TH + + +I  A + +  T+ +
Sbjct:    9 MNIYCVTLA-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSISETNAEEMTHVEAQNKIRAATDSLTLTLSR 91          
BLAST of PDZ domain-containing protein vs. Ensembl Sea Lamprey
Match: grasp (GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein [Source:ZFIN;Acc:ZDB-GENE-060312-30])

HSP 1 Score: 51.2174 bits (121), Expect = 1.154e-7
Identity = 40/140 (28.57%), Postives = 66/140 (47.14%), Query Frame = 1
Query:  241 SLRRTVT-----DKPWGFVLQGG-------SDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGN----EIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHG 612
            S RRT+T     D+ +GF LQ         S+  +  +V KV   G A ++G++ GD++I I +S + G  H QI   I  AGN    E++F +  R   +    + +  + + MH+        E R+ + +E    HG
Sbjct:   39 STRRTITIEKEDDESYGFELQTYGLRNRVVSELEMCTYVFKVKEEGPAERAGMKAGDILITINDSNVEGIPHKQIVDIIREAGNCLRIEVEFGIMARRMEL---QTRLQYLKQTMHEKCK-----ELRSLLQQEQRLVHG 170          
BLAST of PDZ domain-containing protein vs. Ensembl Sea Lamprey
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 51.6026 bits (122), Expect = 1.423e-7
Identity = 27/98 (27.55%), Postives = 50/98 (51.02%), Query Frame = 1
Query:  238 LSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINE 531
            +++RR   + P GF L GG D+G P++V  +     A +SGL+ GD I+++          +Q   +I++    +  TVK    N+ +Y    +++ E
Sbjct:  347 VTVRRASRESPLGFKLDGGQDRGFPLYVSSLDLQSKASESGLKRGDQILEVNGQNFDNVLLSQ-AMDIMKKSTHLSITVKN---NLLSYKEICHRLEE 440          
BLAST of PDZ domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002484.1 (pep scaffold:Pmarinus_7.0:GL476548:370238:411117:1 gene:ENSPMAG00000002245.1 transcript:ENSPMAT00000002484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.460e-7
Identity = 26/70 (37.14%), Postives = 38/70 (54.29%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVK 477
            PWGF L GG D   P+ + +VT   +A  + L PGDVI+ I        THA+ + E ++A +    T+K
Sbjct:   12 PWGFRLVGGRDLDQPLTISRVTPGSVASSANLSPGDVILAIEGENAEEMTHAEAQ-ERIKACSTATLTLK 80          
BLAST of PDZ domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 6.225e-7
Identity = 21/71 (29.58%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D  +P+ + +++    A ++ + PGDV++QI  +     TH + + +I  +   +  T+++
Sbjct:   13 PWGFRLQGGKDFNMPLTISRISPGSKAAQATVVPGDVVLQIDGTPTDSMTHLEAQTKIKNSVGNLRLTLQR 83          
BLAST of PDZ domain-containing protein vs. Ensembl Nematostella
Match: EDO41810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S390])

HSP 1 Score: 50.447 bits (119), Expect = 6.326e-7
Identity = 24/94 (25.53%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  235 VLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTM 516
            V+SL R   D+PWGF + GG + G  +FV+K+     A  +G+   D ++++ +      T+ + + ++L +   +   +KK   N+A +   +
Sbjct:  246 VISLERQSHDQPWGFSIAGGRENGFGIFVYKIDPECSAFTAGVRKADQVLKVNDISFENITYDKAR-DLLSSSIRLTLALKK---NIAGFKDLL 335          
BLAST of PDZ domain-containing protein vs. Ensembl Nematostella
Match: EDO47763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY1])

HSP 1 Score: 44.669 bits (104), Expect = 2.606e-6
Identity = 25/71 (35.21%), Postives = 35/71 (49.30%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF L+GG D G    V ++T  G A  +GL   D I+ I        TH + +  I R GN +   V++
Sbjct:   15 PWGFRLKGGKDFGQIPTVSQLTPGGKAITNGLRVEDQILSINGMGCEDMTHMEAQESIKRTGNALRLQVRR 85          
BLAST of PDZ domain-containing protein vs. Ensembl Nematostella
Match: EDO30217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1F1])

HSP 1 Score: 43.5134 bits (101), Expect = 5.722e-6
Identity = 22/71 (30.99%), Postives = 33/71 (46.48%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            PWGF LQGG D   P+ + KV +   A ++G+ P   +  I N      +H      I R G  ++  + K
Sbjct:   16 PWGFRLQGGKDFRAPLKIAKVEQGSKAERAGIRPNLYVRSINNDPCETMSHGDALNNIKRTGTNLNLLLCK 86          
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Match: pdlim5a (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101174195])

HSP 1 Score: 60.8474 bits (146), Expect = 1.537e-10
Identity = 41/151 (27.15%), Postives = 65/151 (43.05%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEE-----HVWKHGG--------------PKFKNVQPKSYKILEQ 663
            PWGF LQGG D  +P+ + ++T +G A K G+  GDV++ I      G  H + + +I    + +  T++K          T      P+    P+S    PR  I++      HV  HG               P+    Q +S++IL Q
Sbjct:   14 PWGFRLQGGKDFNMPLTISRLTNDGKAAKGGIAVGDVVLSIDGISTDGMNHLEAQNKIKNCSSNLSLTLQKASSVQKPPPVTPKTGASPLVTNGPHSILKAPRKHIVDTDIHFYHVPSHGDASRKRIMEDTEDWRPRSGTTQSRSFRILAQ 164          
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:101167302])

HSP 1 Score: 58.151 bits (139), Expect = 1.162e-9
Identity = 43/164 (26.22%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYN---------STMNQINEPMHQMS-PNSPALEP----RAEIIEE-HVWKHGGPKFKNVQPKSYKILEQ 663
            MN+ T+ L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I ++     TH + + +I  A + +  T+ +    V             +  ++I +P H +   N P   P    +  +IE+   W+   P+    Q +S++IL Q
Sbjct:    1 MNLYTVTLN-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSICDANAEDMTHVEAQNKIRAATDSLTLTLSRGSKLVEERKMETLDKGELTYFDEIYQPKHGLRMENMPCFIPNDRSKKRLIEDTEDWQ---PRTGTTQSRSFRILAQ 156          
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:101167302])

HSP 1 Score: 58.5362 bits (140), Expect = 3.304e-9
Identity = 41/151 (27.15%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYN-STMNQINEPMHQMSPNSPALEPRAEIIEE-HVWKHGGPKFKNVQPKSYKILEQ 663
            MN+ T+ L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I ++     TH + + +I  A + +  T+ +    V      T+++    M  M    P    +  +IE+   W+   P+    Q +S++IL Q
Sbjct:    1 MNLYTVTLN-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSICDANAEDMTHVEAQNKIRAATDSLTLTLSRGSKLVEERKMETLDKHGLRMENMPCFIPNDRSKKRLIEDTEDWQ---PRTGTTQSRSFRILAQ 143          
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:101167302])

HSP 1 Score: 57.7658 bits (138), Expect = 6.180e-9
Identity = 43/164 (26.22%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYN---------STMNQINEPMHQMS-PNSPALEP----RAEIIEE-HVWKHGGPKFKNVQPKSYKILEQ 663
            MN+ T+ L+        PWGF LQGG D  +P+ V ++T  G A ++G+  GD ++ I ++     TH + + +I  A + +  T+ +    V             +  ++I +P H +   N P   P    +  +IE+   W+   P+    Q +S++IL Q
Sbjct:    1 MNLYTVTLN-----GPAPWGFRLQGGKDFSMPLTVSRLTPGGKAAQAGVGVGDWVVSICDANAEDMTHVEAQNKIRAATDSLTLTLSRGSKLVEERKMETLDKGELTYFDEIYQPKHGLRMENMPCFIPNDRSKKRLIEDTEDWQ---PRTGTTQSRSFRILAQ 156          
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Match: pdlim5a (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101174195])

HSP 1 Score: 57.7658 bits (138), Expect = 6.510e-9
Identity = 42/159 (26.42%), Postives = 66/159 (41.51%), Query Frame = 1
Query:  268 PWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNS--------PALEPRAEIIEE-----HVWKHGG--------------PKFKNVQPKSYKILEQ 663
            PWGF LQGG D  +P+ + ++T +G A K G+  GDV++ I      G  H + + +I    + +  T++K          T      P+    P+S        P   PR  I++      HV  HG               P+    Q +S++IL Q
Sbjct:   14 PWGFRLQGGKDFNMPLTISRLTNDGKAAKGGIAVGDVVLSIDGISTDGMNHLEAQNKIKNCSSNLSLTLQKASSVQKPPPVTPKTGASPLVTNGPHSILKKPQQHPPRAPRKHIVDTDIHFYHVPSHGDASRKRIMEDTEDWRPRSGTTQSRSFRILAQ 172          
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Match: SMESG000015639.1 (SMESG000015639.1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.851e-140
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 1
Query:  217 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 786
            MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN
Sbjct:    1 MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN 190          
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Match: SMESG000032524.1 (SMESG000032524.1)

HSP 1 Score: 188.734 bits (478), Expect = 7.549e-59
Identity = 93/198 (46.97%), Postives = 129/198 (65.15%), Query Frame = 1
Query:  208 YFIMNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQI-NEPM-----HQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGE 783
            + I   E IVL LRR  TDK WGFVLQGGSDQGLP+F+HK+ R  I HK+GL+PGDVI++I    L G T+ ++KA ILRAGNE++  VKKR FN+A YN T+  I NE       H+   N    +   +++E  +WK+G PK++NVQ ++YK+LE+ LP    N     S++D D  +R  YL+ +E +I + +GE
Sbjct:   10 FLIFMSEIIVLFLRRDNTDKSWGFVLQGGSDQGLPIFIHKLMRQSIGHKAGLDPGDVILRINGQTLLGMTNEEVKAIILRAGNEMEMRVKKRGFNLATYNETIQSIHNEEFHGDHNHKSHNNVDHNQEEVKVVETPLWKNGSPKYRNVQSRTYKLLEELLP----NDECSGSIFDHDNSDRKRYLQTSEASILKTFGE 203          
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Match: SMESG000032524.1 (SMESG000032524.1)

HSP 1 Score: 186.808 bits (473), Expect = 2.088e-58
Identity = 92/192 (47.92%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  226 ETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQI-NEPM-----HQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQLPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGE 783
            E IVL LRR  TDK WGFVLQGGSDQGLP+F+HK+ R  I HK+GL+PGDVI++I    L G T+ ++KA ILRAGNE++  VKKR FN+A YN T+  I NE       H+   N    +   +++E  +WK+G PK++NVQ ++YK+LE+ LP    N     S++D D  +R  YL+ +E +I + +GE
Sbjct:    3 EIIVLFLRRDNTDKSWGFVLQGGSDQGLPIFIHKLMRQSIGHKAGLDPGDVILRINGQTLLGMTNEEVKAIILRAGNEMEMRVKKRGFNLATYNETIQSIHNEEFHGDHNHKSHNNVDHNQEEVKVVETPLWKNGSPKYRNVQSRTYKLLEELLP----NDECSGSIFDHDNSDRKRYLQTSEASILKTFGE 190          
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Match: SMESG000015397.1 (SMESG000015397.1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.083e-18
Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 1
Query:  226 ETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKK 480
            +T+++ LRR+ T  PWGF L+GG D G P+ + K+    IA  +GL+P D ++ I  S     TH Q K EI+R+ NEI FT+ +
Sbjct:    3 QTLIIDLRRSDTSIPWGFRLEGGVDMGAPIRIMKIVSGSIAEYAGLQPADYVLLINRSTTERMTHEQAKMEIIRSANEITFTISR 87          
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Match: SMESG000029617.1 (SMESG000029617.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.283e-9
Identity = 35/137 (25.55%), Postives = 60/137 (43.80%), Query Frame = 1
Query:  238 LSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLEPGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTMNQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSY 648
             +L +     PWGF +QGG D   P+ + ++T + +A  SGL+ GD I +I N       H + +  I+ +GN ++  + +    VA  N        P    S N  ++ PR  +  +    H     K+  P  +
Sbjct:    6 FNLSKAGLHNPWGFRIQGGRDFNRPLIISRITCDSVADNSGLKCGDRITKINNFDTGFICHNEAQQVIIESGNTLNLEITRDPLPVAE-NLKQTPFTVPKFPSSTNCNSIAPRTGLAGDIQLSHSNFDLKHRAPCCH 141          
The following BLAST results are available for this feature:
BLAST of PDZ domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDLIM22.330e-739.66PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM22.558e-739.66PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM23.394e-739.66PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM25.634e-739.66PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM26.553e-739.66PDZ and LIM domain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zasp523.746e-1034.72gene:FBgn0265991 transcript:FBtr0329910[more]
Zasp526.370e-1034.72gene:FBgn0265991 transcript:FBtr0342711[more]
Zasp526.445e-1034.72gene:FBgn0265991 transcript:FBtr0392901[more]
Zasp526.696e-1034.72gene:FBgn0265991 transcript:FBtr0100388[more]
Zasp527.077e-1029.41gene:FBgn0265991 transcript:FBtr0087315[more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim72.135e-726.72PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813][more]
pdlim5b3.389e-727.10PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ldb3a5.332e-735.21LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ldb3a5.354e-735.21LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ldb3a5.977e-735.21LIM domain binding 3a [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsx24.254e-833.67GS homeobox 2 [Source:Xenbase;Acc:XB-GENE-492505][more]
arhgef404.787e-828.57Rho guanine nucleotide exchange factor 40 [Source:... [more]
arhgef402.162e-726.55Rho guanine nucleotide exchange factor 40 [Source:... [more]
arhgef403.651e-732.39Rho guanine nucleotide exchange factor 40 [Source:... [more]
arhgef403.968e-726.55Rho guanine nucleotide exchange factor 40 [Source:... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdlim22.160e-732.39PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:23... [more]
Pdlim23.009e-732.39PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:23... [more]
Pdlim23.009e-732.39PDZ and LIM domain 2 [Source:MGI Symbol;Acc:MGI:23... [more]
Pdlim51.550e-624.53PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:19... [more]
Ldb32.112e-632.39LIM domain binding 3 [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of PDZ domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1ZA47|ZASP_DROME6.712e-934.72PDZ and LIM domain protein Zasp OS=Drosophila mela... [more]
sp|Q6AYD6|PDLI2_RAT1.415e-632.00PDZ and LIM domain protein 2 OS=Rattus norvegicus ... [more]
sp|Q6P7E4|PDLI7_DANRE1.860e-628.21PDZ and LIM domain protein 7 OS=Danio rerio OX=795... [more]
sp|Q8R1G6|PDLI2_MOUSE2.104e-632.39PDZ and LIM domain protein 2 OS=Mus musculus OX=10... [more]
sp|Q3T0C8|PDLI2_BOVIN2.255e-638.71PDZ and LIM domain protein 2 OS=Bos taurus OX=9913... [more]
back to top
BLAST of PDZ domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V8956.298e-9470.00PDZ domain-containing protein OS=Schistosoma manso... [more]
A0A183LQ311.835e-9370.47PDZ domain-containing protein OS=Schistosoma margr... [more]
Q86EC17.027e-9368.42Clone ZZD551 mRNA sequence OS=Schistosoma japonicu... [more]
G4V8965.347e-9268.02PDZ domain-containing protein OS=Schistosoma manso... [more]
A0A183QUV95.835e-9268.02PDZ domain-containing protein OS=Schistosoma rodha... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim71.059e-730.68PDZ and LIM domain 7 [Source:NCBI gene;Acc:1030478... [more]
pdlim71.133e-730.11PDZ and LIM domain 7 [Source:NCBI gene;Acc:1030478... [more]
ldb3b1.459e-735.21LIM domain-binding protein 3-like [Source:NCBI gen... [more]
ldb3b2.014e-735.21LIM domain-binding protein 3-like [Source:NCBI gen... [more]
pdlim72.095e-730.68PDZ and LIM domain 7 [Source:NCBI gene;Acc:1030478... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
grasp1.154e-728.57GRP1 (general receptor for phosphoinositides 1)-as... [more]
rapgef21.423e-727.55Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
ENSPMAT00000002484.13.460e-737.14pep scaffold:Pmarinus_7.0:GL476548:370238:411117:1... [more]
ENSPMAT00000007081.16.225e-729.58pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO418106.326e-725.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477632.606e-635.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302175.722e-630.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PDZ domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim5a1.537e-1027.15PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim71.162e-926.22PDZ and LIM domain 7 [Source:NCBI gene;Acc:1011673... [more]
pdlim73.304e-927.15PDZ and LIM domain 7 [Source:NCBI gene;Acc:1011673... [more]
pdlim76.180e-926.22PDZ and LIM domain 7 [Source:NCBI gene;Acc:1011673... [more]
pdlim5a6.510e-926.42PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of PDZ domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015639.11.851e-140100.00SMESG000015639.1[more]
SMESG000032524.17.549e-5946.97SMESG000032524.1[more]
SMESG000032524.12.088e-5847.92SMESG000032524.1[more]
SMESG000015397.13.083e-1842.35SMESG000015397.1[more]
SMESG000029617.11.283e-925.55SMESG000029617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030352 ID=SMED30030352|Name=PDZ domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=989bp
TATTAATCAATAAATTTAGTGTGCTACTAATGTGCTACGTGATTCCCTTG
CACTTGCAAGCACACAAGATGGGTGAACTATTGAGATTCTGTGAAAGAAT
ATTTTCGCTTTAAACAAATCCTAATACTATTAATATTATTGGTATAGAAA
AAAAATTGACATAATTAATTTTTTTGGATTTGGAATAATTTTTTAAATAT
CGATTTATATTTTATAATGAACATTGAAACTATTGTTTTGAGTTTAAGGA
GAACTGTTACTGATAAACCTTGGGGCTTTGTATTGCAAGGAGGATCTGAT
CAAGGTCTACCTGTTTTTGTTCATAAAGTAACGAGGAATGGAATTGCTCA
TAAATCAGGACTTGAACCAGGCGATGTCATTATACAAATTGGCAACTCGC
AATTAACAGGTAAAACTCATGCTCAAATAAAGGCAGAAATATTGAGAGCT
GGCAATGAAATTGATTTTACAGTAAAGAAACGTGATTTTAACGTGGCAGC
ATATAACTCTACCATGAATCAAATAAATGAACCAATGCATCAAATGTCAC
CAAACTCTCCTGCATTAGAACCAAGAGCTGAAATAATTGAGGAACACGTT
TGGAAACACGGGGGACCAAAATTTAAAAATGTACAACCTAAATCATATAA
GATTTTAGAACAACAATTACCCCAAACTGAGCAGAATCAAAGTACACCTG
CTTCAGTATGGGACAGAGACCTTGATGAAAGATCTCCTTACTTGAAAGCT
ACAGAGAAGACAATACAAAGGGCTTATGGAGAAAATTAATCAACTTGAAT
ATAAGAGAACCCTTTAGTGCACATTATATACTTGTGCCTGAATGATTTTT
GTGTATCTAATAGATCTAACCTATTATTTTCTTAGTACTGTTTAACACTG
TTTTAATATTCTTTAAATTTTTAATTTAAATTAGTTGAACGTGTTATCCT
AGTTAAAATTAATATGCTTATTTTTATCCAATTAACGCT
back to top

protein sequence of SMED30030352-orf-1

>SMED30030352-orf-1 ID=SMED30030352-orf-1|Name=SMED30030352-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MNIETIVLSLRRTVTDKPWGFVLQGGSDQGLPVFVHKVTRNGIAHKSGLE
PGDVIIQIGNSQLTGKTHAQIKAEILRAGNEIDFTVKKRDFNVAAYNSTM
NQINEPMHQMSPNSPALEPRAEIIEEHVWKHGGPKFKNVQPKSYKILEQQ
LPQTEQNQSTPASVWDRDLDERSPYLKATEKTIQRAYGEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0008270zinc ion binding
GO:0042805actinin binding
GO:0046872metal ion binding
GO:0051371muscle alpha-actinin binding
Vocabulary: cellular component
TermDefinition
GO:0001725stress fiber
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005915zonula adherens
GO:0005925focal adhesion
GO:0005927muscle tendon junction
GO:0015629actin cytoskeleton
GO:0016323basolateral plasma membrane
GO:0030018Z disc
GO:0031252cell leading edge
GO:0045177apical part of cell
GO:0045178basal part of cell
Vocabulary: biological process
TermDefinition
GO:0001952regulation of cell-matrix adhesion
GO:0030239myofibril assembly
GO:0061061muscle structure development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 17..90
e-value: 2.0E-15
score: 67.2
IPR001478PDZ domainPFAMPF00595PDZcoord: 10..86
e-value: 4.1E-14
score: 52.7
IPR001478PDZ domainPROSITEPS50106PDZcoord: 7..90
score: 15.059
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 9..103
e-value: 6.9E-20
score: 72.6
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 14..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..190
NoneNo IPR availablePANTHERPTHR24214:SF38FI06453P-RELATEDcoord: 6..131
NoneNo IPR availablePANTHERPTHR24214FAMILY NOT NAMEDcoord: 6..131
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 12..87
e-value: 1.07041E-20
score: 79.533