bok-2

Overview
Namebok-2 (AEX93480.1)
Smed IDSMED30030330
Length (bp)893
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of bok-2 (SMED30030330) t-SNE clustered cells

Violin plots show distribution of expression levels for bok-2 (SMED30030330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of bok-2 (SMED30030330) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for bok-2 (SMED30030330) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030330

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030330SMESG000066862.1 dd_Smed_v4_16107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030330SMESG000066862.1 dd_Smed_v4_16107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030330SMESG000066862.1 dd_Smed_v4_16107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030330SMESG000066862.1 dd_Smed_v4_16107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of bok-2 vs. Ensembl Human
Match: BOK (BCL2 family apoptosis regulator BOK [Source:HGNC Symbol;Acc:HGNC:1087])

HSP 1 Score: 71.2478 bits (173), Expect = 3.866e-14
Identity = 36/128 (28.12%), Postives = 60/128 (46.88%), Query Frame = 3
Query:  330 GPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
             P  AA         CA    +  +LE + P +Y+NVA Q+ I++  E   +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW 
Sbjct:   52 APERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPV-VTDAFLAVAGHIFSAG------ITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 172          
BLAST of bok-2 vs. Ensembl Fly
Match: Buffy (gene:FBgn0040491 transcript:FBtr0088077)

HSP 1 Score: 67.0106 bits (162), Expect = 2.118e-12
Identity = 37/111 (33.33%), Postives = 57/111 (51.35%), Query Frame = 3
Query:  387 QEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGES--EPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
            Q +  +LE M+P +Y  VA Q+  N G E      V L     LL   G      +I W+K+ISL  I  GL+VDC + G  + +PK++++   ++   L+ WI    GW+
Sbjct:  140 QVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSL-----LLGAVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWS 245          
BLAST of bok-2 vs. Ensembl Fly
Match: Debcl (gene:FBgn0029131 transcript:FBtr0086108)

HSP 1 Score: 61.6178 bits (148), Expect = 1.451e-10
Identity = 37/131 (28.24%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  324 MLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMG-INVG-WEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +L P S+    E F         +  +LE M+P +Y N++ Q+     G  E   ++ + L    + L +S      I W KIIS+  +  G A+DC + G +D +  +ID    I+   L+ W+I   GW
Sbjct:  130 ILDPGSSHVVYEVFPA----LNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRS-----SITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGW 251          
BLAST of bok-2 vs. Ensembl Zebrafish
Match: boka (BCL2 family apoptosis regulator BOK a [Source:NCBI gene;Acc:445218])

HSP 1 Score: 70.0922 bits (170), Expect = 1.015e-13
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQ-----FSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE + P++Y+NVA Q+ I +   +  +S+ FL      FS E   K  E    + W KI+SL  +   LAVDC ++G    +  I+D     V + L +W+  + GW
Sbjct:   77 ELEYLRPNVYRNVARQLNITIA-SENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGW 183          
BLAST of bok-2 vs. Ensembl Zebrafish
Match: bokb (BCL2 family apoptosis regulator BOK b [Source:NCBI gene;Acc:394160])

HSP 1 Score: 66.6254 bits (161), Expect = 1.188e-12
Identity = 33/103 (32.04%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE M P +Y+N+A Q+ I+V  E   +S+ FL  + E++         I W K++++  + AGLAVDC + G    +  I+D+    V + L+ W+  + GW
Sbjct:   80 ELECMRPYVYRNIAKQLNISVSVEAV-VSDAFLSVATEVIAMG------ITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGW 175          
BLAST of bok-2 vs. Ensembl Zebrafish
Match: boka (BCL2 family apoptosis regulator BOK a [Source:NCBI gene;Acc:445218])

HSP 1 Score: 64.6994 bits (156), Expect = 6.248e-12
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESE-PQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE + P++Y+NVA Q+ I +   +  +S+ FL  + E+           + W KI+SL  +   LAVDC ++G    +  I+D     V + L +W+  + GW
Sbjct:   77 ELEYLRPNVYRNVARQLNITIA-SENIVSDAFLAVAAEIFSTGSVCFFTGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGW 179          
BLAST of bok-2 vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:Xenbase;Acc:XB-GENE-5819524])

HSP 1 Score: 69.707 bits (169), Expect = 1.311e-13
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 3
Query:  384 FQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            F  +  +LE M P +Y+N+A Q+ I++  E   +S+ FL  + E+          I W K++SL  + AGLAVDC K  +   +  I+D     + + L+TW+  + GW
Sbjct:   72 FLRLGDELEYMRPTVYRNIARQLNISLTSETI-LSDAFLAVAAEIFTAG------ITWGKVVSLYAVAAGLAVDCVKQSQPALVLTIVDCLGEFIRKTLVTWLKRRGGW 173          
BLAST of bok-2 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 65.4698 bits (158), Expect = 3.048e-12
Identity = 32/113 (28.32%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  375 CAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
            C     +  +LE + P +Y+NVA Q+ I +  E   +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW 
Sbjct:   68 CTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPV-VTDAFLAVAGHIFSAG------ITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-2 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 65.4698 bits (158), Expect = 3.048e-12
Identity = 32/113 (28.32%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  375 CAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
            C     +  +LE + P +Y+NVA Q+ I +  E   +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW 
Sbjct:   68 CTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPV-VTDAFLAVAGHIFSAG------ITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-2 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 48.1358 bits (113), Expect = 1.266e-6
Identity = 21/76 (27.63%), Postives = 37/76 (48.68%), Query Frame = 3
Query:  483 ISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW
Sbjct:   12 VTDAFLAVAGHIFSAG------ITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGW 81          
BLAST of bok-2 vs. UniProt/SwissProt
Match: sp|Q9UMX3|BOK_HUMAN (Bcl-2-related ovarian killer protein OS=Homo sapiens OX=9606 GN=BOK PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.856e-13
Identity = 36/128 (28.12%), Postives = 60/128 (46.88%), Query Frame = 3
Query:  330 GPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
             P  AA         CA    +  +LE + P +Y+NVA Q+ I++  E   +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW 
Sbjct:   52 APERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPV-VTDAFLAVAGHIFSAG------ITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 172          
BLAST of bok-2 vs. UniProt/SwissProt
Match: sp|Q6DC66|BOKA_DANRE (Bcl-2-related ovarian killer protein homolog A OS=Danio rerio OX=7955 GN=boka PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.987e-13
Identity = 36/108 (33.33%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQ-----FSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE + P++Y+NVA Q+ I +   +  +S+ FL      FS E   K  E    + W KI+SL  +   LAVDC +NG    +  I+D     V + L +W+  + GW
Sbjct:   74 ELEYLRPNVYRNVARQLNITIA-SENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRNGHPAMVHTIVDCMGEFVRKSLASWLKKRGGW 180          
BLAST of bok-2 vs. UniProt/SwissProt
Match: sp|Q9I8I2|BOK_CHICK (Bcl-2-related ovarian killer protein OS=Gallus gallus OX=9031 GN=BOK PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.626e-12
Identity = 31/103 (30.10%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE + P++Y+N+A Q+ I++  E   +++ FL  + ++          I W K++SL  + AGLAVDC ++ +   +  I+D     V + L+TW+  + GW
Sbjct:   77 ELEYIRPNVYRNIARQLNISLHSETV-VTDAFLAVAAQIFTAG------ITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRKTLVTWLKRRGGW 172          
BLAST of bok-2 vs. UniProt/SwissProt
Match: sp|Q7T381|BOKB_DANRE (Bcl-2-related ovarian killer protein homolog B OS=Danio rerio OX=7955 GN=bokb PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.450e-12
Identity = 33/103 (32.04%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE M P +Y+N+A Q+ I+V  E   +S+ FL  + E++         I W K++++  + AGLAVDC + G    +  I+D+    V + L+ W+  + GW
Sbjct:   77 ELECMRPYVYRNIAKQLNISVSVEAV-VSDAFLSVATEVIAMG------ITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGW 172          
BLAST of bok-2 vs. UniProt/SwissProt
Match: sp|Q792S6|BOK_RAT (Bcl-2-related ovarian killer protein OS=Rattus norvegicus OX=10116 GN=Bok PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.132e-11
Identity = 32/113 (28.32%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  375 CAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
            C     +  +LE + P +Y+NVA Q+ I +  E   +++ FL  +  +          I W K++SL  + AGLAVDC +  +   +  ++D     V + L TW+  + GW 
Sbjct:   68 CTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPV-VTDAFLAVAGHIFSAG------ITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-2 vs. TrEMBL
Match: H2DL18 (Bok-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.003e-146
Identity = 244/244 (100.00%), Postives = 244/244 (100.00%), Query Frame = 3
Query:   90 MSIDIIHSWYEKCIXXXXXXXXXXEEVITNGHQICKTFIGXXXXXXXXIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYXXXXXXXXXXXXXXXXXXWR 821
            MSIDIIHSWYEKCIPKKPKDPPTPEEVITNGHQICKTFIGNKLKKLNLIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWR
Sbjct:    1 MSIDIIHSWYEKCIPKKPKDPPTPEEVITNGHQICKTFIGNKLKKLNLIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWR 244          
BLAST of bok-2 vs. TrEMBL
Match: A0A1I8J681 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.505e-17
Identity = 49/134 (36.57%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  339 SAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDK 740
            SAA  T+    S  E + +  QLE+MYPDLYKNV  Q+ I +  E   +   F  F+ E LC  G     ++W KI++L  +    AVDC + G+ + + +I+D F   VA  L  W+  Q GW IP   +  K
Sbjct:   70 SAAAVTDGGPAS-QELRLVGEQLEAMYPDLYKNVHKQLNITMHSED-VVRRTFAMFA-EQLCSGG-----VHWGKIVALFAMAGAFAVDCVQQGRQEFVSRIVDCFGAFVAARLTDWLRKQGGWVIPEVTRDAK 195          
BLAST of bok-2 vs. TrEMBL
Match: A0A267FZV8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014893g1 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.125e-16
Identity = 49/134 (36.57%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  339 SAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDK 740
            SAA  T+    S  E + +  QLE+MYPDLYKNV  Q+ I +  E   +   F  F+ E LC  G     ++W KI++L  +    AVDC + G+ + + +I+D F   VA  L  W+  Q GW IP   +  K
Sbjct:  131 SAAAVTDGGPAS-QELRLVGEQLEAMYPDLYKNVHKQLNITMHSED-VVRRTFAMFA-EQLCSGG-----VHWGKIVALFAMAGAFAVDCVQQGRQEFVSRIVDCFGAFVAARLTDWLRKQGGWVIPEVTRDAK 256          
BLAST of bok-2 vs. TrEMBL
Match: A0A1I8H8A7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.698e-15
Identity = 41/114 (35.96%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  381 EFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISE-VFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIP 719
            E + +  +LE+MYPDL+ NV  Q+  N+    +++S   F+ F ++L C+       I+W K+++L  +    A DCA  G  D   KI+D F   VA  L TW+  Q GW IP
Sbjct:  134 ELRLVGEELETMYPDLFNNVHRQL--NLAMHSEEVSRRTFVMFCDQL-CRDS-----IHWGKVVALFAMAGAFAADCASQGHLDYAQKIVDAFGAFVATRLCTWLTEQGGWIIP 239          
BLAST of bok-2 vs. TrEMBL
Match: A0A4Z2BZW1 (Uncharacterized protein OS=Takifugu bimaculatus OX=433685 GN=fugu_013957 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.779e-14
Identity = 42/128 (32.81%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  327 LGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            L P+SAA A  +    C     +  +LESM P LY+NVA Q+ I+V  E   +S+ F+  + E+L         I W K++S+  +   LAVDC + G   T+  ++D+  + V + L+ W+  + GW
Sbjct:   57 LSPSSAALAEASMVLLC-----LGDELESMQPSLYRNVARQLNISVAMENM-VSDAFIGVATEIL------STGITWGKVVSMYAVAGALAVDCVRQGHATTVHILVDSLGQFVRKFLVPWLKRRGGW 172          
BLAST of bok-2 vs. Ensembl Cavefish
Match: boka (BCL2 family apoptosis regulator BOK [Source:NCBI gene;Acc:103021979])

HSP 1 Score: 67.781 bits (164), Expect = 5.046e-13
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWN 713
            +LE + P++Y+NVA Q+ I V   +  +S+ FL  + E+          + W K++SL  +   LAVDC ++G    +  I+D     V + L++W+  + GW 
Sbjct:   79 ELEYLRPNVYRNVARQLNITVA-SESVVSDAFLAVAAEIF------STGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWT 175          
BLAST of bok-2 vs. Ensembl Nematostella
Match: EDO47196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN20])

HSP 1 Score: 57.7658 bits (138), Expect = 6.276e-11
Identity = 34/110 (30.91%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  390 EIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIP 719
            +I   LE+ YP LY NV+  + I +   +  + +VF  F  EL  + G S     WAK+I+L    A ++ DC   G+ + +  I++     V   L  WI +  GW  P
Sbjct:    3 QIGELLETAYPYLYHNVSKHLKIRLR-SEVIVGDVFRTFGRELF-RDGVS-----WAKVIALFAFAASMSEDCVMQGRPELVKSILNNVRAYVRDHLAVWIRNHGGWVSP 105          
BLAST of bok-2 vs. Ensembl Nematostella
Match: EDO33714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRF5])

HSP 1 Score: 48.9062 bits (115), Expect = 8.728e-8
Identity = 23/109 (21.10%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  384 FQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
             + +A  +E+ YPDL++   +++GI            F   + E+       +  I W +I++L   G  +A    ++ + + +P +++     +A  L++WI+   GW
Sbjct:    1 LRSLASHMEAEYPDLFETACTKLGIT----PATARSTFFSVAKEIF------QTGINWGRIVALFTFGGVVAHHFIESERPEMVPHVVEWIPSFIADNLLSWIMENGGW 99          
BLAST of bok-2 vs. Ensembl Nematostella
Match: EDO30802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR6])

HSP 1 Score: 45.4394 bits (106), Expect = 4.578e-6
Identity = 29/118 (24.58%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  357 ENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            E + T     QE+   LE  YP LY +++  +  +    +  + +VF     E++ K G     + WA+II++      LA +C K+ +   + ++ +      A  L+ WI  + GW
Sbjct:   43 EKWPTISKRAQEVGWMLEECYPRLYADISRHVNASFT-SETVVHDVFSSVCTEIV-KDG-----VNWARIIAVYTFAGALATECYKDSRSVFVTEVSNWMYEFTALHLVDWIKKRGGW 153          
BLAST of bok-2 vs. Ensembl Medaka
Match: bokb (bcl-2-related ovarian killer protein homolog A [Source:NCBI gene;Acc:101160592])

HSP 1 Score: 72.0182 bits (175), Expect = 1.473e-14
Identity = 39/129 (30.23%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  345 AQATENFKTSCAEFQEIAV-------QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            ++A  NF  S A   E+ +       +LE + P LY+NVA Q+ I+V  E   +S+ FL  + E+          I W K++S+  +   LAVDC + G   T+  ++D+  + V + L+ W+  + GW
Sbjct:   51 SKAEINFSPSNAALSEVTMVLLCLGDELECIQPGLYRNVARQLNISVAMENV-VSDAFLGVATEIF------SAGITWGKVVSMYAVAGALAVDCVRQGYLTTVHILVDSLGQFVRKFLVHWLKRRGGW 172          
BLAST of bok-2 vs. Ensembl Medaka
Match: boka (bcl-2-related ovarian killer protein homolog A [Source:NCBI gene;Acc:101173213])

HSP 1 Score: 63.5438 bits (153), Expect = 1.292e-11
Identity = 30/103 (29.13%), Postives = 52/103 (50.49%), Query Frame = 3
Query:  402 QLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGW 710
            +LE + P++Y+NVA Q+ I V   +  +S+ FL  + ++          I W K++SL  +   LAVDC ++G    +  I+D       + L  W+  + GW
Sbjct:   74 ELEYLRPNVYRNVARQLNITVA-SESIVSDAFLAVAADIFSTG------ITWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFARKSLTVWLKKRGGW 169          
BLAST of bok-2 vs. Planmine SMEST
Match: SMESG000066862.1 (SMESG000066862.1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.789e-150
Identity = 244/244 (100.00%), Postives = 244/244 (100.00%), Query Frame = 3
Query:   90 MSIDIIHSWYEKCIXXXXXXXXXXEEVITNGHQICKTFIGXXXXXXXXIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYXXXXXXXXXXXXXXXXXXWR 821
            MSIDIIHSWYEKCIPKKPKDPPTPEEVITNGHQICKTFIGNKLKKLNLIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWR
Sbjct:    1 MSIDIIHSWYEKCIPKKPKDPPTPEEVITNGHQICKTFIGNKLKKLNLIKPDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQEIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWR 244          
BLAST of bok-2 vs. Planmine SMEST
Match: SMESG000021216.1 (SMESG000021216.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.673e-14
Identity = 39/124 (31.45%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  390 EIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKY 761
            ++  +L+  YPDLY ++ +Q+G       +     +L F  E L KSG +     W K+ ++L +  G  +DC +  + + I  +ID+F   V+  L  W+  QNGWN+P E     F+ LK Y
Sbjct:   53 KVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFC-EHLTKSGMN-----WVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEE-----FNSLKLY 165          
The following BLAST results are available for this feature:
BLAST of bok-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BOK3.866e-1428.13BCL2 family apoptosis regulator BOK [Source:HGNC S... [more]
back to top
BLAST of bok-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bok-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Buffy2.118e-1233.33gene:FBgn0040491 transcript:FBtr0088077[more]
Debcl1.451e-1028.24gene:FBgn0029131 transcript:FBtr0086108[more]
back to top
BLAST of bok-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
boka1.015e-1332.41BCL2 family apoptosis regulator BOK a [Source:NCBI... [more]
bokb1.188e-1232.04BCL2 family apoptosis regulator BOK b [Source:NCBI... [more]
boka6.248e-1229.81BCL2 family apoptosis regulator BOK a [Source:NCBI... [more]
back to top
BLAST of bok-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
plxna11.311e-1332.11plexin A1 [Source:Xenbase;Acc:XB-GENE-5819524][more]
back to top
BLAST of bok-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bok3.048e-1228.32BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
Bok3.048e-1228.32BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
Bok1.266e-627.63BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
back to top
BLAST of bok-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UMX3|BOK_HUMAN1.856e-1328.13Bcl-2-related ovarian killer protein OS=Homo sapie... [more]
sp|Q6DC66|BOKA_DANRE1.987e-1333.33Bcl-2-related ovarian killer protein homolog A OS=... [more]
sp|Q9I8I2|BOK_CHICK5.626e-1230.10Bcl-2-related ovarian killer protein OS=Gallus gal... [more]
sp|Q7T381|BOKB_DANRE9.450e-1232.04Bcl-2-related ovarian killer protein homolog B OS=... [more]
sp|Q792S6|BOK_RAT2.132e-1128.32Bcl-2-related ovarian killer protein OS=Rattus nor... [more]
back to top
BLAST of bok-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2DL181.003e-146100.00Bok-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A1I8J6813.505e-1736.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FZV81.125e-1636.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H8A76.698e-1535.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Z2BZW13.779e-1432.81Uncharacterized protein OS=Takifugu bimaculatus OX... [more]
back to top
BLAST of bok-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
boka5.046e-1329.81BCL2 family apoptosis regulator BOK [Source:NCBI g... [more]
back to top
BLAST of bok-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bok-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bok-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471966.276e-1130.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337148.728e-821.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308024.578e-624.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of bok-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bokb1.473e-1430.23bcl-2-related ovarian killer protein homolog A [So... [more]
boka1.292e-1129.13bcl-2-related ovarian killer protein homolog A [So... [more]
back to top
BLAST of bok-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066862.12.789e-150100.00SMESG000066862.1[more]
SMESG000021216.12.673e-1431.45SMESG000021216.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030330
GenBankAEX93480.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030330 ID=SMED30030330|Name=bok-2|organism=Schmidtea mediterranea sexual|type=transcript|length=893bp
GCACAATGACAATGAATATATACTGACAAACAATATAAAATTGATCTAGT
AACAAATTTTAGTACAGAATCAACTCAATTAATTTACCAATGTCTATTGA
TATTATACATAGTTGGTATGAAAAATGTATACCAAAAAAGCCGAAGGATC
CTCCGACTCCAGAAGAAGTCATTACAAATGGTCATCAAATATGTAAAACC
TTCATTGGGAATAAATTGAAAAAATTGAATCTAATTAAGCCAGACAACGT
CAGGAGTCCAAATTTAAAGAAGCATTCTTTTGGAATTTTGGCATATCAAG
GCGTAAATGTGATTTCTCACTTTATGCTAGGACCGAATTCGGCGGCTCAA
GCGACAGAGAATTTTAAAACGTCTTGCGCAGAGTTTCAGGAAATTGCCGT
CCAGCTGGAAAGTATGTATCCGGATTTGTATAAAAATGTCGCCTCTCAAA
TGGGAATTAATGTTGGTTGGGAACAACAGAAAATCAGTGAAGTCTTTTTA
CAGTTTTCCAATGAATTGCTATGCAAATCTGGAGAGTCTGAACCTCAGAT
TTATTGGGCAAAAATAATTTCTCTTCTTTGTATTGGCGCGGGCTTGGCAG
TGGATTGTGCAAAAAATGGAAAATGGGATACAATTCCAAAAATAATAGAC
ACATTTGATCGGATAGTTGCTCAGATTCTTATGACTTGGATAATCAGCCA
AAATGGATGGAATATTCCACCCGAGTTAAAGCCAGACAAATTTTCCAGAT
TAAAAAAATATTTTTTAATATTTAATACCTTTCTTGCCATTTTTGCTGCA
ATACTTTTGGTGGCTTGGCGATTTTATTAGTAATTCTTTTTGAAAAAATT
TTATTTTCTATATAAATTGATGCTATTGTGTTTGTTTTTTGCG
back to top

protein sequence of SMED30030330-orf-1

>SMED30030330-orf-1 ID=SMED30030330-orf-1|Name=SMED30030330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MSIDIIHSWYEKCIPKKPKDPPTPEEVITNGHQICKTFIGNKLKKLNLIK
PDNVRSPNLKKHSFGILAYQGVNVISHFMLGPNSAAQATENFKTSCAEFQ
EIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGES
EPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTW
IISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWRFY*
back to top
Aliases
The feature 'bok-2' has the following synonyms
Synonym
bok-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036834Blc2-like_sf
IPR026309BOK
IPR026298Blc2_fam
IPR002475Bcl2-like
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0006915apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036834Blc2-like superfamilyGENE3DG3DSA:1.10.437.10coord: 24..210
e-value: 6.7E-22
score: 79.8
IPR036834Blc2-like superfamilySUPERFAMILYSSF56854Bcl-2 inhibitors of programmed cell deathcoord: 94..208
IPR026298Blc2 familyPFAMPF00452Bcl-2coord: 100..207
e-value: 7.3E-12
score: 45.8
IPR026298Blc2 familyPANTHERPTHR11256BCL-2 RELATEDcoord: 19..240
IPR026309Bcl-2-related ovarian killer proteinPANTHERPTHR11256:SF48BCL-2-RELATED OVARIAN KILLER PROTEINcoord: 19..240
IPR002475Bcl2-likePROSITEPS50062BCL2_FAMILYcoord: 99..209
score: 10.489
NoneNo IPR availableTMHMMTMhelixcoord: 224..243