Trichoplein keratin filament-binding protein

Overview
NameTrichoplein keratin filament-binding protein
Smed IDSMED30030319
Length (bp)1615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Trichoplein keratin filament-binding protein (SMED30030319) t-SNE clustered cells

Violin plots show distribution of expression levels for Trichoplein keratin filament-binding protein (SMED30030319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Trichoplein keratin filament-binding protein (SMED30030319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Trichoplein keratin filament-binding protein (SMED30030319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030319SMESG000056471.1 SmedASXL_013138SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030319SMESG000056471.1 Contig37671newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030319SMESG000056471.1 Contig37671uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30030319SMESG000056471.1 dd_Smed_v6_6634_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030319SMESG000056471.1 dd_Smed_v4_6634_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 178.333 bits (451), Expect = 4.771e-49
Identity = 175/493 (35.50%), Postives = 297/493 (60.24%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRS 1554
            MALP L  S++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY  Q EK + +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSA+EE+RK  AE+L YEH++ NNP LR++E +L  K VV  W  Q + + ++E  A+++++  E E + AR +  ++ +  + +++ L+++   ++L +Q++E+K KE EA +LK ++  L+K   E++    +R+     + K E G+ L  Q+ A + R++QQIQEELE+D R L  L +++++   +  +R+E+   D+ WM++AIE+QL+ ER REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+Q+K+ + R  Q +SL+ RE+++  +E  +++  RE E + + KS  +  LE Q A ++ Q    + + +EE +     E   +  L++EAE M  +G  P+ 
Sbjct:    1 MALPTL-PSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAY--QREKMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERAR-REALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 178.333 bits (451), Expect = 4.771e-49
Identity = 175/493 (35.50%), Postives = 297/493 (60.24%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRS 1554
            MALP L  S++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY  Q EK + +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSA+EE+RK  AE+L YEH++ NNP LR++E +L  K VV  W  Q + + ++E  A+++++  E E + AR +  ++ +  + +++ L+++   ++L +Q++E+K KE EA +LK ++  L+K   E++    +R+     + K E G+ L  Q+ A + R++QQIQEELE+D R L  L +++++   +  +R+E+   D+ WM++AIE+QL+ ER REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+Q+K+ + R  Q +SL+ RE+++  +E  +++  RE E + + KS  +  LE Q A ++ Q    + + +EE +     E   +  L++EAE M  +G  P+ 
Sbjct:    1 MALPTL-PSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAY--QREKMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERAR-REALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 178.333 bits (451), Expect = 4.771e-49
Identity = 175/493 (35.50%), Postives = 297/493 (60.24%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRS 1554
            MALP L  S++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY  Q EK + +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSA+EE+RK  AE+L YEH++ NNP LR++E +L  K VV  W  Q + + ++E  A+++++  E E + AR +  ++ +  + +++ L+++   ++L +Q++E+K KE EA +LK ++  L+K   E++    +R+     + K E G+ L  Q+ A + R++QQIQEELE+D R L  L +++++   +  +R+E+   D+ WM++AIE+QL+ ER REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+Q+K+ + R  Q +SL+ RE+++  +E  +++  RE E + + KS  +  LE Q A ++ Q    + + +EE +     E   +  L++EAE M  +G  P+ 
Sbjct:    1 MALPTL-PSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAY--QREKMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERAR-REALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 64.3142 bits (155), Expect = 2.217e-11
Identity = 68/172 (39.53%), Postives = 102/172 (59.30%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQ 594
            MALP L  S++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY+ +  K+E +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSA+EE+RK  AE+L YEH++ NNP LR++E +L  K VV  W  Q
Sbjct:    1 MALPTL-PSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAYQREKMKEEKR--RSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQ 169          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Zebrafish
Match: tchp (trichoplein, keratin filament binding [Source:NCBI gene;Acc:678595])

HSP 1 Score: 186.422 bits (472), Expect = 3.534e-52
Identity = 161/433 (37.18%), Postives = 267/433 (61.66%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAY-KNQM-EKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQL------RTEEEN------YAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDK 1335
            MALP L   + ++ +T E  L R+R  E   R++W    +YF++ ++ SSK ++WSS +S + S++A+ +++M E+K+ K    L+ RR +L  +  +ER++ + EL      +D+    +  K + L+SAREE RK  A+ L  EH++ NN  LRK+E+EL    +V  W  Q Q       RT+EE       Y + + + LE     R++ E +N   K+++K   E  LK     Q++E+K +E+EA+RLK ++  LM    E++    +R++  +++ K E+G+ L RQ+ A ++R++QQ+QEELE+D + L+ L + +  E     +R+E+A  D  WM+  IE+QL+ EREREAE D ++ EEA R+W KRE EW KE++ARE+LM EVL  R+ Q+Q+++ E R+ + +SLQ REE+L ++E+D+
Sbjct:    1 MALPTLSAHWPSRVRTLEQQLVRQREQEARLRRQWEQHSQYFREQDVRSSKQAQWSSRQSFHRSMSAFQRDRMREEKQRK----LEERRERLRTMLQEERDQLEAELRNIHPDRDTLARQLVEKTDALRSAREERRKNLAQELLREHWKQNNSQLRKVESELHKDHIVSQWQVQQQEKKQADERTQEEKQRFENEYERTRQEALE-----RMRKEEEN--RKWEEKKRAEELLK-----QMEELKLREQEAERLKQEQETLMSKRWELEKLEDERKMMEESRRKTEFGRFLTRQYRAQLKRRAQQVQEELEADRKILAALLEGELDEQRFHKARRERAVADAAWMKRVIEEQLQLEREREAEFDILYREEAQRVWEKREAEWEKERRARERLMREVLAGRQQQLQERMQENRLAREESLQRREELLQQLEQDR 417          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Zebrafish
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:567344])

HSP 1 Score: 62.3882 bits (150), Expect = 8.287e-10
Identity = 70/235 (29.79%), Postives = 134/235 (57.02%), Query Frame = 1
Query:  736 KDSLRRQIDEMKQKEEEAKRLKVQEAKLMK-----MELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQK 1425
            K  L+ Q+D  +Q+  +AK LK +EA+L+K     + LE +  +RQ+ L ++ K +++   SL       M+R ++  QEEL  D+  L  L  +++ E + +  +K + +E+    +E +  QL +++  EAE + +F  E  + W++RE +W  EK AR++LM++V++  +LQ+Q+K+ E    Q ++ +E+EE+   I+ +K +   E    RE   E+++ L  Q   +Q+
Sbjct:  231 KAVLQTQMDMAEQQRIQAKELKQEEAQLLKDQREMLRLEAEREHRQK-LQDQEKRRKQLDLSL----RLKMKRLTRDRQEELALDMSILEQLLAQEKDEKQDEVLKKLERQEEQRRYREYLSQQLEEQKRLEAETEQLFESELQQAWARREAQWRLEKTARDRLMKDVMDTLRLQIQEKLNENMQKQAEAFKEKEELDRIIQANKLLDEEEKAHFREATKEYQADLLAQMMYRQR 460          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000021681.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 196.438 bits (498), Expect = 9.887e-56
Identity = 177/509 (34.77%), Postives = 311/509 (61.10%), Query Frame = 1
Query:   76 LMALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQ---------KASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVT------PRSA 1557
            +MALP L + ++++ +  E  + R+R  E   R +W+   +YF++S + S+K ++WSS +S   S+NA+   +EK++ +   +L+ RR +L  L  +ER+  +EEL      K+SS+  M+ + E LKSAREE RKQ AE L YE ++ NN  LR++E+ L+ K VV+ W +QI ++ +E+     + +  E       +  I+ +    +++  QE  L + LR+Q++E+K K+ EAK+LK ++  L + + E+++   +R+   + + K E G  L RQ+ A M+R++Q +QEEL  D + LS L  ++++   +Q++R+E+A  D+ WM+  IE+QL  ER+REAELD++F EEA ++W+KRE EW +E+ AR +LM+EVL  R++Q+Q+++   ++ Q +S++ RE++L ++E  ++  +RE +   E+K+  R+ L+ Q          A  Q+++  +EF+L E    +L+N     N L++EAE M  RG        PR+A
Sbjct:    1 MMALPTLPSHWHSRSRVLEQQIVRQREQEARLRHQWDQTNQYFKQSNVCSTKQAQWSSRQSYQKSMNAF--HLEKQKEEKKKNLEYRREQLRKLLQEERDLLEEELRELQCNKESSVCDMRERTEELKSAREERRKQLAEELLYEQWKKNNVKLREVESSLLKKHVVDAWGEQITVKNQEKEEEDVEKKRFENEYEITRREAIERMKRDKEKRQKQEEELAEVLRQQMEELKLKDLEAKKLKKEQEHLQRQQWEIEELEEERRKMEEHRKKTELGHFLSRQYNAQMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADVTWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQIFEQRLREKDAIVQQEEEEKEFKLAE----DLEN-----NLLQQEAEIMTQRGYQKKVYSRPRNA 498          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000035176.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 194.126 bits (492), Expect = 7.628e-55
Identity = 177/508 (34.84%), Postives = 310/508 (61.02%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQ---------KASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVT------PRSA 1557
            MALP L + ++++ +  E  + R+R  E   R +W+   +YF++S + S+K ++WSS +S   S+NA+   +EK++ +   +L+ RR +L  L  +ER+  +EEL      K+SS+  M+ + E LKSAREE RKQ AE L YE ++ NN  LR++E+ L+ K VV+ W +QI ++ +E+     + +  E       +  I+ +    +++  QE  L + LR+Q++E+K K+ EAK+LK ++  L + + E+++   +R+   + + K E G  L RQ+ A M+R++Q +QEEL  D + LS L  ++++   +Q++R+E+A  D+ WM+  IE+QL  ER+REAELD++F EEA ++W+KRE EW +E+ AR +LM+EVL  R++Q+Q+++   ++ Q +S++ RE++L ++E  ++  +RE +   E+K+  R+ L+ Q          A  Q+++  +EF+L E    +L+N     N L++EAE M  RG        PR+A
Sbjct:   19 MALPTLPSHWHSRSRVLEQQIVRQREQEARLRHQWDQTNQYFKQSNVCSTKQAQWSSRQSYQKSMNAF--HLEKQKEEKKKNLEYRREQLRKLLQEERDLLEEELRELQCNKESSVCDMRERTEELKSAREERRKQLAEELLYEQWKKNNVKLREVESSLLKKHVVDAWGEQITVKNQEKEEEDVEKKRFENEYEITRREAIERMKRDKEKRQKQEEELAEVLRQQMEELKLKDLEAKKLKKEQEHLQRQQWEIEELEEERRKMEEHRKKTELGHFLSRQYNAQMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADVTWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQIFEQRLREKDAIVQQEEEEKEFKLAE----DLEN-----NLLQQEAEIMTQRGYQKKVYSRPRNA 515          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000035157.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 195.282 bits (495), Expect = 8.044e-55
Identity = 180/521 (34.55%), Postives = 314/521 (60.27%), Query Frame = 1
Query:   40 LSFLVR*KLK*ALMALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQ---------KASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVT------PRSA 1557
             SF V+       MALP L + ++++ +  E  + R+R  E   R +W+   +YF++S + S+K ++WSS +S   S+NA+   +EK++ +   +L+ RR +L  L  +ER+  +EEL      K+SS+  M+ + E LKSAREE RKQ AE L YE ++ NN  LR++E+ L+ K VV+ W +QI ++ +E+     + +  E       +  I+ +    +++  QE  L + LR+Q++E+K K+ EAK+LK ++  L + + E+++   +R+   + + K E G  L RQ+ A M+R++Q +QEEL  D + LS L  ++++   +Q++R+E+A  D+ WM+  IE+QL  ER+REAELD++F EEA ++W+KRE EW +E+ AR +LM+EVL  R++Q+Q+++   ++ Q +S++ RE++L ++E  ++  +RE +   E+K+  R+ L+ Q          A  Q+++  +EF+L E    +L+N     N L++EAE M  RG        PR+A
Sbjct:   59 CSFFVQ-------MALPTLPSHWHSRSRVLEQQIVRQREQEARLRHQWDQTNQYFKQSNVCSTKQAQWSSRQSYQKSMNAF--HLEKQKEEKKKNLEYRREQLRKLLQEERDLLEEELRELQCNKESSVCDMRERTEELKSAREERRKQLAEELLYEQWKKNNVKLREVESSLLKKHVVDAWGEQITVKNQEKEEEDVEKKRFENEYEITRREAIERMKRDKEKRQKQEEELAEVLRQQMEELKLKDLEAKKLKKEQEHLQRQQWEIEELEEERRKMEEHRKKTELGHFLSRQYNAQMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADVTWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQIFEQRLREKDAIVQQEEEEKEFKLAE----DLEN-----NLLQQEAEIMTQRGYQKKVYSRPRNA 561          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000035168.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 171.4 bits (433), Expect = 1.330e-46
Identity = 166/508 (32.68%), Postives = 298/508 (58.66%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQ---------KASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVT------PRSA 1557
            MALP L + ++++ +  E  + R+R  E   R +W+   +YF++S + S+K ++WSS +S   S+NA+   +EK++ +   +L+ RR +L  L  +ER+  +EEL      K+SS+  M+ + E LKSAREE R                   +++E+ L+ K VV+ W +QI ++ +E+     + +  E       +  I+ +    +++  QE  L + LR+Q++E+K K+ EAK+LK ++  L + + E+++   +R+   + + K E G  L RQ+ A M+R++Q +QEEL  D + LS L  ++++   +Q++R+E+A  D+ WM+  IE+QL  ER+REAELD++F EEA ++W+KRE EW +E+ AR +LM+EVL  R++Q+Q+++   ++ Q +S++ RE++L ++E  ++  +RE +   E+K+  R+ L+ Q          A  Q+++  +EF+L E    +L+N     N L++EAE M  RG        PR+A
Sbjct:   19 MALPTLPSHWHSRSRVLEQQIVRQREQEARLRHQWDQTNQYFKQSNVCSTKQAQWSSRQSYQKSMNAF--HLEKQKEEKKKNLEYRREQLRKLLQEERDLLEEELRELQCNKESSVCDMRERTEELKSAREERR-------------------KQVESSLLKKHVVDAWGEQITVKNQEKEEEDVEKKRFENEYEITRREAIERMKRDKEKRQKQEEELAEVLRQQMEELKLKDLEAKKLKKEQEHLQRQQWEIEELEEERRKMEEHRKKTELGHFLSRQYNAQMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADVTWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQIFEQRLREKDAIVQQEEEEKEFKLAE----DLEN-----NLLQQEAEIMTQRGYQKKVYSRPRNA 496          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Match: st3gal2.1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2, gene 1 [Source:Xenbase;Acc:XB-GENE-963532])

HSP 1 Score: 50.0618 bits (118), Expect = 8.822e-6
Identity = 48/191 (25.13%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  931 MRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENF 1503
            M+R +++ QEEL  D++ L ++    + + E +  RK + K++    +E +  QL +E+ +E E+D +   E  + W+K+  +  KEK+AR +LM++V++ R++Q+ +K           L++  ++  E+ +DK+++ R  E  ++        LE ++ ++Q         L ++YQ +L +++AY+ +
Sbjct:  294 MKRLAREQQEELALDMKILEHVMQGYQDDTEEKRQRKMELKKEQQIYREYLAQQLEEEKRQEREMDKMIEAELEKSWAKKTEQMRKEKEARNRLMKDVMDTRRVQIHEK-----------LEKNAKLQEELAQDKELLQRATEEHKQ--------LETERNARQ-------MNLAQQYQQDLLSQVAYQQW 458          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Mouse
Match: Tchp (trichoplein, keratin filament binding [Source:MGI Symbol;Acc:MGI:1925082])

HSP 1 Score: 160.999 bits (406), Expect = 5.364e-43
Identity = 163/497 (32.80%), Postives = 292/497 (58.75%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEEN-YRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKL-----EDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPR 1551
            MALP L + + ++K     +L +R++ +E+ +RQ+W    +YF+  +I +SK  +WSS+ S   S++AY  +  K+E +   +L+  R +      +DL A E +E +  +  +  +       ++ + + LKSAREE+RK  AERL YEH++ NNP LR++E +L  K V+  W  Q + + ++E   K++++ LE   +A  +     +  + +++ L+ R   ++LR+Q++E+KQKE EA +LK ++  L++   E++    +R+     + K E G+ L  Q+ A + R++Q+IQEELE D R L  L +++ +  +++ +R+E+A+ D  WM++ IE+QL+ E+ REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+ +K+ + R  Q ++L+ RE+++  +E  K++  R  E + E K   +  LE Q A +Q Q+     + +EE +     E      L++EA+ M  +G  P+
Sbjct:    1 MALPTLPSYWSSRKHM---DLRQRQHQQEDQFRQQWEQNSRYFRTWDIHNSKQIEWSSKISYQRSMHAYHCEKMKEEKRKILELRRERLRELLLEEQDLLAAELDELRLSMGLREQR-------LREQHQDLKSAREEQRKLIAERLLYEHWKKNNPKLRELELDLHKKHVINSWATQKEEKKQQEATEKQENKRLENQYAAARREAEARMRVEEERRQLEGRLQAEALRQQMEELKQKEMEATKLKKEQENLLRQRWELERLEEERRQMAALRRKTELGRFLKHQYNAQLNRRTQEIQEELEVDGRILQALLEKEGELQQVELARREQARADAAWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKREAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLEEGKQLAQRAKEESEELKLARKQELEAQVAERQGQEWEAARQEEEEEEEARQAEEHSNALLQQEAKTMAEKGYQPK 487          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Mouse
Match: Tchp (trichoplein, keratin filament binding [Source:MGI Symbol;Acc:MGI:1925082])

HSP 1 Score: 112.079 bits (279), Expect = 7.775e-28
Identity = 76/203 (37.44%), Postives = 125/203 (61.58%), Query Frame = 1
Query:  718 LQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIE 1326
            L+ R   ++LR+Q++E+KQKE E +R   Q A L                    + K E G+ L  Q+ A + R++Q+IQEELE D R L  L +++ +  +++ +R+E+A+ D  WM++ IE+QL+ E+ REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+ +K+ + R  Q ++L+ RE+++  +E
Sbjct:   34 LEGRLQAEALRQQMEELKQKEMEERR---QMAAL--------------------RRKTELGRFLKHQYNAQLNRRTQEIQEELEVDGRILQALLEKEGELQQVELARREQARADAAWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKREAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLE 213          
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Match: sp|A0AUT1|TCHP_XENLA (Trichoplein keratin filament-binding protein OS=Xenopus laevis OX=8355 GN=tchp PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 9.740e-57
Identity = 180/509 (35.36%), Postives = 313/509 (61.49%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASK---------QKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVT------PRSA 1557
            MALP L ++++++ +  E  + R+R  E   R +W+   +YF++S + SSK ++WSS +S   S+NA+    EK++ +    L+ RR +L  L  +ER+  +EEL+     K+ ++S M+ + E LKSAREE +KQ AE L YE ++ NN  LR++E+ L  K VV+ W +QI  R +E+     + + LE E + AR +  I+ +    +++  QE  L   L+ Q++E+K K+ EAK+LK ++  L++ + E+++   +R+   + + K E    L RQ+ A M+R++QQ+QEELE D + LS L  +++++  +Q++R+E+A  D+ WM+  IE+QL  ER+REAELD++F EEA ++W+KRE EW +E+ AR +LM+EVL  R++Q+Q+++   ++ Q +S+  RE +L ++E  ++  +RE +   E+K+  R+ LE Q A +         Q+++  +EF+L E+ +++L         L++EAE M  RG        PR+A
Sbjct:    1 MALPTLPSNWHSRSRVLEQQIVRQREQEARLRHQWDQTNQYFKQSNVCSSKQAQWSSRQSYQKSMNAF--HQEKQKEEKKKTLEYRREQLRKLLQEERDLLEEELKELRCNKEHNVSDMRQRTEELKSAREERQKQLAEELLYEQWKKNNVKLREVESSLFKKHVVDAWGEQITARNQEKEEEDMEKKRLENEYELAR-REAIERMKRDKEKRQQQEEELARVLKWQMEELKLKDLEAKKLKKEQEDLLRQQWEIEELEEERRKMEQCRKKTELSHFLSRQYNAQMKRRAQQVQEELEMDKKILSALISKEDEDQHLQSARREQAIADVAWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKRETEWERERNARNRLMKEVLAGRQMQIQERIERNQLAQAESVMNRERLLRQLEEARQFTSREKKQEEEQKTARRTELEAQIAEQLLKGKEAIVQQEEEEKEFKLAEDLENDL---------LQQEAEIMTQRGYQKKTYSRPRTA 497          
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Match: sp|Q1RM03|TCHP_DANRE (Trichoplein keratin filament-binding protein OS=Danio rerio OX=7955 GN=tchp PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 2.668e-51
Identity = 161/433 (37.18%), Postives = 267/433 (61.66%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAY-KNQM-EKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQL------RTEEEN------YAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDK 1335
            MALP L   + ++ +T E  L R+R  E   R++W    +YF++ ++ SSK ++WSS +S + S++A+ +++M E+K+ K    L+ RR +L  +  +ER++ + EL      +D+    +  K + L+SAREE RK  A+ L  EH++ NN  LRK+E+EL    +V  W  Q Q       RT+EE       Y + + + LE     R++ E +N   K+++K   E  LK     Q++E+K +E+EA+RLK ++  LM    E++    +R++  +++ K E+G+ L RQ+ A ++R++QQ+QEELE+D + L+ L + +  E     +R+E+A  D  WM+  IE+QL+ EREREAE D ++ EEA R+W KRE EW KE++ARE+LM EVL  R+ Q+Q+++ E R+ + +SLQ REE+L ++E+D+
Sbjct:    1 MALPTLSAHWPSRVRTLEQQLVRQREQEARLRRQWEQHSQYFREQDVRSSKQAQWSSRQSFHRSMSAFQRDRMREEKQRK----LEERRERLRTMLQEERDQLEAELRNIHPDRDTLARQLVEKTDALRSAREERRKNLAQELLREHWKQNNSQLRKVESELHKDHIVSQWQVQQQEKKQADERTQEEKQRFENEYERTRQEALE-----RMRKEEEN--RKWEEKKRAEELLK-----QMEELKLREQEAERLKQEQETLMSKRWELEKLEDERKMMEESRRKTEFGRFLTRQYRAQLKRRAQQVQEELEADRKILAALLEGELDEQRFHKARRERAVADAAWMKRVIEEQLQLEREREAEFDILYREEAQRVWEKREAEWEKERRARERLMREVLAGRQQQLQERMQENRLAREESLQRREELLQQLEQDR 417          
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Match: sp|Q9BT92|TCHP_HUMAN (Trichoplein keratin filament-binding protein OS=Homo sapiens OX=9606 GN=TCHP PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.291e-48
Identity = 175/493 (35.50%), Postives = 297/493 (60.24%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRS 1554
            MALP L  S++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY  Q EK + +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSA+EE+RK  AE+L YEH++ NNP LR++E +L  K VV  W  Q + + ++E  A+++++  E E + AR +  ++ +  + +++ L+++   ++L +Q++E+K KE EA +LK ++  L+K   E++    +R+     + K E G+ L  Q+ A + R++QQIQEELE+D R L  L +++++   +  +R+E+   D+ WM++AIE+QL+ ER REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+Q+K+ + R  Q +SL+ RE+++  +E  +++  RE E + + KS  +  LE Q A ++ Q    + + +EE +     E   +  L++EAE M  +G  P+ 
Sbjct:    1 MALPTL-PSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAY--QREKMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERAR-REALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Match: sp|Q5RE49|TCHP_PONAB (Trichoplein keratin filament-binding protein OS=Pongo abelii OX=9601 GN=TCHP PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.180e-46
Identity = 174/492 (35.37%), Postives = 289/492 (58.74%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRS 1554
            MALP L   ++  +Q     LAR+R  E   RQ+W    +YF+ S+I SSK ++WSS+ S   S++AY  Q EK + +    L+ RR KL  L  +E++    ELE   L  +     ++ +  +LKSAREE+RK  AE+L YEH++ NNP LR++E +L  K V+  W  Q + + ++E  A+++++  E       +  ++ +  + +++ L+++   ++L +Q++E+K KE EA +LK ++  L+K   E++    +R+     + K E G+ L  Q+ A + R++QQIQEELE+D R L  L +++++   +  +R+E+   D  WM++AIE+QL+ ER REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+Q+K+ + R  Q +SL+ RE+++  +E  ++   RE E   E KS  +  LE Q A +Q Q    + + KEE +     E   +  L++EAE M  +G  P+ 
Sbjct:    1 MALPTL-PFYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAY--QREKMKEEKRRSLEARREKLRQLMREEQDLLARELEELRLSMNLQERRIREQHRKLKSAREEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVINSWETQKEEKKQQEATAEEENKRYENEYERAQREALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLNRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVIADAAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEARESARREKEENEELKSARKQELEAQVAERQLQAWEADQQEKEEEEEARRVEQLSDALLQQEAETMAEQGYRPKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Match: sp|Q3TVW5|TCHP_MOUSE (Trichoplein keratin filament-binding protein OS=Mus musculus OX=10090 GN=Tchp PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 3.752e-42
Identity = 163/497 (32.80%), Postives = 292/497 (58.75%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEEN-YRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKL-----EDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPR 1551
            MALP L + + ++K     +L +R++ +E+ +RQ+W    +YF+  +I +SK  +WSS+ S   S++AY  +  K+E +   +L+  R +      +DL A E +E +  +  +  +       ++ + + LKSAREE+RK  AERL YEH++ NNP LR++E +L  K V+  W  Q + + ++E   K++++ LE   +A  +     +  + +++ L+ R   ++LR+Q++E+KQKE EA +LK ++  L++   E++    +R+     + K E G+ L  Q+ A + R++Q+IQEELE D R L  L +++ +  +++ +R+E+A+ D  WM++ IE+QL+ E+ REAEL  +  EEA  +W KRE EWA+E+ AR++LM EVL  R+ Q+ +K+ + R  Q ++L+ RE+++  +E  K++  R  E + E K   +  LE Q A +Q Q+     + +EE +     E      L++EA+ M  +G  P+
Sbjct:    1 MALPTLPSYWSSRKHM---DLRQRQHQQEDQFRQQWEQNSRYFRTWDIHNSKQIEWSSKISYQRSMHAYHCEKMKEEKRKILELRRERLRELLLEEQDLLAAELDELRLSMGLREQR-------LREQHQDLKSAREEQRKLIAERLLYEHWKKNNPKLRELELDLHKKHVINSWATQKEEKKQQEATEKQENKRLENQYAAARREAEARMRVEEERRQLEGRLQAEALRQQMEELKQKEMEATKLKKEQENLLRQRWELERLEEERRQMAALRRKTELGRFLKHQYNAQLNRRTQEIQEELEVDGRILQALLEKEGELQQVELARREQARADAAWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKREAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLEEGKQLAQRAKEESEELKLARKQELEAQVAERQGQEWEAARQEEEEEEEARQAEEHSNALLQQEAKTMAEKGYQPK 487          
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Match: A0A1S3H0D4 (trichoplein keratin filament-binding protein OS=Lingula unguis OX=7574 GN=LOC106150964 PE=4 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.622e-76
Identity = 207/495 (41.82%), Postives = 323/495 (65.25%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQI--QLRTEEENYAKKQ--DQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPR 1551
            MALP++ + + ++K  YE  + RRRN E+++R++W D  +YF  +EI + K + W+SE S ++S++AYK+Q   +E+K   +LK RR KL D+  KER+  + EL          IS MK ++E L+SAREE+RKQ AE   Y+HFR NNPDLR++E+    ++V+E W  Q+  Q R +E+   +K   +Q +EE + A LK + +   EK Q    +E+ LK  LR Q++E+KQ+E EA+RLK Q  +L K + E++    QR+  ++ + K+E+G+ LLRQH A + ++S+Q+QE+LE D R L  L ++ E++  +QT+RKEKA+ D  WM++ I++QLR E+ REAELD ++ +EA+R+W KRE EW +E+QARE+LM EVL  R+ Q++ ++ E R  Q +SL+ REE+L E++  +++  RE E   + K+E +  L+ Q  S+++QK+  + +L  E   E   E  YE  LR EAERM IRG  P+
Sbjct:    1 MALPNMPSLWTSRKNVYEAAIVRRRNQEDDFREKWQDTSRYFHDTEIGAVKQTAWTSEDSFHDSMDAYKSQ-HNREIK-AMNLKRRRLKLTDMLQKERDVLEAELRGYSADNYDRISDMKERSENLRSAREEKRKQLAEEKLYDHFRKNNPDLRELESRAGEQEVIEEWEGQVEEQKRKQEQEIREKALYEQLMEEERQAALKFDQELEREKIQ----EEKKLKSVLRDQVEELKQREREAERLKFQAEELQKQQWELEKLEDQRKEMDEIRKKEEFGRVLLRQHKAKLLQRSKQVQEQLELDRRILEALTEKAEEDRVLQTARKEKARADAAWMKQVIDEQLRLEKAREAELDMLYQDEASRMWQKREAEWERERQARERLMNEVLQGRQEQIEDRMEEIRKKQEESLERREELLRELDIAQQMTRREQEEEMKLKTERKQQLQAQMTSRREQKISAQDQLLREMAEEKKAEEDYEEMLRREAERMNIRGFGPK 489          
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Match: A0A433TC36 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013094 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.838e-66
Identity = 190/508 (37.40%), Postives = 321/508 (63.19%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXX-XXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQI--------QLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKL----GEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR 1563
            MALP +   + ++K  YE  +  +RN E+++R +W+D   YF+KS++ ++K + WSS ++  +  ++AY+  +++ ++K  ++LK RR+KL  L A+E   +Q+EL+       + +  MK +A+ LKSAREE+R++ AE   Y+H+R NNP+LRK E+E++N+ VV  W  Q+          R E E +A++    +EE + A L+ E     ++ + ++ +++ LK+ LR Q+ E K +E EAK+ ++ + +LM+ + E++    Q++   + + K++ G++LLRQH A M RKS+ IQEELE D + L  L +++ +   +QT+R+E+++ D  WM++ IEDQL+ E+ REAELD ++ EEAAR+W KRE+EW KE+QAR++LM EVL ER+ Q+  ++ E +  Q +SL  REE++ E+E  ++   +E E     K   R  LE+Q  ++Q+Q+      E F L+ E + E D    YE+ LR+E +RMR++G TPR   R
Sbjct:    1 MALPTMTGYWSSRKNIYEQAIVSQRNREDDFRNKWSDTANYFKKSDVRAAKQNAWSSTQAFQDRCMSAYEESVDR-DVKS-SNLKRRRDKLGRLLAEENQAFQDELKGLSRPSTARLEDMKARADGLKSAREEKRQKLAEEKLYQHWRENNPELRKAESEMLNEHVVGEWGDQMCEKEERLESARQENEVFARQ----MEEERLAALELE----RQREEARLTEQKSLKEVLREQMLEFKTREAEAKQWRLHQEELMRQKWELEQIEEQQRQREEERRKKDLGRALLRQHKAQMMRKSRVIQEELEQDRQLLESLIEKETENATLQTARREQSRADAQWMKQVIEDQLKLEKAREAELDMLYQEEAARMWQKRESEWEKERQARQRLMAEVLEERQAQISDQLHELQQQQEESLVRREELVREMELAQREARQEEEDRERGKLTTRVDLEEQMHNRQRQEAEARERERFELRHERKEEED----YEDLLRQETQRMRLQGFTPRDHSR 494          
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Match: A0A0B6ZYC9 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF87633 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.523e-64
Identity = 187/506 (36.96%), Postives = 306/506 (60.47%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQ--------LRTEEENYAKKQDQD-LEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQK--LGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR 1563
            MALP +   + ++K  YE  +AR R  E ++R++W+D   YF+ S++ ++K + WSS ++C +S++AY   +EK+E     +L+ RR KL  L +++   ++ EL  K       +  M+ K + LK+AREE R++ AE   Y+H++ +NPDLRK+E+E++   VV  W  Q++         R E+  + K+ ++D L EI+   LK E + V EK        +  K+ L++Q+ E K++E EA+  + Q+  L+K + E+D    ++    K + K++ G++LLRQH A M RKSQ IQ ELE+D + L  L  ++ +   +Q++R+EKA+ D  WM++ IEDQLR E+ REAELD ++ +EAAR+W KR+ EW KE++AR++LM EVL  R+ QV  ++ +    Q +SLQ REE++ E+E  +++  RE +  R  K   ++ LE Q  ++Q+Q+  L E+  LK E   E + +       R+E ER+R+RG TPR   R
Sbjct:   13 MALPTMTGYWSSRKNVYEQAIARHRQQEHDFRRQWSDTANYFKNSDVWATKQNAWSSNQACQDSMDAYNVGVEKEE--KAANLRRRREKLASLLSRDNITFEAELTGKSRPSFQKLEEMRSKVDGLKTAREEARQKLAEEKLYQHWQQSNPDLRKVESEVLQDHVVASWSDQLEEKKERLESARQEKLVFEKQLEEDRLNEIKMNELK-EAERVQEK--------KSFKEVLQQQMMEFKKREAEAQEFRRQQEDLLKHKWELDQIEEEQDFKEKERQKKDLGRALLRQHKAQMMRKSQVIQIELENDKKLLESLIAKENEHVALQSARQEKARADAHWMKQVIEDQLRLEKSREAELDMLYQDEAARVWHKRQAEWEKEREARQRLMAEVLLSRQEQVTARLRDLERQQEESLQHREELVKEMELVQQMTQREDDENRRNKMTTKTDLEKQIQTRQEQEKHLKEQLNLKLEVDKEEEEDYEDLL--RQETERLRLRGYTPRQHGR 505          
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Match: A0A2T7PHC7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08266 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 9.200e-63
Identity = 182/492 (36.99%), Postives = 311/492 (63.21%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEI-DXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTP 1548
            MALP     +  +K+ YE+++AR RN E ++R +W +   YF+K+ +  + + +  S+    +   +A+K   E+ EMK   +LK R+ KL  +  +E  +++ EL+    Q    I  MK +AE L+SAREE+RK+ AE   Y+H++ NNPD+RK+ +EL+   VV  WP QI+   ++E  A+++ + +E +++  RL   ++   ++  +++ +ER L++ L+RQI E++Q+E EA++LK Q+  L+  + E++    +R+   + + + + G+ LLRQH A M  KS++IQEELE D   L  L  ++E+E+ +QT+R+EKA+ D  WM++ IEDQ+R E+ REAELD +F +EAAR+W KR+ EW +E+ ARE+LM+EVL  R+ Q+  K+ E +    +S++ REE+L EIE   ++  RE + A   +  F+  LE+Q   +++Q+     +L+EE + E   +M Y++F+++E ER+R RG  P
Sbjct:    1 MALPTTPRYWMNRKEAYEHSIARHRNQESDFRHQWEEHADYFKKNNVVAAKQQAWESTPAYKDRCTDAFKKSSER-EMK-ALNLKQRQEKLRAMLLEENRQWEAELKQVSRQNCDKIENMKDRAEELRSAREEKRKKIAEDKLYDHWQQNNPDIRKVRSELLKDYVVGQWPTQIEEMKQKEEEARREKEAIERQMEEERLAA-LEKERQEEAKRLKEERQLREHLKRQIQELRQREAEAEQLKRQQDALLLQQWEVEQLEAERKEKEQQRKRSDLGRILLRQHKAQMMSKSRRIQEELEEDRLLLEMLIKKEEKEDVLQTARREKARADAQWMKQVIEDQIRLEKAREAELDVLFQDEAARMWQKRDAEWERERLARERLMKEVLESRQEQIAVKLEEIKQQHQESIERREELLQEIEIANQLTQREQKEAEATQKAFKHSLEEQITERREQEKLARLKLQEEEEEEEKADMEYQDFVQQETERLRQRGYKP 489          
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Match: F7BMH9 (Trichoplein keratin filament binding OS=Ornithorhynchus anatinus OX=9258 GN=TCHP PE=4 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 4.096e-60
Identity = 181/520 (34.81%), Postives = 314/520 (60.38%), Query Frame = 1
Query:    7 TPLN*YNKLIQLSFLVR*KLK*AL--MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQ-MEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAY--ENFLREEAERMRIRGVTPR 1551
             PL  Y          R K + A   MALP L   +    +  +  + RRR+ E  +R++W+   +YF+ S+I S+K ++WSS +S   S++AY  Q ++ +EMK+  D   RR +L  L  +E+    EE++   L  +S    ++ ++E LKSAREE RK  A++L YEH++ NNP LR+IE +L  K ++  W  Q++ + ++E   K++++  E    A     +  +  +  Q+  +++ L ++LR Q++E+K +E EA +LK ++  L+  + E++     R+   + +   E+G+ L RQ +A + R SQQIQ+ELE+D R L  L D++++E  + ++R+E+A  D+ WM++ +E+QL+ EREREAEL +++ E++ ++W KRE EWA+E+QAR+KLM EVL  R+LQ+Q+K+ + R  Q +SL+ RE++L ++E  K++  RE E A E K+  +  LE Q A + +QK  +E  L++++Q E      +  +  L++EA+ +  RG  P+
Sbjct:    5 PPLRFYGYGPGAGGFRRRKAEGAFDAMALPTLPFCWENHGRALQRQILRRRDQEACFRRQWDANSRYFRVSDIFSTKQAQWSSRRSYQQSMDAYHRQKLKAEEMKNLED---RRERLHKLLLQEQELLTEEMKELRLNLESREHQIRERSENLKSAREERRKMVADQLLYEHWKKNNPKLREIEADLHKKHIISSWGDQVEGKKQQEASEKEENRRFENEYEASRAEALKRMKAEEAQRRAEDQLLAEALRDQMEELKLREMEAMKLKKEQENLLSQQWELESLEENRRQMEEYRKNVEHGRYLRRQFSAQLSRHSQQIQDELETDKRILQALLDKEDEEQRLLSARRERAAADVAWMKQVVEEQLQLEREREAELQTLYLEDSKQMWQKREEEWAQERQARDKLMNEVLAGRQLQIQEKLEKNRRAQEESLKCREQLLRDLEEAKELTWREKEEAAELKTARKQELEAQVAERNRQK--QEASLQQQHQEEQARLAQHQEDEVLQQEAKALSDRGYQPK 519          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Cavefish
Match: tchp (trichoplein, keratin filament binding [Source:NCBI gene;Acc:678595])

HSP 1 Score: 90.1225 bits (222), Expect = 8.569e-19
Identity = 50/125 (40.00%), Postives = 89/125 (71.20%), Query Frame = 1
Query:  754 QIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELD 1128
            Q+ E++ +EEE +RL+ +E  LM    E++    +R+ A +++ K+E+G+ L RQ+ A ++R++QQ+QEELE+D R L  L + +++E  +Q++R+E+A  D  WM++ +E+QL+ ER+REAE D
Sbjct:  212 QMQELRLREEETRRLQKEEEALMSQRWEVERLEDERKRAEESRTKEEFGRFLSRQYRAQLKRRAQQVQEELEADRRILEALLEGEDEEQRLQSARRERAVADAAWMRKVLEEQLQLERQREAEFD 336          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Cavefish
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:103021622])

HSP 1 Score: 58.9214 bits (141), Expect = 7.418e-9
Identity = 66/224 (29.46%), Postives = 128/224 (57.14%), Query Frame = 1
Query:  730 YLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRK-EKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVL 1398
            +L+D    Q+   +Q+ ++AK+LK +EAKL++ + EM     QR+   K ++++   + L       M+R +Q+ Q+EL  D+  L  L   ++ E + +  RK E  KE   + Q  + +QL ++R  EAE + +   E  + W++R  +W  EK+AR++LM++VL+ R++Q+Q+K+      QV+  +ER+++   ++ +K +  +E    RE   E+++ L
Sbjct:  234 FLQD----QMMAAEQQRQQAKQLKEEEAKLLREQSEMLRLEEQREHKQKLQSQERRRRQLDLSLRLKMKRVAQEQQDELALDMSILEQLLTIEKDEKKEEALRKLELCKEQQTYRQ-YLAEQLEEQRRLEAETEQLIEAELQQTWNRRAAQWNLEKEARDRLMKDVLDTRRIQIQEKLERNAQKQVELAKERDDLNRVVQENKLLDEQEKTRLRESCLEYQADL 452          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Sea Lamprey
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:567344])

HSP 1 Score: 47.3654 bits (111), Expect = 6.109e-6
Identity = 35/103 (33.98%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  955 QEELESDIRFLSYLADRDEQENEIQTSRK-EKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKV 1260
            QEE++ D+R L  +      E++ Q  RK E  KE  ++ Q  +  Q  +ER+   E++ +   E  R+W +RE +W  EK+AR +L ++V++ RK Q+Q+K+
Sbjct:  277 QEEMDLDMRLLEQMVQTSSNESQDQQQRKMELRKEQQLYRQH-LAQQAEEERQCAREMERLMGAELERMWRRREEQWRLEKEARNRLFKDVMDARKQQIQEKL 378          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Nematostella
Match: EDO48130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK95])

HSP 1 Score: 208.764 bits (530), Expect = 3.968e-60
Identity = 185/535 (34.58%), Postives = 300/535 (56.07%), Query Frame = 1
Query:   79 MALPHLKTSFYTQ-KQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQ------------EREEILHEIERDKKIMN--------------REIESAREKKSEF---RSVLEDQKASKQ-KQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR*INKCIFSL 1590
            MALP L+  +    K   E  + RR   E + RQ W+   KYF ++EI+++K   W S+     S++A     +K   K+   L+ RR KL +L  +E+ EY+E+L    L +   +  M+ +AE LKS +E  RK+ A++  YEH++ N P+LR+IE+E + + VVE W +Q+  + E    A+++D+ +  +        +   +EK + +   E+ + + LR Q++E+K +EEEA  LK ++  L+  +  ++    QR+   +A+ K+E+G+ LLRQH A M RKSQ+IQ+ LE D++ L  +A  + ++ EI TSR+EKAK D  +M++ + DQL+ EREREAELD ++ +EAAR+WSKRE EW +E+ ARE+LM EVL ERK Q+  K+   R  Q  S++            +R      +E DKK  +              R++E+A  ++ EF   ++++E +K  K  K ++G+   L+EE       +  YE  LR+EA RM+     PR  R  +   I  +
Sbjct:    1 MALPTLQPYWMKNFKSRSEGLMVRRNQNEADRRQAWDGNAKYFHRNEIEATKQRAWGSDTCFQESMSALDTLYKKDHRKE--KLEERRKKLAELLLQEKKEYEEQLRDARLGESGKLIQMRDRAEELKSGKETRRKELAQQKLYEHWKQNAPELRQIESEQLKEHVVESWGEQVVDKAENLKTAREEDRRINAVMERDRLLAVHKEHEKEEARRRGEKVIAEQLRGQMEELKLREEEAVMLKKEQEMLIAEQQRIEQAEEQRRALEEARRKREFGRVLLRQHKAQMMRKSQEIQQALELDLKILESMAKEENKDKEIMTSRREKAKADAEYMRQVVADQLKLEREREAELDMLYRDEAARMWSKREAEWERERLARERLMAEVLAERKRQLDDKMSRLRQRQEASIESREELLRELEEVQRMTARERLEEDKKRRDADIQMRAQIEARRERDLEAAMREQEEFDRQKTLVEMRKRFKSCKLEIGKITSLREE-------DAVYEQMLRDEASRMKSHRPEPRPTRTRVTLVILGV 526          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Nematostella
Match: EDO35876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKB0])

HSP 1 Score: 184.496 bits (467), Expect = 3.924e-52
Identity = 177/547 (32.36%), Postives = 273/547 (49.91%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRN-FEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQ-------QIQLRTEEENYAKKQDQDLEEIQSARLKTE------IDNV------------NEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIE-----------------RDKKI-MNREIESAREK--------KSEF---RSVLEDQKASKQ-KQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPR 1551
            MALP L+  +    ++    L  RRN  E + RQ W+   KYF                         ++N++E  + + +                                  S +  + +AE LKS +E  RK+ A++  YEH++ N P+LR+IE+E   + VVE W +        + LR  E    KKQ        +  LKT       I+ V            +EK + +   E+ + + LR Q++E+K +EEEA  LK ++  L+  +  ++    QR+   +A+ K+E+G+ LLRQH A M RKSQ+IQ+ LE D++ L  +A  + ++ EI TSR+EKAK D  +M++ + DQL+ EREREAELD ++ +EAAR+WSKRE EW +E+ ARE+LM EVL ERK Q+  K+   R  Q +S++ REE+L E+E                 RD  I M  +IE+ RE+        + EF   ++++E +K  K  K ++G+   L+EE       +  YE  LR+EA RM+     PR
Sbjct:    1 MALPTLQPYWMKNYKSRSEGLMVRRNQNEADRRQAWDGNAKYF-------------------------HRNEIEATKQRAW---------------------------------GSDTCFQERAEELKSGKETRRKELAQQKLYEHWKQNAPELRQIESEQFKEHVVESWGELNQNNLKSMWLRAGESKLLKKQG-------TPNLKTAREEDRRINAVMERDRLLAVHKEHEKEEARRRGEKVIAEQLRGQMEELKLREEEAVMLKKEQEMLIAEQQRIEQAEEQRRALEEARRKREFGRVLLRQHKAQMMRKSQEIQQALELDLKILEAMAKEESKDKEIMTSRREKAKADAEYMRQVVADQLKLEREREAELDMLYRDEAARMWSKREAEWERERLARERLMAEVLAERKRQLDDKMSRLRQRQEESIESREELLRELEVVQRMTARERLEEDKKRRDADIQMRAQIEARRERDLEAAMREQEEFDRQKTLVEMRKRFKSCKLEIGKITSLREE-------DAVYEQMLRDEASRMKSHRPEPR 475          
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Medaka
Match: ENSORLT00000009185.2 (trichoplein keratin filament binding [Source:NCBI gene;Acc:101169367])

HSP 1 Score: 173.711 bits (439), Expect = 1.047e-47
Identity = 143/406 (35.22%), Postives = 252/406 (62.07%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLE-EIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSL 1293
            MALP L T   ++ +   + L+RRR  E  +RQ+W    +YF++  + S + + W S  S + S++AY NQ  ++E K   +L+ RR++L  +   ER++ + EL   +  +++  S +  K E L++ARE+ +K+ A+ L  EH+R N+P+LR+ E+ L    VV  W +QI  + ++E   +++ +  E E + +R K  +  + +  ++K  +ER   + LR+Q++E+  +EEEA RLK ++  L+  + E++    +R+   + + K E    L+RQ+ A M+R++QQ+Q ELE+D R L+ L + +++E +++T R+E+A  D  WM+  IE+QL+ ER+REAE +S+  EEA R+W +RE +W KE++ARE+LM EVL  R+ Q++ K+ + R  Q +SL
Sbjct:    1 MALPTLSTHLSSRSRMAADQLSRRREQEARWRQQWEMHARYFREQNLHSLRQAAWGSRSSFHQSMSAYHNQRLQEEKK--ANLEQRRDRLRAMLQGERDQLEAELRALVPDRNTLKSRLVQKTEELRTAREDRKKKLAQELLKEHWRKNSPELREAESALHKDYVVSQWQEQISEKKQKEVTEQEEKRHFENEYERSR-KEALQRMKQAEERKKEEERKTAEELRKQMEELYLREEEATRLKKEQDALLHQQWELEKIEEERRKMEERQKKTEIRHFLIRQYRAQMKRRAQQVQGELEADRRILAALLEGEQEEMKLETVRRERAVADAAWMKRVIEEQLKLERQREAEFESLHREEAQRVWERREAQWEKERKARERLMREVLMGRQQQLELKMQKNREAQEESL 403          
BLAST of Trichoplein keratin filament-binding protein vs. Planmine SMEST
Match: SMESG000056471.1 (SMESG000056471.1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 495/495 (100.00%), Postives = 495/495 (100.00%), Query Frame = 1
Query:   79 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDXXXXXXXXXXXXXXXXINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNXXXXXXXXXXXXXDSSISFMKHKAERLKSXXXXXXXXXXXXLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR 1563
            MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDSSKNSKWSSEKSCNNSINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNEYQEELEYKLLQKDSSISFMKHKAERLKSAREEERKQEAERLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR
Sbjct:    1 MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDSSKNSKWSSEKSCNNSINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNEYQEELEYKLLQKDSSISFMKHKAERLKSAREEERKQEAERLFYEHFRLNNPDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKTEIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKMELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQKLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR 495          
BLAST of Trichoplein keratin filament-binding protein vs. Planmine SMEST
Match: SMESG000004919.1 (SMESG000004919.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.777e-8
Identity = 50/161 (31.06%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  931 MRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKA 1413
            ++R ++++QEE+  D + +  L    E E  +Q  +K++  +D    ++ ++    +E  RE ELD +  EE  R W KR ++W +E  AR++L++EV+N RK QV+ ++      Q ++L +RE+    IER K+      +S  EK + +R+ L  Q A
Sbjct:  297 LKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 457          
The following BLAST results are available for this feature:
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TCHP4.771e-4935.50trichoplein keratin filament binding [Source:HGNC ... [more]
TCHP4.771e-4935.50trichoplein keratin filament binding [Source:HGNC ... [more]
TCHP4.771e-4935.50trichoplein keratin filament binding [Source:HGNC ... [more]
TCHP2.217e-1139.53trichoplein keratin filament binding [Source:HGNC ... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tchp3.534e-5237.18trichoplein, keratin filament binding [Source:NCBI... [more]
cfap538.287e-1029.79cilia and flagella associated protein 53 [Source:N... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021681.19.887e-5634.77trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000035176.17.628e-5534.84trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000035157.18.044e-5534.55trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000035168.11.330e-4632.68trichoplein, keratin filament binding [Source:NCBI... [more]
st3gal2.18.822e-625.13ST3 beta-galactoside alpha-2,3-sialyltransferase 2... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tchp5.364e-4332.80trichoplein, keratin filament binding [Source:MGI ... [more]
Tchp7.775e-2837.44trichoplein, keratin filament binding [Source:MGI ... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0AUT1|TCHP_XENLA9.740e-5735.36Trichoplein keratin filament-binding protein OS=Xe... [more]
sp|Q1RM03|TCHP_DANRE2.668e-5137.18Trichoplein keratin filament-binding protein OS=Da... [more]
sp|Q9BT92|TCHP_HUMAN2.291e-4835.50Trichoplein keratin filament-binding protein OS=Ho... [more]
sp|Q5RE49|TCHP_PONAB2.180e-4635.37Trichoplein keratin filament-binding protein OS=Po... [more]
sp|Q3TVW5|TCHP_MOUSE3.752e-4232.80Trichoplein keratin filament-binding protein OS=Mu... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H0D41.622e-7641.82trichoplein keratin filament-binding protein OS=Li... [more]
A0A433TC363.838e-6637.40Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0B6ZYC91.523e-6436.96Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A2T7PHC79.200e-6336.99Uncharacterized protein OS=Pomacea canaliculata OX... [more]
F7BMH94.096e-6034.81Trichoplein keratin filament binding OS=Ornithorhy... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tchp8.569e-1940.00trichoplein, keratin filament binding [Source:NCBI... [more]
cfap537.418e-929.46cilia and flagella associated protein 53 [Source:N... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap536.109e-633.98cilia and flagella associated protein 53 [Source:N... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481303.968e-6034.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358763.924e-5232.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000009185.21.047e-4735.22trichoplein keratin filament binding [Source:NCBI ... [more]
back to top
BLAST of Trichoplein keratin filament-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000056471.10.000e+0100.00SMESG000056471.1[more]
SMESG000004919.11.777e-831.06SMESG000004919.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030319 ID=SMED30030319|Name=Trichoplein keratin filament-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1615bp
TCTTTTACCCCGCTAAATTGATATAATAAGTTAATTCAATTGTCATTTTT
AGTCCGTTAAAAATTAAAATAAGCATTAATGGCACTTCCCCATTTGAAAA
CCTCATTTTACACTCAAAAACAGACGTATGAAAATAATCTAGCTAGAAGG
CGAAACTTTGAAGAAAATTACAGACAAGAATGGAACGATAAGGTTAAATA
TTTTCAGAAATCGGAAATTGATAGTAGCAAAAACAGTAAATGGTCATCCG
AGAAATCTTGTAACAATAGCATTAATGCGTACAAAAATCAAATGGAAAAA
AAAGAAATGAAAGATTATACTGATTTAAAAATTCGTAGAAATAAATTAGA
AGATCTGTTTGCGAAAGAGAGAAATGAATATCAAGAAGAGCTTGAATACA
AATTACTTCAAAAAGATTCGTCTATATCTTTCATGAAACATAAAGCCGAA
CGATTAAAAAGTGCTCGTGAAGAAGAAAGAAAACAAGAAGCTGAACGCTT
ATTTTATGAGCATTTCAGATTAAACAATCCAGATTTGAGAAAAATTGAAA
CGGAATTAATTAATAAAGATGTAGTTGAATATTGGCCACAACAGATCCAG
CTGAGAACTGAGGAGGAAAACTATGCAAAAAAACAAGATCAAGATCTTGA
AGAAATTCAAAGTGCACGTTTGAAAACAGAAATTGATAATGTAAATGAAA
AGTTTCAACAAAAAATTCTCCAAGAAAGATATTTAAAAGACAGTCTGAGG
CGACAAATAGACGAAATGAAACAAAAAGAGGAAGAAGCTAAACGATTAAA
AGTTCAAGAAGCGAAATTAATGAAAATGGAATTAGAAATGGATGATTATT
ATCGGCAACGGCAACTTGCCAATAAGGCAAAGGCAAAGCAAGAATATGGG
AAGTCCTTGCTCCGACAACATACGGCTGTTATGAGGAGAAAATCTCAACA
AATTCAAGAGGAATTGGAATCCGATATTCGTTTTCTTTCATATCTTGCAG
ATAGAGATGAACAAGAAAATGAAATTCAAACCAGTAGAAAGGAAAAGGCC
AAAGAAGATTTAATCTGGATGCAAGAAGCTATTGAAGATCAACTAAGAAA
GGAAAGAGAAAGAGAAGCAGAATTGGATTCTATCTTTGCTGAAGAAGCAG
CCAGGTTGTGGTCTAAGAGAGAAAATGAGTGGGCAAAAGAAAAGCAAGCA
AGGGAAAAACTGATGGAAGAGGTACTGAATGAAAGAAAACTACAAGTTCA
ACAAAAGGTTTTGGAAACCCGAATGATGCAAGTTAAATCTCTTCAAGAAA
GAGAAGAAATTCTCCATGAAATTGAACGTGATAAAAAGATTATGAATAGA
GAAATTGAATCGGCTCGAGAGAAAAAGTCAGAATTCCGATCTGTATTGGA
AGATCAAAAAGCGAGTAAACAAAAACAAAAATTGGGAGAAGAATTTCGTT
TGAAAGAAGAATATCAGTCAGAACTGGACAATGAAATGGCGTATGAAAAC
TTTCTTAGAGAAGAGGCTGAACGAATGCGGATAAGAGGAGTCACTCCAAG
ATCTGCAAGACGGTGAATAAATAAATGTATTTTTTCTTTGTTTTAATAAT
AGTGTTACTTCTCTT
back to top

protein sequence of SMED30030319-orf-1

>SMED30030319-orf-1 ID=SMED30030319-orf-1|Name=SMED30030319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MALPHLKTSFYTQKQTYENNLARRRNFEENYRQEWNDKVKYFQKSEIDSS
KNSKWSSEKSCNNSINAYKNQMEKKEMKDYTDLKIRRNKLEDLFAKERNE
YQEELEYKLLQKDSSISFMKHKAERLKSAREEERKQEAERLFYEHFRLNN
PDLRKIETELINKDVVEYWPQQIQLRTEEENYAKKQDQDLEEIQSARLKT
EIDNVNEKFQQKILQERYLKDSLRRQIDEMKQKEEEAKRLKVQEAKLMKM
ELEMDDYYRQRQLANKAKAKQEYGKSLLRQHTAVMRRKSQQIQEELESDI
RFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELD
SIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMM
QVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKASKQKQ
KLGEEFRLKEEYQSELDNEMAYENFLREEAERMRIRGVTPRSARR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026773TCHP
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 220..260
NoneNo IPR availableCOILSCoilCoilcoord: 307..327
NoneNo IPR availableCOILSCoilCoilcoord: 116..141
NoneNo IPR availableCOILSCoilCoilcoord: 80..100
NoneNo IPR availableCOILSCoilCoilcoord: 405..432
NoneNo IPR availablePFAMPF13868TPHcoord: 147..483
e-value: 1.9E-16
score: 59.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 429..454
NoneNo IPR availablePANTHERPTHR31183FAMILY NOT NAMEDcoord: 1..495
IPR026773Trichoplein keratin filament-binding proteinPANTHERPTHR31183:SF2TRICHOPLEIN KERATIN FILAMENT-BINDING PROTEINcoord: 1..495