Si:ch211-93n23.7

Overview
NameSi:ch211-93n23.7
Smed IDSMED30030316
Uniprot Best hitProtein STPG4 OS=Homo sapiens OX=9606 GN=STPG4 PE=1 SV=2 (E=1.55592e-25)
Length (bp)1127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-93n23.7 (SMED30030316) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-93n23.7 (SMED30030316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-93n23.7 (SMED30030316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-93n23.7 (SMED30030316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30030316SMESG000060671.1 SMESG000060669.1 dd_Smed_v4_5936_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30030316SMESG000060671.1 SMESG000060669.1 dd_Smed_v4_5936_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-93n23.7 vs. Ensembl Human
Match: STPG4 (sperm-tail PG-rich repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:26850])

HSP 1 Score: 106.686 bits (265), Expect = 3.240e-26
Identity = 75/208 (36.06%), Postives = 107/208 (51.44%), Query Frame = 3
Query:  321 DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYL--LPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPA-ELKHLGRQHGL 935
            +R  WW+  +      G Y   TFI+    NP+  +Y F ++GRK+     R    L  LP  Y   DF  L++K+ ++YSFK +PR S   L    D +L L+PGQYN    L   + K + +   F+S  +RFP+  F P  GP PG Y+V    P   +TS F+S   RF PS +K PGPG Y    Q P  +  +  +G++H L
Sbjct:   37 EREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLP-QYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVD-KDQSLQLSPGQYN---VLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMP-PTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSL 238          
BLAST of Si:ch211-93n23.7 vs. Ensembl Human
Match: STPG4 (sperm-tail PG-rich repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:26850])

HSP 1 Score: 70.8626 bits (172), Expect = 2.079e-14
Identity = 43/111 (38.74%), Postives = 60/111 (54.05%), Query Frame = 3
Query:  606 DLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPA-ELKHLGRQHGL 935
            D +L L+PGQYN    L   + K + +   F+S  +RFP+  F P  GP PG Y+V    P   +TS F+S   RF PS +K PGPG Y    Q P  +  +  +G++H L
Sbjct:   12 DQSLQLSPGQYN---VLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMP-PTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSL 118          
BLAST of Si:ch211-93n23.7 vs. Ensembl Human
Match: STPG4 (sperm-tail PG-rich repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:26850])

HSP 1 Score: 67.781 bits (164), Expect = 8.681e-13
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  321 DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYL--LPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEP 740
            +R  WW+  +      G Y   TFI+    NP+  +Y F ++GRK+     R    L  LP  Y   DF  L++K+ ++YSFK +PR S   L    D +L L+PGQYN    L   + K + +   F+S  +RFP+  F P
Sbjct:   37 EREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLP-QYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVD-KDQSLQLSPGQYN---VLPAPVPKYASRSCVFRSTVQRFPTTYFIP 173          
BLAST of Si:ch211-93n23.7 vs. Ensembl Zebrafish
Match: si:ch211-93n23.7 (si:ch211-93n23.7 [Source:ZFIN;Acc:ZDB-GENE-141222-51])

HSP 1 Score: 99.3673 bits (246), Expect = 7.239e-24
Identity = 65/190 (34.21%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  318 ADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQ 887
             +RS WW+  IK Y   G Y    F++    NP+  +Y F   GR   +S   +GE LLPGAY + +      +  ++YSF+  PR     L G  D ++NL+PG Y   D     + K   K + F+S  +R     F P+ GPAPG Y+   S     +TS F+S   R    H   PGPGTY  ++ 
Sbjct:   30 TERSSWWRNTIKNYPIPGSYHIRDFLEETKLNPVPRTYSFKGPGRNTLMSTMGQGEMLLPGAYNFTNSTTEALRYQATYSFRSCPRPDNYTL-GLRDKDINLSPGHY---DITEKPVSKSPCKHVMFRSVVQRV---SFLPKEGPAPGHYNPRQSTGTA-VTSCFRSTVPRLYSVHMGTPGPGTYQLTWH 211          
BLAST of Si:ch211-93n23.7 vs. Ensembl Zebrafish
Match: si:ch211-93n23.7 (si:ch211-93n23.7 [Source:ZFIN;Acc:ZDB-GENE-141222-51])

HSP 1 Score: 56.225 bits (134), Expect = 2.515e-9
Identity = 30/86 (34.88%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  318 ADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPR 575
             +RS WW+  IK Y   G Y    F++    NP+  +Y F   GR   +S   +GE LLPGAY + +      +  ++YSF+  PR
Sbjct:   30 TERSSWWRNTIKNYPIPGSYHIRDFLEETKLNPVPRTYSFKGPGRNTLMSTMGQGEMLLPGAYNFTNSTTEALRYQATYSFRSCPR 115          
BLAST of Si:ch211-93n23.7 vs. Ensembl Zebrafish
Match: stpg1 (sperm-tail PG-rich repeat containing 1 [Source:NCBI gene;Acc:100002345])

HSP 1 Score: 51.9878 bits (123), Expect = 5.053e-7
Identity = 43/114 (37.72%), Postives = 61/114 (53.51%), Query Frame = 3
Query:  612 NLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKR--FPSKEFEPRMGPAPGEY---DVVCSNPLVPITSSFKSASARFK-PSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            N N AP QY+   Y A++         AF+SKT+R  F S +F+   GP+P  Y   DV+       + S FKS +AR + P  N +PGPGTY+  +Q P P +   L R++ L
Sbjct:  130 NENPAPNQYDV-SYRAVDKNSTISGESAFRSKTRRSAFVSDKFK---GPSPCHYKVSDVLVQKSPQALVSCFKSKTARIQSPVRNNIPGPGTYNP-HQPPEPVKRTVLPRRYYL 238          
BLAST of Si:ch211-93n23.7 vs. Ensembl Xenopus
Match: ENSXETT00000044110.1 (sperm-tail PG-rich repeat containing 4 [Source:NCBI gene;Acc:100497472])

HSP 1 Score: 112.849 bits (281), Expect = 3.323e-28
Identity = 73/191 (38.22%), Postives = 101/191 (52.88%), Query Frame = 3
Query:  369 GYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSH-NKVPGPGTYDKSYQSPPPA-ELKHLGRQHGL 935
            G Y    F+     NPI+P++ F   GR +  +    GE LLPG Y + D  + V++ P++YSF  R  R    L G  D +L+  PG+YN    +  + E    K   F+S  KRFPS    PR GP PG+Y+V  SNP   I+S F+S   RF  +H +K PGPGTY+   Q P     +  +GR HG+
Sbjct:   85 GAYDIRDFLQERQLNPIQPTFSFKCQGRTKRPNPVGSGEKLLPGCYNFPDLAYFVERLPNTYSF--RNTRRNTLLLGIRDKDLHTDPGKYN---VIHPSSEPCECKNFMFRSAVKRFPSSFLVPREGPGPGDYEVK-SNPSRGISSCFRSKVPRFPRAHISKTPGPGTYEPIRQFPKQTPTVAKMGRLHGI 269          
BLAST of Si:ch211-93n23.7 vs. Ensembl Mouse
Match: Stpg4 (sperm tail PG rich repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922717])

HSP 1 Score: 105.916 bits (263), Expect = 4.487e-26
Identity = 79/214 (36.92%), Postives = 109/214 (50.93%), Query Frame = 3
Query:  306 KYTPA-DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRS--VSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSP-PPAELKHLGRQHGL 935
            K TP  +R  WW+  I      G Y   TF +    NP+K +Y F ++GRK+   V +       LP  Y   DF  L++K+ +SYSFK +PR     L    D +L+L PGQY   + L   + K   +   F+S  +RFP   F P  GP PG+Y++  S P   ITS F+S   RF P  +K PGPG Y  S Q P   + +  +GR+H L
Sbjct:   32 KKTPGLEREGWWRLTITDTPIPGTYHFRTFTEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLP-QYSPPDFLELLKKQTASYSFKDKPRADPSTLVD-KDESLHLCPGQY---EVLPAPVPKSPARSFVFRSSVQRFPPNYFTPHEGPGPGDYELKAS-PKGSITSCFRSKVPRFLPVSSKTPGPGAYTSSRQFPKQSSTIAKMGREHSL 239          
BLAST of Si:ch211-93n23.7 vs. Ensembl Mouse
Match: Stpg4 (sperm tail PG rich repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922717])

HSP 1 Score: 65.0846 bits (157), Expect = 7.618e-12
Identity = 67/214 (31.31%), Postives = 90/214 (42.06%), Query Frame = 3
Query:  306 KYTPA-DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKR--SVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSP-PPAELKHLGRQHGL 935
            K TP  +R  WW+  I      G Y   TF +    NP+K +Y F ++GRK+   V +       LP  Y   DF  L++K+ +SYSFK +PR     L                             DK              E E   GP PG+Y++  S P   ITS F+S   RF P  +K PGPG Y  S Q P   + +  +GR+H L
Sbjct:   32 KKTPGLEREGWWRLTITDTPIPGTYHFRTFTEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLP-QYSPPDFLELLKKQTASYSFKDKPRADPSTL----------------------------VDK-------------DEHE---GPGPGDYELKAS-PKGSITSCFRSKVPRFLPVSSKTPGPGAYTSSRQFPKQSSTIAKMGREHSL 199          
BLAST of Si:ch211-93n23.7 vs. Ensembl Mouse
Match: Stpg4 (sperm tail PG rich repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922717])

HSP 1 Score: 63.929 bits (154), Expect = 1.366e-11
Identity = 48/142 (33.80%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  321 DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKR--SVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEP 740
            +R  WW+  I      G Y   TF +    NP+K +Y F ++GRK+   V +       LP  Y   DF  L++K+ +SYSFK +PR     L    D +L+L PGQY   + L   + K   +   F+S  +RFP   F P
Sbjct:   38 EREGWWRLTITDTPIPGTYHFRTFTEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLP-QYSPPDFLELLKKQTASYSFKDKPRADPSTLVD-KDESLHLCPGQY---EVLPAPVPKSPARSFVFRSSVQRFPPNYFTP 174          
BLAST of Si:ch211-93n23.7 vs. UniProt
Match: sp|Q8N801|STPG4_HUMAN (Protein STPG4 OS=Homo sapiens OX=9606 GN=STPG4 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.556e-25
Identity = 75/208 (36.06%), Postives = 107/208 (51.44%), Query Frame = 3
Query:  321 DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYL--LPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPA-ELKHLGRQHGL 935
            +R  WW+  +      G Y   TFI+    NP+  +Y F ++GRK+     R    L  LP  Y   DF  L++K+ ++YSFK +PR S   L    D +L L+PGQYN    L   + K + +   F+S  +RFP+  F P  GP PG Y+V    P   +TS F+S   RF PS +K PGPG Y    Q P  +  +  +G++H L
Sbjct:   37 EREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLP-QYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVD-KDQSLQLSPGQYN---VLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMP-PTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSL 238          
BLAST of Si:ch211-93n23.7 vs. UniProt
Match: sp|Q9DAG5|STPG4_MOUSE (Protein STPG4 OS=Mus musculus OX=10090 GN=Stpg4 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.138e-25
Identity = 79/214 (36.92%), Postives = 109/214 (50.93%), Query Frame = 3
Query:  306 KYTPA-DRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRS--VSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSP-PPAELKHLGRQHGL 935
            K TP  +R  WW+  I      G Y   TF +    NP+K +Y F ++GRK+   V +       LP  Y   DF  L++K+ +SYSFK +PR     L    D +L+L PGQY   + L   + K   +   F+S  +RFP   F P  GP PG+Y++  S P   ITS F+S   RF P  +K PGPG Y  S Q P   + +  +GR+H L
Sbjct:   32 KKTPGLEREGWWRLTITDTPIPGTYHFRTFTEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLP-QYSPPDFLELLKKQTASYSFKDKPRADPSTLVD-KDESLHLCPGQY---EVLPAPVPKSPARSFVFRSSVQRFPPNYFTPHEGPGPGDYELKAS-PKGSITSCFRSKVPRFLPVSSKTPGPGAYTSSRQFPKQSSTIAKMGREHSL 239          
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Match: gnl|BL_ORD_ID|17225777 (tr|A0A3S1AZ98|A0A3S1AZ98_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016257 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.409e-44
Identity = 93/222 (41.89%), Postives = 131/222 (59.01%), Query Frame = 3
Query:  288 SMNDWGKYTPADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLR-GFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVP-ITSSFKSASARFKPSHN----KVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            ++ND+ +    DR  WW+CQI+     G Y    FI  L   P   +Y F S+GR    +    G  LLPG YEYHDF   + +KP++Y FK + R + D L  G  D N+N++P QY+ + +L++N+EK   K   FKS++KRFP+  F P+ GP+PG Y+V       P +TSSF+S + RF  SH     KVPGPGTY K++Q P P  +  +GRQ+GL
Sbjct:   86 ALNDFYEAPITDREAWWRCQIRVTPIPGSYETSDFISELGKKP--NTYRFKSNGRVVPCTFDGYGALLLPGGYEYHDFLETLSEKPATYRFKAQNRDAFDVLNFGTKDKNINVSPNQYSVEKHLSVNVEKTPVKDFMFKSQSKRFPTTSFRPKEGPSPGSYNVKDITVRPPSVTSSFRSKTPRFHTSHTYTRKKVPGPGTYAKAFQHPIPPTISKMGRQYGL 305          
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Match: gnl|BL_ORD_ID|18925088 (tr|A0A1W3JBU8|A0A1W3JBU8_CIOIN protein STPG4-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100184507 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.390e-40
Identity = 90/211 (42.65%), Postives = 121/211 (57.35%), Query Frame = 3
Query:  309 YTP--ADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            +TP   DR EWW+  +K     G Y +  F+   + N IKP+Y F  +GRK++ S TR GE LLPGAYE+ DF   + ++P +Y FK   RR    L G  D + N+AP +Y +   L I + K      AFKS++ RFP+K F P+ GP PG YD    N    +TSSFKS + RF+ S  KVPGP TY  + Q+P    +  +GR HGL
Sbjct:   36 FTPQLTDR-EWWRVTLKETPVPGTYEQRDFLQDKDLNRIKPTYNFKGEGRKKNSSNTRNGEILLPGAYEHKDFLEELSRQPLTYEFKSSGRRRV--LPGLKDRDCNVAPCEYET---LRIPVNKAPIHHGAFKSQSPRFPTKYFNPKEGPPPGSYDPTNINRSPSVTSSFKSRTPRFRTSQTKVPGPATYASTLQTPQSQTVMKMGRMHGL 240          
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Match: gnl|BL_ORD_ID|18926018 (tr|A0A1W5B8X4|A0A1W5B8X4_CIOIN protein STPG4-like isoform X1 OS=Ciona intestinalis OX=7719 GN=LOC100184507 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.494e-40
Identity = 90/211 (42.65%), Postives = 121/211 (57.35%), Query Frame = 3
Query:  309 YTP--ADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            +TP   DR EWW+  +K     G Y +  F+   + N IKP+Y F  +GRK++ S TR GE LLPGAYE+ DF   + ++P +Y FK   RR    L G  D + N+AP +Y +   L I + K      AFKS++ RFP+K F P+ GP PG YD    N    +TSSFKS + RF+ S  KVPGP TY  + Q+P    +  +GR HGL
Sbjct:   48 FTPQLTDR-EWWRVTLKETPVPGTYEQRDFLQDKDLNRIKPTYNFKGEGRKKNSSNTRNGEILLPGAYEHKDFLEELSRQPLTYEFKSSGRRRV--LPGLKDRDCNVAPCEYET---LRIPVNKAPIHHGAFKSQSPRFPTKYFNPKEGPPPGSYDPTNINRSPSVTSSFKSRTPRFRTSQTKVPGPATYASTLQTPQSQTVMKMGRMHGL 252          
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Match: gnl|BL_ORD_ID|23918627 (tr|K1RBD6|K1RBD6_CRAGI Uncharacterized protein C2orf61-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10017102 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.007e-38
Identity = 83/191 (43.46%), Postives = 116/191 (60.73%), Query Frame = 3
Query:  369 GYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDN--LRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            G Y   TF++ L     + +Y F SDGRK       KG  LLPGAYE+  F   +++ P++Y+FK    RSK N  + G  D ++N++PGQY+ + YL +  ++ S K   FKS+ KRFP+  F PR GP PG Y+         I+SSFKS + RF  SH KVPGPG Y+K++Q P P+ + ++GRQHGL
Sbjct:   60 GAYESGTFLEDLQRR--QNTYRFKSDGRKIDPHPHGKGAILLPGAYEFQPFLDRLEQAPATYNFKAT-DRSKQNFLVIGHKDKDINVSPGQYDMEKYLTLTTDRQSSKHYMFKSQHKRFPTLPFRPRDGPGPGNYEHRHQRSNTAISSSFKSRTPRFSSSHTKVPGPGMYEKTFQHPIPSTVSNMGRQHGL 247          
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Match: gnl|BL_ORD_ID|21120325 (tr|A0A2T7NZ74|A0A2T7NZ74_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14154 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.286e-38
Identity = 86/207 (41.55%), Postives = 120/207 (57.97%), Query Frame = 3
Query:  324 RSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKP--SSYSFKVRPRRSKDNLR-GFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            R  WW+  I+     G Y   TF+D ++  P   +Y F SDGRK       KG  LLPGAY++  F  ++ KKP  ++Y+F+   R S D L  G  D  +N++P  Y    YL+++ +K   K  AFKS+ KRFP+  F+P+ GP PG YD        P++SSFKS + RF  S+ KVPGPGTY+K +Q P P  +  +GRQ+GL
Sbjct:   20 REGWWRSYIRETPRPGSYDSSTFVDDISQRPN--TYRFKSDGRKIDPQPHNKGSLLLPGAYDFQSFLDILDKKPIPATYNFRTPARDSFDVLNFGKKDKEINVSPTAYQMDKYLSLSADKMPSKHPAFKSQVKRFPTLYFKPKEGPGPGLYDSQLPVFQHPVSSSFKSRTPRFSTSYTKVPGPGTYEKIFQFPIPPTVAKMGRQYGL 224          
BLAST of Si:ch211-93n23.7 vs. Ensembl Cavefish
Match: si:ch211-93n23.7 (sperm-tail PG-rich repeat containing 4 [Source:NCBI gene;Acc:103028277])

HSP 1 Score: 64.6994 bits (156), Expect = 6.714e-12
Identity = 46/136 (33.82%), Postives = 66/136 (48.53%), Query Frame = 3
Query:  492 LPGAYEYHDFGFLVQKKP----SSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQ 887
            +PG Y   DF       P    +SY F+  PR +   L G  D ++N++P  Y   D     + K   K + F+S  +R     F P+ GP+PG+Y V  S P   ITS F+S   R     ++ PGPG YD S++
Sbjct:   47 VPGTYNIRDFLEEASLNPLQRQASYCFRSCPRPNTCTL-GIWDKDINVSPCHY---DVTVKPVPKLPCKHVMFRSAVQRL---SFLPKEGPSPGQYTVK-SIPAKGITSCFRSTVPRLHSVRSRTPGPGAYDPSWK 174          
BLAST of Si:ch211-93n23.7 vs. Ensembl Nematostella
Match: EDO41264 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W0])

HSP 1 Score: 132.88 bits (333), Expect = 5.068e-37
Identity = 81/211 (38.39%), Postives = 119/211 (56.40%), Query Frame = 3
Query:  318 ADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVP----ITSSFKSASARFKPSHN-KVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
             DR EWW+  +K     G Y    F+  +  NPIKP+YGF + GRK+    +RKG  L+PG Y+Y      + ++  +YSF+   R        F  +N  ++P   N+ D     + K   K  AFKS+  RFP+  F+P  GP PG+YD +  +P++P    I+SSFKS + RF+  H  K PGPG+YDK++Q+P P  +K +GR +GL
Sbjct:    7 TDREEWWRSTLKDTPVPGTYDIKNFVQDMEGNPIKPTYGFKNAGRKKDADLSRKGTTLMPGLYQYSTSVDKLDQRKVTYSFRACDRYHTPCALEF--VNSQISP---NTYDRGYQYVPKLPSKHPAFKSQIHRFPTVYFKPVKGPPPGQYD-LSKDPILPKGPRISSSFKSRTPRFQQPHVLKTPGPGSYDKTFQTPMPDTIKKMGRNYGL 211          
BLAST of Si:ch211-93n23.7 vs. Planmine SMEST
Match: SMESG000060669.1 (SMESG000060669.1)

HSP 1 Score: 513.072 bits (1320), Expect = 0.000e+0
Identity = 249/250 (99.60%), Postives = 249/250 (99.60%), Query Frame = 3
Query:  186 MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 935
            MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIK SYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL
Sbjct:    1 MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQIKPYRDTGYYSKPTFIDILNSNPIKSSYGFLSDGRKRSVSKTRKGEYLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQYNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSNPLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL 250          
The following BLAST results are available for this feature:
BLAST of Si:ch211-93n23.7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
STPG43.240e-2636.06sperm-tail PG-rich repeat containing 4 [Source:HGN... [more]
STPG42.079e-1438.74sperm-tail PG-rich repeat containing 4 [Source:HGN... [more]
STPG48.681e-1334.51sperm-tail PG-rich repeat containing 4 [Source:HGN... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-93n23.77.239e-2434.21si:ch211-93n23.7 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch211-93n23.72.515e-934.88si:ch211-93n23.7 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
stpg15.053e-737.72sperm-tail PG-rich repeat containing 1 [Source:NCB... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000044110.13.323e-2838.22sperm-tail PG-rich repeat containing 4 [Source:NCB... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Stpg44.487e-2636.92sperm tail PG rich repeat containing 4 [Source:MGI... [more]
Stpg47.618e-1231.31sperm tail PG rich repeat containing 4 [Source:MGI... [more]
Stpg41.366e-1133.80sperm tail PG rich repeat containing 4 [Source:MGI... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8N801|STPG4_HUMAN1.556e-2536.06Protein STPG4 OS=Homo sapiens OX=9606 GN=STPG4 PE=... [more]
sp|Q9DAG5|STPG4_MOUSE3.138e-2536.92Protein STPG4 OS=Mus musculus OX=10090 GN=Stpg4 PE... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|172257771.409e-4441.89tr|A0A3S1AZ98|A0A3S1AZ98_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|189250882.390e-4042.65tr|A0A1W3JBU8|A0A1W3JBU8_CIOIN protein STPG4-like ... [more]
gnl|BL_ORD_ID|189260183.494e-4042.65tr|A0A1W5B8X4|A0A1W5B8X4_CIOIN protein STPG4-like ... [more]
gnl|BL_ORD_ID|239186272.007e-3843.46tr|K1RBD6|K1RBD6_CRAGI Uncharacterized protein C2o... [more]
gnl|BL_ORD_ID|211203254.286e-3841.55tr|A0A2T7NZ74|A0A2T7NZ74_POMCA Uncharacterized pro... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-93n23.76.714e-1233.82sperm-tail PG-rich repeat containing 4 [Source:NCB... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412645.068e-3738.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-93n23.7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-93n23.7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000060669.10.000e+099.60SMESG000060669.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030316 ID=SMED30030316|Name=Si:ch211-93n23.7|organism=Schmidtea mediterranea sexual|type=transcript|length=1127bp
TAAATTTATAATTAATGATTTTCATGACTGGTTGGCTTTACAATTTTGTT
AATCTTCAGCAACTGATTGTAATTGCCATGGTACTAAGTGCCGGTATTAC
AATTGAATAACTGACCAGTTTTACTGCACCGTTATGCTGGTTATCATTGC
AACTGTATTGTTAGTTTATTAATCCAAAACCGAAAATGGCTGCAACAAAT
ATTCCACTGTCCAATGATTTAATGTTTAAACTGAAAACCGAAATTAAAGA
CCCGAATGATGTCAGACAGACGAAATTATTTGAAAAATCAATGAACGATT
GGGGCAAATACACCCCAGCTGACCGGAGTGAATGGTGGAAATGTCAAATA
AAACCTTACCGAGATACAGGATATTATTCCAAGCCAACATTTATAGACAT
ACTTAATTCAAATCCAATTAAACCGTCCTACGGATTCCTAAGTGATGGGC
GTAAAAGAAGTGTCAGTAAAACAAGAAAAGGAGAATATCTGTTGCCAGGA
GCTTATGAATATCATGATTTTGGATTCTTAGTTCAGAAAAAGCCGTCTTC
TTATAGCTTTAAAGTTAGACCGAGACGATCCAAAGATAATTTAAGAGGTT
TCTCTGATTTGAATTTAAATTTGGCTCCAGGACAATACAATAGTCAAGAC
TATCTGGCAATTAACCTGGAAAAAGGCTCAGATAAAATGATGGCGTTCAA
ATCAAAAACGAAGCGCTTTCCATCGAAAGAATTTGAACCGCGAATGGGAC
CTGCCCCTGGAGAATACGATGTTGTTTGTTCAAATCCTTTGGTGCCAATA
ACGTCATCATTCAAATCCGCCAGTGCTAGGTTCAAACCATCTCACAATAA
AGTTCCCGGTCCCGGAACGTATGACAAATCATACCAGTCGCCGCCCCCGG
CCGAATTGAAACATTTGGGCAGACAACATGGGCTATTTTTTAATAGCACA
TTTTGTAACTGATTTTTTTCTCCTAAATTATCGGTGACCCGTGAAATGAA
CTTGCCGAATTTTTAAATTTGTTTTGCAGTTTCTACTATTATTATTTTTT
ATTCTTAAAAATTTATACTAATTATTTTTCTAATTATTTTGAGTTTTTAT
AAAGTCTGATTCTAAAATCATTTCAAC
back to top

protein sequence of SMED30030316-orf-1

>SMED30030316-orf-1 ID=SMED30030316-orf-1|Name=SMED30030316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=259bp
MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEW
WKCQIKPYRDTGYYSKPTFIDILNSNPIKPSYGFLSDGRKRSVSKTRKGE
YLLPGAYEYHDFGFLVQKKPSSYSFKVRPRRSKDNLRGFSDLNLNLAPGQ
YNSQDYLAINLEKGSDKMMAFKSKTKRFPSKEFEPRMGPAPGEYDVVCSN
PLVPITSSFKSASARFKPSHNKVPGPGTYDKSYQSPPPAELKHLGRQHGL
FFNSTFCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1901537positive regulation of DNA demethylation
GO:0090116C-5 methylation of cytosine
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR039345STPG4
Vocabulary: cellular component
TermDefinition
GO:0001939female pronucleus
GO:0001940male pronucleus
GO:0005634nucleus
GO:0005737cytoplasm
GO:0042585germinal vesicle
Vocabulary: molecular function
TermDefinition
GO:0042393histone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039345Protein STPG4PANTHERPTHR35678FAMILY NOT NAMEDcoord: 33..255