Epidermal growth factor-8

Overview
NameEpidermal growth factor-8
Smed IDSMED30030312
Length (bp)1307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal growth factor-8 (SMED30030312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal growth factor-8 (SMED30030312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030312SMESG000077702.1 dd_Smed_v4_9465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030312SMESG000077702.1 dd_Smed_v4_9465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030312SMESG000077702.1 dd_Smed_v4_9465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A161HX36 (Epidermal growth factor-8 OS=Schmidtea mediterranea OX=79327 GN=egf-8 PE=2 SV=1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 383/385 (99.48%), Postives = 384/385 (99.74%), Query Frame = 3
Query:   39 MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYXXXXXXXXXXXXXXXXXXXXXXXXXMIYVIRTTKKRNKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNMPENEFEDPYEVPLLNHIESASSTVDDTYEIPIKSE 1193
            MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVD GGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKRNKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNMPENEFEDPYEVPLL+HIESASSTVDDTYEIPIKSE
Sbjct:    1 MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKRNKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNMPENEFEDPYEVPLLSHIESASSTVDDTYEIPIKSE 385          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A4S2LB56 (EGF-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008611 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.868e-14
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query:   69 INVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICI------TEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCE-------------ERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 674
            +NV+I   L+  +  +  L + + NY+N  ++    +KCE   +  D+CDPIF++ +       E+ L  + +     F N K +  V   +  + +F + I I++ + D D       IA+FR    +   G +D +  S    +VKV  +  + V+CA NYYG +CE               +   +CN  CI G C       +  C C  GW G  C
Sbjct:    1 MNVVILLCLLLSVRAEVNLLLTVRNYENKNNLDSRLRKCEALSFLGDNCDPIFQLTVHVTNSRNERHL--LLRREAGPFANKKVLKEVLQTSSTQREFPSVIEIALDIYDNDADE-DQLIARFRRIIPLLRTGQLDLQMGS----DVKV--KVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFC 210          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A419QGW3 (EGF-like domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CSKR_5660s PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.439e-14
Identity = 60/221 (27.15%), Postives = 97/221 (43.89%), Query Frame = 3
Query:   69 INVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICI------TEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCE-------------ERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 674
            +NV+I   L+     +  L + + NY+N  ++    +KCE   +  D+CDPIF++ +       E+ L  + +     F N K +  V   +  + +F N I I++ + D D       IA+FR    +   G +D +  S    +VKV  +  + V+CA NYYG +CE               +   +CN  CI G C       +  C C  GW G  C
Sbjct:    1 MNVVIILCLLLSARAEVNLLLTVRNYENKNNLDSRLRKCEALSFLGDNCDPIFQLTVHVTNSRNERHL--LLRREAGPFTNKKVLKEVLQTSSTQREFPNVIEIALDIYDNDADE-DQLIARFRRIIPLLKTGQLDLQMGS----DVKV--KVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFC 210          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A074ZCZ5 (EGF-like domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08602 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.052e-13
Identity = 57/221 (25.79%), Postives = 97/221 (43.89%), Query Frame = 3
Query:   69 INVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICI------TEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCE-------------ERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 674
            +NV+I   L+     +  L + + +Y+N  ++    +KCE   +  D+CDP+F++ +       E+ L  + +     F N K +  V   +  + +F + I I++ + D D       IA+FR    +   G +D +  S    +VKV  +  + V+CA NYYG +CE               +   +CN  CI G C       +  C C  GW G  C
Sbjct:    1 MNVVIILCLLLSARAEVKLLLTVRDYENKNNLDSRLRKCEALSFFGDNCDPVFQLTVHVTNSRNERHL--LLRREAGPFTNKKILKEVLQTSSTQREFPSVIEIALDIHDNDADE-DQLIARFRRIIPLLRTGQLDLQMGS----DVKV--KVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFC 210          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A1S8WXP4 (EGF-like domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05002 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.916e-11
Identity = 53/203 (26.11%), Postives = 89/203 (43.84%), Query Frame = 3
Query:  123 LKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICI------TEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCE-------------ERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 674
            L + + +Y+N  ++    +KCE   +  D+CDP+F++ +       E+ L  + +     F N K +  V   +  + +F + I I++ + D D       IA+FR    +   G +D +  S    +VKV  +  + V+CA NYYG +CE               +   +CN  CI G C       +  C C  GW G  C
Sbjct:   14 LLLTVRDYENKNNLDSRLRKCEALSFFGDNCDPVFQLTVHVTNSRNERHL--LLRREAGPFTNKKILKEVLQTSSTQREFPSVIEIALDIHDNDADE-DQLIARFRRIIPLLRTGQLDLQMGS----DVKV--KVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFC 205          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 377/385 (97.92%), Postives = 382/385 (99.22%), Query Frame = 3
Query:   39 MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYXXXXXXXXXXXXXXXXXXXXXXXXXMIYVIRTTKKRNKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNMPENEFEDPYEVPLLNHIESASSTVDDTYEIPIKSE 1193
            MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHD+ KCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTF+RDKFINSISISVRVDDVD GGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKF CNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKR+KKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQN+PENEFEDPYEVPLL+HIESASSTVDDTYEIPIKSE
Sbjct:    1 MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFERDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKRSKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNIPENEFEDPYEVPLLSHIESASSTVDDTYEIPIKSE 385          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 375/383 (97.91%), Postives = 380/383 (99.22%), Query Frame = 3
Query:   45 MKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYXXXXXXXXXXXXXXXXXXXXXXXXXMIYVIRTTKKRNKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNMPENEFEDPYEVPLLNHIESASSTVDDTYEIPIKSE 1193
            MKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHD+ KCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTF+RDKFINSISISVRVDDVD GGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKF CNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKR+KKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQN+PENEFEDPYEVPLL+HIESASSTVDDTYEIPIKSE
Sbjct:    1 MKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFERDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFDFSTTIIIISLIFVLCISLFSMIYVIRTTKKRSKKSSNLFTATSRPLPTITFTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNIPENEFEDPYEVPLLSHIESASSTVDDTYEIPIKSE 383          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077703.1 (SMESG000077703.1)

HSP 1 Score: 190.274 bits (482), Expect = 3.838e-55
Identity = 90/212 (42.45%), Postives = 135/212 (63.68%), Query Frame = 3
Query:   39 MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 674
            MKMK  I   I + I   +      KA+L ++I NY+N+ ++KHD  KCETF WAND+CDP+F+IC+T K+ CD+     + + N+K +Y V +Q  +  +    +S+ V+VDD D     DHIA F TSF I+   +  ++ M ++P N+ +SLQ SV +KCA +YYGN CE++  +  C  SCI+GKC+FN +K+   C+C++GWD  NC
Sbjct:    1 MKMKLKIFLQIFLYILLQINHQTKAKAVLTIHILNYKNYANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKTLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGNNCEKKRTQ--CKQSCIHGKCSFNIEKNQETCECFSGWDLPNC 210          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 129.798 bits (325), Expect = 7.947e-35
Identity = 61/156 (39.10%), Postives = 90/156 (57.69%), Query Frame = 3
Query:   93 LISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEE 560
             +S I  K  ++V IY+Y NH ++ H+ KKCE FHWA DHCDP+F IC+ +K  CD+   TT  + N + ++N+++ T   + FI S+ I V  DD D     DHI  FR +F            M   P ++ + L+A V +KC+ NYYGN C++
Sbjct:   13 FMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDK 168          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 129.028 bits (323), Expect = 8.355e-35
Identity = 61/155 (39.35%), Postives = 90/155 (58.06%), Query Frame = 3
Query:   96 ISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEE 560
            +S I  K  ++V IY+Y NH ++ H+ KKCE FHWA DHCDP+F IC+ +K  CD+   TT  + N + ++N+++ T   + FI S+ I V  DD D     DHI  FR +F            M   P ++ + L+A V +KC+ NYYGN C++
Sbjct:    1 MSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDK 155          
The following BLAST results are available for this feature:
BLAST of Epidermal growth factor-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A161HX360.000e+099.48Epidermal growth factor-8 OS=Schmidtea mediterrane... [more]
A0A4S2LB563.868e-1426.70EGF-like domain-containing protein OS=Opisthorchis... [more]
A0A419QGW36.439e-1427.15EGF-like domain-containing protein OS=Clonorchis s... [more]
A0A074ZCZ55.052e-1325.79EGF-like domain-containing protein OS=Opisthorchis... [more]
A0A1S8WXP41.916e-1126.11EGF-like domain protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077702.10.000e+097.92SMESG000077702.1[more]
SMESG000077702.10.000e+097.91SMESG000077702.1[more]
SMESG000077703.13.838e-5542.45SMESG000077703.1[more]
SMESG000012543.17.947e-3539.10SMESG000012543.1[more]
SMESG000012543.18.355e-3539.35SMESG000012543.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030312 ID=SMED30030312|Name=Epidermal growth factor-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1307bp
CGCATTACAACCTTTATTTGTATTCGGATTAATTGTTTATGAAAATGAAA
ACAAACATTACAACGCTGATTAATGTGATTATATTTGGGATACTTATTAG
TCCAATTACTACCAAAGCGATATTGAAAGTCTACATATATAATTACCAAA
ATCATGAGGATATGAAGCATGATGAAAAAAAATGTGAAACCTTTCATTGG
GCAAATGATCACTGTGATCCGATCTTTGAAATATGTATCACAGAAAAATC
TTTATGTGATGTTTTTAAGACAACAACAAATGTATTTGACAATTCCAAAA
AGATTTACAATGTTTTCACACAAACCTTTAAAAGAGATAAATTCATAAAT
TCAATATCAATTTCCGTTCGAGTAGATGATGTCGACGGCGGAGGAATTTC
GGATCATATCGCAAAGTTTCGTACAAGTTTTAACATAGAAACACCAGGAC
TCATAGATAGAAAAACAATGTCAGTTGAGCCAGCAAATGTTAAAGTTAGT
CTACAAGCAAGCGTTTCCGTAAAATGTGCTTTGAATTATTACGGAAATAA
ATGCGAAGAGAGATCTGATAAATTCATATGTAATTCAAGTTGTATTAATG
GCAAATGTAATTTCAATTATCAAAAAGATACATTTTTCTGTCAATGTTAC
AACGGATGGGATGGAATAAATTGTAATAAATCTATCTTTATAAATAATCT
TTCTTCTTCAACCAAGCTTCCAACAAAGCATACCTCTCAGCGACTTACAA
CAAAATATAACTATGTGGTTTATGTATCGTCATTTGATTTTTCAACGACA
ATTATTATAATTAGCCTAATCTTTGTATTGTGCATCTCTTTATTCTCAAT
GATTTATGTGATCAGAACAACGAAGAAACGAAACAAAAAGAGTTCAAATT
TATTTACTGCTACATCAAGACCACTTCCGACAATAACATTTACCAAAAAT
TTAAACAAGGAATCACAAGATCCAATCAAACAAAACACTCTAGTTTCTCA
ATTCAATCAGCCGGATACAGTTTATGATTACTCCACAGTTCAAATCGGTG
ATTCGTATAGTGAACGAAATTCGAATAAACAAAATATGCCTGAAAACGAA
TTTGAGGATCCTTATGAAGTTCCTCTGCTAAATCATATAGAATCTGCCTC
ATCTACAGTTGATGATACGTACGAAATACCAATTAAATCAGAAATATTGA
AATACTAAAAAAAAGTCGTCTGACATTTGAAGATTTATTCATAATGATAC
TTTTAGATAAATCCTATACAACTTTATTTTAATAAGCGTTTTATTCATAT
GTTTAAC
back to top

protein sequence of SMED30030312-orf-1

>SMED30030312-orf-1 ID=SMED30030312-orf-1|Name=SMED30030312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MKMKTNITTLINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCE
TFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRD
KFINSISISVRVDDVDGGGISDHIAKFRTSFNIETPGLIDRKTMSVEPAN
VKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFF
CQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQRLTTKYNYVVYVSSFD
FSTTIIIISLIFVLCISLFSMIYVIRTTKKRNKKSSNLFTATSRPLPTIT
FTKNLNKESQDPIKQNTLVSQFNQPDTVYDYSTVQIGDSYSERNSNKQNM
PENEFEDPYEVPLLNHIESASSTVDDTYEIPIKSEILKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013032EGF-like_CS
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 149..217
e-value: 3.0E-7
score: 32.5
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 179..214
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 201..212
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 201..212
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 177..213
score: 11.529