Peptidase_M14 domain-containing protein

Overview
NamePeptidase_M14 domain-containing protein
Smed IDSMED30030305
Length (bp)1721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase_M14 domain-containing protein (SMED30030305) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase_M14 domain-containing protein (SMED30030305) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase_M14 domain-containing protein (SMED30030305) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase_M14 domain-containing protein (SMED30030305) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030305

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030305SMESG000037626.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030305SMESG000037626.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030305SMESG000037626.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30030305SMESG000048042.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030305SMESG000048042.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030305SMESG000048042.1 Contig1315GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30030305SMESG000048042.1 dd_Smed_v4_2282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030305SMESG000048042.1 dd_Smed_v4_2282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030305SMESG000048042.1 dd_Smed_v4_2282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30030305SMESG000048042.1 dd_Smed_v6_2282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30030305SMESG000048042.1 dd_Smed_v6_2282_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA4 (carboxypeptidase A4 [Source:HGNC Symbol;Acc:HGNC:15740])

HSP 1 Score: 209.149 bits (531), Expect = 5.843e-61
Identity = 130/393 (33.08%), Postives = 210/393 (53.44%), Query Frame = 2
Query:  383 KIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQI-EEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            +I K S++  ++ +   F + P   N  + V+V   + +   + L  + + Y  TI + Q L+D E  E +    Q   R+ +N ++ AY   + I  E         + A+ VK G ++ENR ++++K S    +  P VWL+ GIH+REWI+ ++A++   K++    R+ + T  IL K   +++P+ NPDGY Y+   +RLWRK RSR   S CIG D NRN+   + G  +S NPC + Y GP+A SE E++S++  + K+ +  K  + LH++ Q ++ P+G+S +  P +  ++  VA  AA  L +     Y VG     +YPASGSS D+      I F+FT EL D G +GF LP   I     + W  + T+   + R  LY
Sbjct:   36 EISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQE--RSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAIT-SILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN-FKGFIDLHSYSQLLMYPYGYSVKKAP-DAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHV-RDNLY 421          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA2 (carboxypeptidase A2 [Source:HGNC Symbol;Acc:HGNC:2297])

HSP 1 Score: 207.608 bits (527), Expect = 2.003e-60
Identity = 125/412 (30.34%), Postives = 210/412 (50.97%), Query Frame = 2
Query:  284 ALISVLFLGFISSFRYD-----GFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSE---TWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            A+  +LF G +    Y      G  V++I P    +  +I+   ++   + +   F + P  P     V V     + +   L  + I+Y   I + Q L+D+E   N + +F        N +  AY   ++I + +   V +       V  G ++ENR + ++K S     P +WLD GIHAREW+  ++AL+  +K++ +  +      IL     +++P+ NPDGY +S   +R+WRK RS+ + S C+GVD NRN+   +GG  +S NPC D Y GP+A SE E++SI+ +  K   ++K  ++LH++ Q ++ P+G+       ++ +++ VA  AA  L++ H   Y VG    ++Y ASG S D+      I +SF  EL D G +GF LP + I     + W
Sbjct:    2 AMRLILFFGALFGHIYCLETFVGDQVLEIVPS---NEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKE---NEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIV-DFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLD-DFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSY-DYGIKYSFAFELRDTGRYGFLLPARQILPTAEETW 404          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPO (carboxypeptidase O [Source:HGNC Symbol;Acc:HGNC:21011])

HSP 1 Score: 191.43 bits (485), Expect = 8.076e-55
Identity = 116/328 (35.37%), Postives = 178/328 (54.27%), Query Frame = 2
Query:  572 DREFAENRQAIFQSLFRTGS--NSDHIAYLRYQQIEEW---IKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLP--IVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIY 1525
            DR  A++RQ I        S     +  Y    +I EW   I EK + V    F+  G TYE   ++ +K+S+    P  I+W+D GIHAREWIA +   + + ++L+N   +S   ++L    FYV+P++N DGY Y+  T RLWRK+RS      C G D+NRNF   W    +S N  D  + G    SE E +++ S +   KD I   +++H++GQ IL P+G++ ++   N+ +M  V   AA  L+ K+   Y VG   DILY +SGSS D+    + IPFS+T EL D G +GF LP   I+    +  + ++++  ++Y
Sbjct:   22 DRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFL--GVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYT-KNKSSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGSSRDWAR-DIGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDVY 345          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA4 (carboxypeptidase A4 [Source:HGNC Symbol;Acc:HGNC:15740])

HSP 1 Score: 191.43 bits (485), Expect = 1.211e-54
Identity = 125/392 (31.89%), Postives = 198/392 (50.51%), Query Frame = 2
Query:  383 KIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            +I K S++  ++ +   F + P   N  + V+V   + +   + L  + + Y  TI + Q  I  E  +N  A F  L                               A+ VK G ++ENR ++++K S    +  P VWL+ GIH+REWI+ ++A++   K++    R+ + T  IL K   +++P+ NPDGY Y+   +RLWRK RSR   S CIG D NRN+   + G  +S NPC + Y GP+A SE E++S++  + K+ +  K  + LH++ Q ++ P+G+S +  P +  ++  VA  AA  L +     Y VG     +YPASGSS D+      I F+FT EL D G +GF LP   I     + W  + T+   + R  LY
Sbjct:   36 EISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQ--IYHEM-DNIAADFPDL-------------------------------ARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAIT-SILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN-FKGFIDLHSYSQLLMYPYGYSVKKAP-DAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHV-RDNLY 388          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA1 (carboxypeptidase A1 [Source:HGNC Symbol;Acc:HGNC:2296])

HSP 1 Score: 191.43 bits (485), Expect = 2.157e-54
Identity = 119/385 (30.91%), Postives = 203/385 (52.73%), Query Frame = 2
Query:  374 DVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDS-LPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWE---ILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYP-LNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            D ++++K  ++ + + +   F R P  P S I V V   + + +   L    ISY T I + Q+L+D E  + +   F+S  R+    ++  Y   ++I +++   V +  +    ++ G TYE R ++++K S   S  P +W+D GIH+REW+  +S ++   K+ ++  +      IL     ++  + NPDG+ ++H T+R+WRK RS    S CIGVD NRN+   +G + +S NPC + Y G  A SE E++SI+ +  K    IK  +S+H++ Q ++ P+G+  E  P  + LD  S A   A  L + +   +  G     +Y ASGS+ D+   +  I +SFT EL D G +GF LP   I     + W  ++T+
Sbjct:   32 DEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEE--QEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIV-DFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTA--LASLYGTKFNYGSIIKAIYQASGSTIDWTY-SQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTI 410          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.1 (pep chromosome:WBcel235:I:770892:776369:1 gene:WBGene00020281.1 transcript:T06A4.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.1)

HSP 1 Score: 210.305 bits (534), Expect = 4.177e-60
Identity = 140/442 (31.67%), Postives = 223/442 (50.45%), Query Frame = 2
Query:  287 LISVLFLGFISSFR-------YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKE----KVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPI-----VWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRS-----RFTFSK--CIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNY-LDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQGM--HGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            LI   F GF+ +         Y  F +I I P+    V  +R   +  +       F +PP    + + + V+P    + +  L  + ISYI  + +    I+ E   ++     + F         AY +Y  +EE   E    K +       +  G+++ENR L ++K++   + P+     +W+D GIHAREWIA ++A++I  +LL    N +   +++    FY++P++NPDGYEYS E +R+WRKNRS     R TFS   C GVD+NRNF + W    SS +PC D Y G  A SE E Q++   L   ++  +  +SLH++ Q  L P+G   + YP +Y   +  +A+ A   L   +   Y VG   D++Y ASG S D+  G LK+P+++ +EL P   M  HGF LP + I   G + ++ I  +  E+
Sbjct:    8 LIFGAFFGFLGAIHNTDDNAGYHNFKLIRINPETEGSVKYLRSLYE--DPSPYELDFWQPPTNIGAIVDLTVAPADAPRFVKDLESKKISYIVAVNDLSKAIENERGSDKFYNPVAGF---------AYDKYNSLEEIQTEMKRLKKEYPTMITLIDIGQSHENRTLLVMKITGKRN-PLGSKISMWIDAGIHAREWIAPATAMYIAHELLLGYENDATVAKLMDHIDFYILPVMNPDGYEYSREKNRMWRKNRSPAKCARQTFSTVCCSGVDLNRNFDWFWASTGSSSDPCHDTYHGSAAFSEPESQAVRDFLE--QNTPEAFISLHSYSQMWLIPYGHRKQSYPQDYHTGLRPLALRATKALYELYGTKYQVGTGADLMYEASGGSHDWAKGQLKVPYAYLIELRPKNTMMGHGFLLPEREIVPTGLETFESIKVVADEL 435          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.3 (pep chromosome:WBcel235:I:763625:768917:1 gene:WBGene00020283.1 transcript:T06A4.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.3)

HSP 1 Score: 201.445 bits (511), Expect = 3.673e-58
Identity = 138/435 (31.72%), Postives = 224/435 (51.49%), Query Frame = 2
Query:  296 VLFLGFIS-SFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDR-EFAENRQAIFQSLFRTGSNS--DHIAYLRYQQIEEWIKEKVQGVNYAKFVKF---GETYENRKLFMVKLSKND-SLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETW--EILSKYQFYVVPLVNPDGYEYSHETH----RLWRKNRSRFTFSK--------CIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISEL--TKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQ-GMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            ++FL F + S     F+V  + P+   D   I++  K   + +++F   +     +    V+V     +  L  L    ISYI TI + + LI + E  +    +F  L+   S++  D   Y  YQ++ +W+K+ V  V Y K V++   G+T E R +  V++  +  +  I W+DGGIHAREW A  +ALF I +L   ++E    ++L++  F VVP +NPDGYE++  +     RLWRKNRS+    K        C GVD+NRNF F +  + +S +PC + Y+GP+  SE E +++   L   +YK R    ++LH + Q  + P+G   + YP +  D+  V   AA  L+  +   Y+VG   D LYPASG S+D+     K+ F + +EL PD+    GF L  K +     + W+ +  +   +
Sbjct:    8 LIFLCFSAVSLSTQSFAVYRLLPKSQTDFQAIQRLYKNATDHDLNFW--KTGKDKHGFWDVMVDMKNSKYFLDFLQVNDISYIKTIDDVEGLITKHENNKTLSNMFPRLWDDSSSAHYDFHTYGSYQRMTDWMKQLV--VKYPKMVQYISIGKTTEGRNIDGVEIGGDSRTKKIFWIDGGIHAREWAAPHTALFFIHQLTSRANEPGIKKLLNEITFVVVPCLNPDGYEFTRSSTNPHVRLWRKNRSKMQCRKDIWGRNRCCRGVDLNRNFDFHFRESGTSDDPCSEIYQGPSPFSEPEAKAVRDALLSQRYKGRTDAYITLHTYSQIWIHPYGHKKDAYPGDIKDLYEVGKKAAQALKRVYGTKYVVGSGADTLYPASGGSEDWAKHEAKVKFVYLLELRPDEKNWDGFILDEKELIPTARETWEGVRVVAEAV 438          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: F02D8.4 (pep chromosome:WBcel235:V:14984893:14987571:1 gene:WBGene00008521.1 transcript:F02D8.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F02D8.4)

HSP 1 Score: 200.675 bits (509), Expect = 5.345e-58
Identity = 119/358 (33.24%), Postives = 189/358 (52.79%), Query Frame = 2
Query:  488 WAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFR-------TGSNSDHIAYLRYQQIEEWIK----EKVQGVNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            W +++    ++++S+  +       NL D     + + +   +F+        G+ S H    RY   +E +K       Q  N  K    G +YE R +  V+++ +  S PIVW+D GIHAREWI+ + AL++I  ++   +    +L   Q  VVP  NPDGYEYS    R+WRK RSRFT S+C G D NRN+PF WG    S + C + + G    SE E+ ++ + + + ++RIK  ++LH++GQ IL P+G +   YP +  D+  V  + A  ++  ++  Y V    D LYPA+G+SDD+   +  I +S+T+EL P     GF+LP   I  V  + +  I  L  E+
Sbjct:   60 WKQKQAHYFIDKDSVEKVKI-----NLADNNITYHMRDVNPQIFKVRRRRDLNGAVSIHDVNTRYLSYDEQMKFLNSLAQQYPNDVKLQNIGNSYEGRSITAVRIADDGSSKPIVWIDAGIHAREWISYNVALYLIYTIVSQPAYR-NLLDSVQLVVVPNTNPDGYEYSRTNDRMWRKTRSRFTNSRCAGADANRNYPFYWGTQGVSHSQCSEIFCGSRPQSEPEVLALTNAIIRDEERIKGYIALHSYGQEILYPWGHTQRTYPTDVQDLIQVGRAMASAIRAVNNTDYTVVNSGDGLYPAAGASDDW-AKSRGIKYSYTIELSPIDDFTGFSLPEDRINQVCREAFQAIQVLMIEV 410          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: F02D8.4 (pep chromosome:WBcel235:V:14984909:14987571:1 gene:WBGene00008521.1 transcript:F02D8.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F02D8.4)

HSP 1 Score: 200.675 bits (509), Expect = 5.345e-58
Identity = 119/358 (33.24%), Postives = 189/358 (52.79%), Query Frame = 2
Query:  488 WAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFR-------TGSNSDHIAYLRYQQIEEWIK----EKVQGVNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            W +++    ++++S+  +       NL D     + + +   +F+        G+ S H    RY   +E +K       Q  N  K    G +YE R +  V+++ +  S PIVW+D GIHAREWI+ + AL++I  ++   +    +L   Q  VVP  NPDGYEYS    R+WRK RSRFT S+C G D NRN+PF WG    S + C + + G    SE E+ ++ + + + ++RIK  ++LH++GQ IL P+G +   YP +  D+  V  + A  ++  ++  Y V    D LYPA+G+SDD+   +  I +S+T+EL P     GF+LP   I  V  + +  I  L  E+
Sbjct:   60 WKQKQAHYFIDKDSVEKVKI-----NLADNNITYHMRDVNPQIFKVRRRRDLNGAVSIHDVNTRYLSYDEQMKFLNSLAQQYPNDVKLQNIGNSYEGRSITAVRIADDGSSKPIVWIDAGIHAREWISYNVALYLIYTIVSQPAYR-NLLDSVQLVVVPNTNPDGYEYSRTNDRMWRKTRSRFTNSRCAGADANRNYPFYWGTQGVSHSQCSEIFCGSRPQSEPEVLALTNAIIRDEERIKGYIALHSYGQEILYPWGHTQRTYPTDVQDLIQVGRAMASAIRAVNNTDYTVVNSGDGLYPAAGASDDW-AKSRGIKYSYTIELSPIDDFTGFSLPEDRINQVCREAFQAIQVLMIEV 410          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.3 (pep chromosome:WBcel235:I:763597:770720:1 gene:WBGene00020283.1 transcript:T06A4.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.3)

HSP 1 Score: 201.445 bits (511), Expect = 1.232e-57
Identity = 139/437 (31.81%), Postives = 225/437 (51.49%), Query Frame = 2
Query:  296 VLFLGFIS-SFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAI---FQSLFRTGSNS--DHIAYLRYQQIEEWIKEKVQGVNYAKFVKF---GETYENRKLFMVKLSKND-SLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETW--EILSKYQFYVVPLVNPDGYEYSHETH----RLWRKNRSRFTFSK--------CIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISEL--TKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQ-GMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            ++FL F + S     F+V  + P+   D   I++  K   + +++F   +     +    V+V     +  L  L    ISYI TI + + LI +   EN + +   F  L+   S++  D   Y  YQ++ +W+K+ V  V Y K V++   G+T E R +  V++  +  +  I W+DGGIHAREW A  +ALF I +L   ++E    ++L++  F VVP +NPDGYE++  +     RLWRKNRS+    K        C GVD+NRNF F +  + +S +PC + Y+GP+  SE E +++   L   +YK R    ++LH + Q  + P+G   + YP +  D+  V   AA  L+  +   Y+VG   D LYPASG S+D+     K+ F + +EL PD+    GF L  K +     + W+ +  +   +
Sbjct:    8 LIFLCFSAVSLSTQSFAVYRLLPKSQTDFQAIQRLYKNATDHDLNFW--KTGKDKHGFWDVMVDMKNSKYFLDFLQVNDISYIKTIDDVEGLITKH--ENNKTLSNMFPRLWDDSSSAHYDFHTYGSYQRMTDWMKQLV--VKYPKMVQYISIGKTTEGRNIDGVEIGGDSRTKKIFWIDGGIHAREWAAPHTALFFIHQLTSRANEPGIKKLLNEITFVVVPCLNPDGYEFTRSSTNPHVRLWRKNRSKMQCRKDIWGRNRCCRGVDLNRNFDFHFRESGTSDDPCSEIYQGPSPFSEPEAKAVRDALLSQRYKGRTDAYITLHTYSQIWIHPYGHKKDAYPGDIKDLYEVGKKAAQALKRVYGTKYVVGSGADTLYPASGGSEDWAKHEAKVKFVYLLELRPDEKNWDGFILDEKELIPTARETWEGVRVVAEAV 438          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG8560 (gene:FBgn0035781 transcript:FBtr0332725)

HSP 1 Score: 213.001 bits (541), Expect = 8.634e-63
Identity = 127/402 (31.59%), Postives = 204/402 (50.75%), Query Frame = 2
Query:  329 YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKF-GETYENRKLFMVKLSKNDSLP---IVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            YDG+ + DI  +   +   + + S        ++ F   P   +++  V+V P  +E    LL +  ++Y     N+   + +E  EN+     +L     +    A+ R+ +I  ++ E          V+  G++YENR +  + ++  D      +V+LD GIHAREWIA + AL++I +L+ N +   E+L  + + ++P+VNPDGYEYSH T R+WRK R   + S C G D NRNF F WG   +S   C D ++G  A SE E Q I   L     R K  ++LH++G Y+L P+G+++   P ++ D   VA   A  +++     Y VG   ++LY A+G SDD+  G    P S T+ELP  G  GF      I+   S+ W  I  +  ++
Sbjct:   21 YDGYKIYDINARNAFEKQLLLRLSG-----NEAYDFFDLPRSLDASSRVMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRHAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALYVIHQLVENFAANSELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPIS-SACYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSA-LPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYAFGVANFPVSITMELPAGGT-GFNPSTSQIEGFVSETWVGIKAMAQKV 414          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG8560 (gene:FBgn0035781 transcript:FBtr0076868)

HSP 1 Score: 213.001 bits (541), Expect = 8.634e-63
Identity = 127/402 (31.59%), Postives = 204/402 (50.75%), Query Frame = 2
Query:  329 YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKF-GETYENRKLFMVKLSKNDSLP---IVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            YDG+ + DI  +   +   + + S        ++ F   P   +++  V+V P  +E    LL +  ++Y     N+   + +E  EN+     +L     +    A+ R+ +I  ++ E          V+  G++YENR +  + ++  D      +V+LD GIHAREWIA + AL++I +L+ N +   E+L  + + ++P+VNPDGYEYSH T R+WRK R   + S C G D NRNF F WG   +S   C D ++G  A SE E Q I   L     R K  ++LH++G Y+L P+G+++   P ++ D   VA   A  +++     Y VG   ++LY A+G SDD+  G    P S T+ELP  G  GF      I+   S+ W  I  +  ++
Sbjct:   21 YDGYKIYDINARNAFEKQLLLRLSG-----NEAYDFFDLPRSLDASSRVMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRHAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALYVIHQLVENFAANSELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPIS-SACYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSA-LPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYAFGVANFPVSITMELPAGGT-GFNPSTSQIEGFVSETWVGIKAMAQKV 414          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG12374 (gene:FBgn0033774 transcript:FBtr0087854)

HSP 1 Score: 208.379 bits (529), Expect = 5.200e-61
Identity = 131/427 (30.68%), Postives = 217/427 (50.82%), Query Frame = 2
Query:  230 KLPRIIFLMVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSK-YQFYVVPLVNPDGYEYSHETHRLWRKNRS----RFTFSKCIGVDMNRNFPFEWGGAS-SSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDR-IKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQL 1489
            KLP ++  +V+M  +           G +++ RYD F +  +  +    + +++K      ++ IS  F+       +  +VIV P     L   L    I Y   + + Q LID           +S     S  +   Y     I +WI ++    ++ +    G++YE R +  ++LSK      ++L+G IHA EWI++++  F++++L+ +     + LS+ Y + VVP+VNPDG+ Y+HE  RLWRKNR     R     C G+DMNRNF + WGGA  +   PCD  + G    +E EI S+ + ++ ++D  I+  ++ HA+GQY+L P+G SN  +P NY  M  +A + +      + + +  G    + Y  SG++ D+  G  KIPF+ TVEL D+G  GF LP   I  VG ++
Sbjct:    2 KLPILLITLVAMVAAKSAP-------GRMAA-RYDHFRIYQLTIETNLQMEELKKI-----HEHISVHFLNELGAVGNKYNVIVGPLFHRALEKTLKFLEIVYEVIVDDLQKLID-----------ESSVGDDSQMEWETYHTLDTIYDWIDQECAAHDFLECKVIGQSYEGRDIKSIRLSKRSGNKAIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEV 404          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG18585 (gene:FBgn0031929 transcript:FBtr0335489)

HSP 1 Score: 207.608 bits (527), Expect = 1.160e-60
Identity = 127/417 (30.46%), Postives = 215/417 (51.56%), Query Frame = 2
Query:  239 RIIFLMVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRY---QQIEEWIKEKVQGV-NYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNS-SETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEW-GGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQT-KHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYI 1468
            R+++L+ ++      AL S   L      RYD F V  +  Q    ++ I K  ++ +   I  ++       +  I ++VSP        LL   +IS    I N Q  ID E                ++S    + +Y   ++IE W+ E +    +  +    G++YE R +  +K+S     P ++++  IHAREWI ++SA + I++LL +  ++   +   Y ++++P+ N DG+EYSH+  R+WRK R     + CIG D NRNF   W     +S NPC + + G N  SE E ++++  LTK +D+I + +S H++GQY+L P+G +NE +P NY D+ ++  + A  ++   +  +Y  G   D+LY A+G+S D+V   L     +T+E  D+G +GF LPP  I
Sbjct:    2 RLLWLLATL-----VALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDER----SRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEE-----------QVTPTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQI 398          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG18585 (gene:FBgn0031929 transcript:FBtr0079516)

HSP 1 Score: 207.608 bits (527), Expect = 1.160e-60
Identity = 127/417 (30.46%), Postives = 215/417 (51.56%), Query Frame = 2
Query:  239 RIIFLMVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRY---QQIEEWIKEKVQGV-NYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNS-SETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEW-GGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQT-KHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYI 1468
            R+++L+ ++      AL S   L      RYD F V  +  Q    ++ I K  ++ +   I  ++       +  I ++VSP        LL   +IS    I N Q  ID E                ++S    + +Y   ++IE W+ E +    +  +    G++YE R +  +K+S     P ++++  IHAREWI ++SA + I++LL +  ++   +   Y ++++P+ N DG+EYSH+  R+WRK R     + CIG D NRNF   W     +S NPC + + G N  SE E ++++  LTK +D+I + +S H++GQY+L P+G +NE +P NY D+ ++  + A  ++   +  +Y  G   D+LY A+G+S D+V   L     +T+E  D+G +GF LPP  I
Sbjct:    2 RLLWLLATL-----VALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDER----SRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEE-----------QVTPTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQI 398          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpa2 (carboxypeptidase A2 (pancreatic) [Source:ZFIN;Acc:ZDB-GENE-040801-182])

HSP 1 Score: 199.519 bits (506), Expect = 1.563e-57
Identity = 131/414 (31.64%), Postives = 207/414 (50.00%), Query Frame = 2
Query:  281 CALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQG-VNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHET----HRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            C  + VL +       ++G  V+ I  +    +  +++  K     +    F    +     + V V   +   +   L E +IS+   I N Q L+DRE AE        + R   + +  AY     I  ++   V    N    VK G TYENR ++++K S   ++ P +W+D GIHAREW++ +SA++I D++      N +    +LSK   Y++ + NPDGY +SH T    HRLWRK+RS  +   C GVD+NRNF  E+ G  +S +PC + YRGP+A SE E+ +I   +  + +  K  ++LHA+ Q ++ P+G++  + P +  D+  VA  A   L + H  +Y VG     +  ASG+S D+      I + F  EL D G +GF LP   I S   + W
Sbjct:    4 CIAVFVLLVAVHCEELFNGDQVLRIHAESKDHIQVLKELEK-----DSGLDFWTHGFSTERPVDVRVPHASLYAVKDFLKENNISFSVMINNVQELLDRERAE--MVSNTEMERNTKSFNFAAYHDLDTIYSFMDTLVASHSNLISKVKIGSTYENRPMYVLKFSTGGENKPAIWIDAGIHAREWVSHASAVWIADRIATDFKENRALARNVLSKMDIYLMIVANPDGYVFSHLTVRPFHRLWRKSRSVTSNPNCPGVDLNRNFDAEFSGPGASDDPCAEDYRGPSAHSEIEVTNIADFILSHGN-FKSFMTLHAYSQLLMYPYGYTGSNAP-DQPDLHDVATQANKALNSWHGTIYKVGSIFHTIEQASGASVDWAYQH-GIKYCFAFELRDTGEYGFLLPADQIVSTARETW 407          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpa6 (carboxypeptidase A6 [Source:ZFIN;Acc:ZDB-GENE-091204-331])

HSP 1 Score: 195.282 bits (495), Expect = 9.579e-56
Identity = 131/435 (30.11%), Postives = 214/435 (49.20%), Query Frame = 2
Query:  278 GCALISVLFLGFISSF----RYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPP----YRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDRE--FAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNY-AKFVKFGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTA 1534
            GC LI       + S+    RY G  V  I P    +V  +++   +F+N  ++    +P      R NS+I V V       L   L++E I Y   I N Q  I+++  +  +R+       R+    D+  Y   ++I+ W+ E  +  ++       G++YE R L++++L K        VW+D G+HAREWI  +   + + + L   ++ S    ++++  FY++P+ N DGY YS +  R WRK RS+     C GVD NRN+  +W    +S +PCDD Y GP   SE E++++   L K+K R+K  +S+HA+ Q +L P+ +     P N+  + S A +A   L + +   Y  G     LY +SGSS D+      IP++F  EL D G +GF LP   I    ++    + T+ S + R  
Sbjct:   19 GCVLILCTAPNNVDSYLYNNRYVGDQVFRIIPSSKPEVQAVKQ---LFQN--LTVDLWQPNSASLIRENSSIDVHVRRDKTHWLRNHLHQEHIYYEVLISNLQTEIEKQTGYRSSRKR------RSELQYDYEVYHPLEEIQSWMFEMNRTHSHLVDLFSIGQSYEGRPLYVLQLGKRTRFFKKAVWIDCGVHAREWIGPAFCQWFVKEALNSYQHDSSMRRLMNQLNFYIMPVFNVDGYHYSWKMDRFWRKTRSKIPKYHCRGVDANRNWKVKWCDEGASLHPCDDTYCGPFPESEPEVKAVAKFLRKHKKRVKAYISMHAYAQMLLYPYSYKYATIP-NFNCVESAAQNAVSALYSAYGVRYRYGPASSTLYVSSGSSMDWAYKN-GIPYAFAFELRDTGYYGFLLPEALINPTCTETMRAVKTIASGLLRKC 440          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpo (carboxypeptidase O [Source:NCBI gene;Acc:100005630])

HSP 1 Score: 190.66 bits (483), Expect = 7.292e-55
Identity = 104/305 (34.10%), Postives = 169/305 (55.41%), Query Frame = 2
Query:  638 DHIAYLRYQQIEEWIKE-KVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLP--IVWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYS--HETHRLWRKNRS-RFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIY 1525
            D+  Y    +I  W+ + + +  +    + +G+TYE R + ++K+  + + P   +W+D GIHAREWIA +     + ++L   +  S    +     FY+ P++N DGY YS  + + RLWRK+RS     S C G D+NRNF   WG    S N C + Y G  A SE E +++   L  +++ +   +++H++GQ IL P+G  N   P NY ++  V ++AA  ++  H   Y VG  PD+LYP SGSS DF    + IP+SFT EL D+G HGF LP   I+    + ++  +++ + ++
Sbjct:   31 DYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCHENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLCYLTIHSYGQLILVPYGHPNISAP-NYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDF-ARLIGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAYEGAMSIINYVH 333          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpa1 (carboxypeptidase A1 (pancreatic) [Source:ZFIN;Acc:ZDB-GENE-050522-438])

HSP 1 Score: 189.889 bits (481), Expect = 5.861e-54
Identity = 115/419 (27.45%), Postives = 208/419 (49.64%), Query Frame = 2
Query:  278 GCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSET---WEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            G  +++ LF+       ++G  V+ I  +  + +S +++ +   E D +   F   P R +  + + V   + + +   L    I Y   I N Q+L+D E  + +   ++   R+  +  +  Y     I  ++   V +  N    ++ G++YENR L ++K S   + P +W+D G+H+REWI  +S ++   K++ +        +IL+ Y  ++  + NPDG  Y+H   R+WRK R     S C+GVD NRN+   +GG  SS NPC   Y GP+  SE E+++I+ E  K    +K  +S+H++ Q +L P+G++ +    +  ++  +A  A  +LQ+ ++  Y  G     +Y A G + D+      I +S+T EL D G +GF LP   I     + W  ++ +   I
Sbjct:    3 GLLVLTALFVAVFGKVTFEGDQVLRINAKNAEQISLLKELT---EADLLGLDFWMTPARESLPVDLHVPFHSLQAVRAFLAYNQIPYHIMIENVQDLVDEE--QLQMLKYRGFPRSTDDFVYTTYHDLDSINSFMDMLVAENQNMVSKIEIGQSYENRPLNVLKFSTGANRPGIWIDTGLHSREWITHASGIWFAKKIVTDYGRDPVLTDILNSYDIFLEIVANPDGLAYTHSDDRMWRKTRKPNPGSSCVGVDPNRNWETGFGGPGSSSNPCSQTYHGPSIHSEPEVKAIV-EFVKSHGNLKAFLSIHSYSQMLLYPYGYT-QTAAKDQAELHELARKATSELQSLYNTAYTYGSIITTIYQADGVTTDWAYEQ-GIKYSYTFELRDTGRYGFILPADQILPTAEETWLALMVIMEHI 413          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpb2 (carboxypeptidase B2 (plasma) [Source:ZFIN;Acc:ZDB-GENE-050522-259])

HSP 1 Score: 188.734 bits (478), Expect = 1.522e-53
Identity = 124/412 (30.10%), Postives = 206/412 (50.00%), Query Frame = 2
Query:  293 SVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPY-RPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSN---SDHIAYLRYQQIEE---WI-KEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPI---VWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQ 1486
            S+     +   ++D    I ++ Q  + V K++  +    N+   +Q   P Y   NS + + +   + + +   L E +I++            R   EN  A+     R  ++   S  + Y RY  +E+   WI K   +  +  K +  G + E R L+++KLS      +   +W+D GIHAREWIA +  ++ ++  L     ++E  E+L+K   Y++ ++NPDGY+Y+  T R+WRKNRS    S C GVD+NRNF   W    +S +PCD  Y G    SE E Q++   L  +KD +KL +S+H++ Q +L P+  S    P N+ ++  +   A+  ++  +   Y  G     +Y A G SDD+    L I +SFT EL D+G +GF LPP +I    ++
Sbjct:   14 SIFLETCLCKVKHDQVLAITVSSQ--EHVEKVQNLTS--HNETALWQPASPNYITTNSEVHLYIQSTSVQFVKEHLREHAITF------------RVLVENTAALVAMQIRNDTSDPRSGGVFYERYHSLEDIYYWINKTSREHSDMVKVILIGSSSEKRPLYVLKLSGKREEEVNRAMWMDCGIHAREWIAPAFCMWFVNYALAFYNQNTEITEMLNKMDIYILTVMNPDGYKYTWTTDRMWRKNRSENKDSYCAGVDLNRNFDANWCTKGASDDPCDPTYCGQFPESEPETQAVAKFLRSHKDTVKLYLSIHSYSQMLLFPYSCSYNEIP-NHNELFELVKEASTKIRRYYRNNYKYGSGAKTIYLAPGGSDDWAYD-LGIKYSFTFELQDRGQYGFLLPPSFIPQACNE 407          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:595005])

HSP 1 Score: 195.282 bits (495), Expect = 7.060e-56
Identity = 114/337 (33.83%), Postives = 192/337 (56.97%), Query Frame = 2
Query:  515 LNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIA--YLRYQQIEE---WIKEKVQG-VNYAKFVKFGETYENRKLFMVKLSKNDSLP--IVWLDGGIHAREWIATSSALFIIDKLLR----NSSETWEILSKYQFYVVPLVNPDGYEYS-HETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQ 1486
            LNE SI Y+  + N Q LI+           Q  F   SN       Y +Y  +E+   W++  V+   +  + +  G ++ENR L+++K+S  +      VW+D GIHAREWI+ +  L+ +   +     + S T ++L    FY++P++N DGY++S    +R+WRKNRS++T S CIG D+NRNF   W G  +S +PC + Y GP A SE E+ +++S L K+++ +K  +++H++ Q +L P+ ++N+    ++ ++  ++   A  +++     Y+ G   + +Y A G SDD+    L I +SFT EL D+GM+GF LPP+ IK   S+
Sbjct:   83 LNESSILYMVLVNNAQELIE-----------QQTFNDTSNQRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSFENRPLYVLKVSGKEKTAKHAVWIDCGIHAREWISPAFCLWFVGHAVEYYGVDLSMT-KLLRYLDFYILPVMNADGYQFSWTAKNRMWRKNRSKYTKSNCIGTDLNRNFDAGWCGPGASSDPCHEIYCGPYAESEPEVSAVVSFLKKHQNVVKGYITVHSYSQMVLFPYSYTNKK-SKDHDELLLLSKKVAEGIRSTSRNKYMYGAGAETIYLAPGGSDDWAYD-LGIKYSFTFELRDKGMYGFLLPPQLIKPTCSE 405          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: pex6 (peroxisomal biogenesis factor 6 [Source:Xenbase;Acc:XB-GENE-6049481])

HSP 1 Score: 188.348 bits (477), Expect = 1.076e-53
Identity = 115/346 (33.24%), Postives = 178/346 (51.45%), Query Frame = 2
Query:  515 LNEESISYITTIGNYQNLIDREFAEN--RQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVK---FGETYENRKLFMVKLS--KNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSET---WEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            L++ SI +   I + Q LID     +  RQ    + F      D+  Y    +I +W+ +  +   Y+  V     G TYE R ++  K+    +    I+W+D GIHAREWIA +   + + ++L          ++L    FY+VP++N DG+ YS   +RLWRK+RS      C GVD+NRNF  +WG   +S N  D+ Y G    SE E+ ++   L   K  +   +++H++GQ +L P+G++ +   +N+ +M +VA  AA  LQ KH   Y VG    +LY  SGSS D+    L I FS+T EL D G HGF LP   I+    +    ++T+   +
Sbjct:   17 LHQYSIPFEVMIKDVQKLIDSSNVGDYRRQKKILAEF------DYTTYHPMDEIYQWMDQVKEA--YSDLVSMHYLGSTYELRPIYYFKIGWPSDKQKKIIWMDCGIHAREWIAVAYCQWFVKEILETHKTNPLLQKVLHNIDFYIVPVLNIDGFVYSWNVNRLWRKSRSPHNNGSCYGVDLNRNFNSKWGSIGASNNCRDETYCGTGPASEPEVNAVSKLLGSLKSDVLCFLTIHSYGQLLLLPYGYTKDP-SINHEEMINVAQKAAAKLQEKHGTEYRVGSTSHLLYSNSGSSRDWAT-DLGINFSYTFELRDTGAHGFILPANQIRPTCEETMAGVMTIVEHV 352          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: kpna1 (karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-1014184])

HSP 1 Score: 189.504 bits (480), Expect = 1.256e-53
Identity = 126/410 (30.73%), Postives = 209/410 (50.98%), Query Frame = 2
Query:  329 YDGFSVIDIAPQRFQDVSKIRKFSKIFENDE-ISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            + G  V+ I P     V+ +R      E++E +   F   P R    I + V     + +   L   SI Y   I + QNL+D E  + R+       R+ ++ ++ AY  + +I  +I   V +  N    ++ G +YE R L ++K S   + P  W+D GIH+REW+  +SA++   K++    ++ S T   L++    +  + NPDG+ Y+H++ R+WRK RS  + S C+G D NRN+   +GG  SS NPC + YRG  A SE E+++I+ +  K    IK  VS+H++ Q +L P+G++N   P ++ ++ +V+  A   L + +   Y  G     +Y ASG + D+      I  S++ EL D G +GF LP   I     + W + +T+  E  R  LY
Sbjct:   20 FSGQQVLRIFPSDEAQVNLVRAL----EDEEYLQLDFWTSPSRVLLPIDIRVPLHHLQSVKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLT-NTLNQMDILIEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIV-DFVKSHGNIKGFVSIHSYSQMLLFPYGYTNTRVP-DHDELNAVSKKAITALASLYGTAYTYGSIISTIYQASGGTIDWTYNQ-GIKHSYSFELRDTGRYGFALPANQIIPTAEETW-LALTILIEHTRDNLY 420          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: kpna1 (karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-1014184])

HSP 1 Score: 187.963 bits (476), Expect = 2.320e-53
Identity = 124/400 (31.00%), Postives = 202/400 (50.50%), Query Frame = 2
Query:  392 KFSKIFENDEISF------------QFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            KF +IF +DE                F   P R    I + V     + +   L   SI Y   I + QNL+D E  + R+       R+ ++ ++ AY  + +I  +I   V +  N    ++ G +YE R L ++K S   + P  W+D GIH+REW+  +SA++   K++    ++ S T   L++    +  + NPDG+ Y+H++ R+WRK RS  + S C+G D NRN+   +GG  SS NPC + YRG  A SE E+++I+ +  K    IK  VS+H++ Q +L P+G++N   P ++ ++ +V+  A   L + +   Y  G     +Y ASG + D+      I  S++ EL D G +GF LP   I     + W + +T+  E  R  LY
Sbjct:    2 KFLRIFPSDEAQLVSHALLLLMLQLDFWTSPSRVLLPIDIRVPLHHLQSVKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLT-NTLNQMDILIEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIV-DFVKSHGNIKGFVSIHSYSQMLLFPYGYTNTRVP-DHDELNAVSKKAITALASLYGTAYTYGSIISTIYQASGGTIDWTYNQ-GIKHSYSFELRDTGRYGFALPANQIIPTAEETW-LALTILIEHTRDNLY 396          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:595005])

HSP 1 Score: 182.956 bits (463), Expect = 1.891e-51
Identity = 113/337 (33.53%), Postives = 179/337 (53.12%), Query Frame = 2
Query:  515 LNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIA--YLRYQQIEE---WIKEKVQG-VNYAKFVKFGETYENRKLFMVKLSKNDSLP--IVWLDGGIHAREWIATSSALFIIDKLLR----NSSETWEILSKYQFYVVPLVNPDGYEYSHET-HRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQ 1486
            LNE SI Y+  + N Q LI+           Q  F   SN       Y +Y  +E+   W++  V+   +  + +  G ++ENR L+++K+S  +      VW+D GIHAREWI+ +  L+ +   +     + S T ++L    FY++P++N DGY++S    +R+WRKNRS++T S CIG D+NRNF   W G  +S +PC + Y GP A SE E+ +++S L K+++ +K  +++H++ Q +L P+ ++N+                       HD L      P       G SDD+    L I +SFT EL D+GM+GF LPP+ IK   S+
Sbjct:   83 LNESSILYMVLVNNAQELIE-----------QQTFNDTSNQRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSFENRPLYVLKVSGKEKTAKHAVWIDCGIHAREWISPAFCLWFVGHAVEYYGVDLSMT-KLLRYLDFYILPVMNADGYQFSWTAKNRMWRKNRSKYTKSNCIGTDLNRNFDAGWCGPGASSDPCHEIYCGPYAESEPEVSAVVSFLKKHQNVVKGYITVHSYSQMVLFPYSYTNKK-------------------SKDHDELIYSDLAP-------GGSDDWAYD-LGIKYSFTFELRDKGMYGFLLPPQLIKPTCSE 380          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa2 (carboxypeptidase A2, pancreatic [Source:MGI Symbol;Acc:MGI:3617840])

HSP 1 Score: 210.305 bits (534), Expect = 1.188e-61
Identity = 127/419 (30.31%), Postives = 215/419 (51.31%), Query Frame = 2
Query:  287 LISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLR----YQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            L+  LF        + G  V+++ P    D  +I+   ++   + +   F + P  P   + V V   + + +   L  + I+Y   I + Q L+D+E     + +F      G+N +  AY      YQ+++  + E    V+    V  G ++ENR + ++K S     P +WLD GIHAREW+  ++AL+  +K+  +         +L+    +++P+ NPDGY +S  ++R+WRK RS+ + S C+GVD NRN+   +GG  +S NPC D Y GP+  SE E++SI+ +  K   ++K  ++LH++ Q ++ P+G+     P ++ ++  VA  AA  L+  H   Y VG    ++Y ASG S D+    L I +SF  EL D G +GF LP K I     + W  + T+   +
Sbjct:    6 LLVALFGYIYCQETFVGDQVLEVIPN---DEEQIKTLLQLEAEEHLELDFWKSPSVPRQTVHVRVPFASIQDVKVFLESQGITYSIMIEDVQVLLDQE---REEMLFNQQRERGTNFNFGAYHTLEEIYQEMDNLVAENPGLVSK---VNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDVFLLPVTNPDGYVFSQTSNRMWRKTRSKRSGSFCVGVDPNRNWDANFGGPGASSNPCSDSYHGPSPNSEVEVKSIV-DFIKSHGKVKAFITLHSYSQLLMFPYGYKCAK-PDDFNELDEVAQRAAQSLKRLHGTSYKVGPICSVIYQASGGSIDWAY-DLGIKYSFAFELRDTGYYGFLLPAKQILPTAEETWLGLKTIMEHV 412          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa4 (carboxypeptidase A4 [Source:MGI Symbol;Acc:MGI:1919041])

HSP 1 Score: 194.126 bits (492), Expect = 1.715e-55
Identity = 120/395 (30.38%), Postives = 204/395 (51.65%), Query Frame = 2
Query:  383 KIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQ-GVNYAKFV---KFGETYENRKLFMVKLSKNDS--LPIVWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            +IRK +++  +D +     + P   +  + ++V   +   + + L  + + Y  TI + Q L+D E  E +    + + R+G       Y  Y  +E    E      ++ + V   K GET+E R ++++K S       P +WL+ GIHAREWI+ ++A++   K++   +       IL K   +++P+ NPDGY Y+   +RLWRK RSR   S+C+G D NRN+   + G  +S NPC + Y G +  SE E++S++  + K+ +  K  + LH++ Q ++ P+G++ +  P +  ++  VA +AA  L +     Y VG     +YPASGSS D+      I ++FT EL D G +GF LP   I     + W  + T+   + R  LY
Sbjct:   36 EIRKLTELVNSDHLKLSVWKSPSTFDRPVDILVPSVSLLPVKSFLKSQGLDYSVTIEDLQALLDNEDEEMQHN--EGIERSGD----FNYGAYHPLEAIYHEMDSIATDFPELVSRVKIGETFEKRPMYVLKFSTGGGKKRPAIWLNAGIHAREWISQATAIWTARKIVTDYKKDPAITSILKKVDIFLLPVANPDGYVYTQSQNRLWRKTRSRNPGSRCVGADPNRNWNASFAGEGTSDNPCSEVYHGSHPNSEVEVKSVVDFIQKHGN-FKCFIDLHSYSQLLMYPYGYTVKKAP-DAEELDDVARNAAQALASLSGTKYRVGPTCTTVYPASGSSVDWAYDN-GIKYAFTFELRDTGYYGFLLPASQIIPTAEETWLGLKTIMEHV-RDHLY 420          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa5 (carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:1921899])

HSP 1 Score: 185.652 bits (470), Expect = 2.850e-52
Identity = 123/418 (29.43%), Postives = 210/418 (50.24%), Query Frame = 2
Query:  293 SVLFLGFI-----SSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQS--LFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKND-SLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETW---EILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            ++LF  FI         + G  V+ +  +  + +S +R              F R P RP+  + + V       +   L    ++Y   I + Q L+D E    R A+ +S  L R+ ++  + +Y    +I  WI   V +  N    +  G+++ENR + ++K S    + P +W+D GIH+REWI  ++ ++I  K++    +      IL+    ++  + NPDG+ ++H  +RLWRKN+S      CIGVD+NRN+   +GG  S+ NPC + YRGP   SE E+ +I+  +T + +  K ++S+H++ Q ++ P+G S E  P N+ ++ ++A  A   L   H   Y+ G     LY ASG S D+   +  I ++F+ EL D G +GF LP   I     + W  + T+
Sbjct:   20 TLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLET---QKPQKVDFWRGPARPSLPVDMRVPFSELPSVKAYLKSHGLAYSIMIKDIQVLLDEE----RDAMAKSRRLERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITGHGN-FKAMISIHSYSQMVMYPYGHSLEPVP-NHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAYDS-GIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTI 427          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa5 (carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:1921899])

HSP 1 Score: 185.652 bits (470), Expect = 2.850e-52
Identity = 123/418 (29.43%), Postives = 210/418 (50.24%), Query Frame = 2
Query:  293 SVLFLGFI-----SSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQS--LFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKND-SLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETW---EILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            ++LF  FI         + G  V+ +  +  + +S +R              F R P RP+  + + V       +   L    ++Y   I + Q L+D E    R A+ +S  L R+ ++  + +Y    +I  WI   V +  N    +  G+++ENR + ++K S    + P +W+D GIH+REWI  ++ ++I  K++    +      IL+    ++  + NPDG+ ++H  +RLWRKN+S      CIGVD+NRN+   +GG  S+ NPC + YRGP   SE E+ +I+  +T + +  K ++S+H++ Q ++ P+G S E  P N+ ++ ++A  A   L   H   Y+ G     LY ASG S D+   +  I ++F+ EL D G +GF LP   I     + W  + T+
Sbjct:   20 TLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLET---QKPQKVDFWRGPARPSLPVDMRVPFSELPSVKAYLKSHGLAYSIMIKDIQVLLDEE----RDAMAKSRRLERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITGHGN-FKAMISIHSYSQMVMYPYGHSLEPVP-NHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAYDS-GIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTI 427          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa1 (carboxypeptidase A1, pancreatic [Source:MGI Symbol;Acc:MGI:88478])

HSP 1 Score: 185.267 bits (469), Expect = 3.204e-52
Identity = 117/384 (30.47%), Postives = 203/384 (52.86%), Query Frame = 2
Query:  374 DVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDS-LPIVWLDGGIHAREWIATSSALFIIDKLLRNSSET---WEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            D ++++K  ++ E + +   F R P R    I V V     + +   L    ISY   I + Q+L+D E  + + + FQ+   +    ++  Y    +I E++   V +       ++ G T+E R + ++K S   +  P +W+D GIH+REW+  +S ++   K+ ++  +      IL     ++  + NPDG+ Y+H+T+R+WRK RS    S C+GVD NRN+   +G   +S NPC + YRG    SE E++SI+  +T + + IK  +S+H++ Q +L P+G+++E  P +  ++  +A SA   L + H   +  G   D +Y ASGS+ D+   +  I +SFT EL D G+ GF LP   I     + W  ++T+
Sbjct:   32 DEAQVQKVRELEELEHLKLDFWRDPARAGLPIDVRVPFPTIQSVKAFLEYHDISYEIMIEDVQSLLDEE--KQQMSAFQARALSTDAFNYATYHTLDEIYEFMDLLVTEHPQLVSKIQIGSTFEGRPINVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLTAILDNMDIFLEIVTNPDGFVYTHKTNRMWRKTRSHTEGSLCVGVDPNRNWDAAFGMPGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGN-IKAFISIHSYSQLLLYPYGYTSEPAP-DKEELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTY-SQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTI 410          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q504N0|CBPA2_MOUSE (Carboxypeptidase A2 OS=Mus musculus OX=10090 GN=Cpa2 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 8.307e-61
Identity = 127/419 (30.31%), Postives = 215/419 (51.31%), Query Frame = 2
Query:  287 LISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLR----YQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            L+  LF        + G  V+++ P    D  +I+   ++   + +   F + P  P   + V V   + + +   L  + I+Y   I + Q L+D+E     + +F      G+N +  AY      YQ+++  + E    V+    V  G ++ENR + ++K S     P +WLD GIHAREW+  ++AL+  +K+  +         +L+    +++P+ NPDGY +S  ++R+WRK RS+ + S C+GVD NRN+   +GG  +S NPC D Y GP+  SE E++SI+ +  K   ++K  ++LH++ Q ++ P+G+     P ++ ++  VA  AA  L+  H   Y VG    ++Y ASG S D+    L I +SF  EL D G +GF LP K I     + W  + T+   +
Sbjct:    6 LLVALFGYIYCQETFVGDQVLEVIPN---DEEQIKTLLQLEAEEHLELDFWKSPSVPRQTVHVRVPFASIQDVKVFLESQGITYSIMIEDVQVLLDQE---REEMLFNQQRERGTNFNFGAYHTLEEIYQEMDNLVAENPGLVSK---VNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDVFLLPVTNPDGYVFSQTSNRMWRKTRSKRSGSFCVGVDPNRNWDANFGGPGASSNPCSDSYHGPSPNSEVEVKSIV-DFIKSHGKVKAFITLHSYSQLLMFPYGYKCAK-PDDFNELDEVAQRAAQSLKRLHGTSYKVGPICSVIYQASGGSIDWAY-DLGIKYSFAFELRDTGYYGFLLPAKQILPTAEETWLGLKTIMEHV 412          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UI42|CBPA4_HUMAN (Carboxypeptidase A4 OS=Homo sapiens OX=9606 GN=CPA4 PE=1 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 2.806e-60
Identity = 130/393 (33.08%), Postives = 210/393 (53.44%), Query Frame = 2
Query:  383 KIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQI-EEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            +I K S++  ++ +   F + P   N  + V+V   + +   + L  + + Y  TI + Q L+D E  E +    Q   R+ +N ++ AY   + I  E         + A+ VK G ++ENR ++++K S    +  P VWL+ GIH+REWI+ ++A++   K++    R+ + T  IL K   +++P+ NPDGY Y+   +RLWRK RSR   S CIG D NRN+   + G  +S NPC + Y GP+A SE E++S++  + K+ +  K  + LH++ Q ++ P+G+S +  P +  ++  VA  AA  L +     Y VG     +YPASGSS D+      I F+FT EL D G +GF LP   I     + W  + T+   + R  LY
Sbjct:   36 EISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQE--RSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAIT-SILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN-FKGFIDLHSYSQLLMYPYGYSVKKAP-DAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHV-RDNLY 421          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q29NC4|CBPA1_DROPS (Zinc carboxypeptidase A 1 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA14587 PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 5.116e-60
Identity = 122/408 (29.90%), Postives = 214/408 (52.45%), Query Frame = 2
Query:  326 RYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEE---WIKE-KVQGVNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSK-YQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL---PDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            RYD + +     +  + ++ +++     E+   S  F+   +   +++ ++V+P     LL +L +  I Y+    + Q  +D         I + +   G   +   + +Y ++++   W++   ++       ++ G+TY+ R +  VK++K+    P ++L+ GIHAREWIA ++A +II++LL +  E  + L++ Y +YV+P  NPDGY Y+H T R+WRK R+   +  C G D NRN+ F W    +S NPC D Y GP+A SE E  S+ + L   K +I+L +SLHA+ QY+L P+G + +  P N  D   V   +   +  ++   Y  G   D +YPA+G+S D+  GT  +  +F  EL    +  + GF LP   I     +L D I+ + +E+
Sbjct:   26 RYDNYRLYKANAENAEQLAVLKQL----ESSSDSILFLDGVHIVGADVKMVVAPHKVPDLLEILGKAEIKYLLQSSDVQKTMDE--------IDEKVAMKGRAGEAYNWAQYYELDDTYAWLQTLAIENPGVVTLIEGGKTYQGRSILGVKITKSGKEKPGIFLEAGIHAREWIAPAAATYIINQLLTSEVEAVKQLAENYTWYVLPHANPDGYVYTHTTDRMWRKTRT--PYQGCFGADPNRNWAFHWNEVGASSNPCSDTYAGPSAFSEIETLSLSNYLASLKGKIQLYISLHAYSQYLLYPYGHTGD-LPDNVADFRKVYDVSIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYELRPSSNSFITGFKLPAAQIVPASEELLDSIVAMAAEV 418          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|P19222|CBPA2_RAT (Carboxypeptidase A2 OS=Rattus norvegicus OX=10116 GN=Cpa2 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.437e-60
Identity = 124/403 (30.77%), Postives = 206/403 (51.12%), Query Frame = 2
Query:  335 GFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLR----YQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            G  V++I P   +   +IR   ++   + +   F + P  P   + V V   + + +   L  + I Y   I + Q L+D+E     + +F      G N +  AY      YQ+++  + E    V+    V  G ++ENR + ++K S     P +WLD GIHAREW+  ++AL+  +K+  +         +L+    +++P+ NPDGY +S  T+R+WRK RS+ + S C+GVD NRN+   +GG  +S +PC D Y GP   SE E++SI+ +  K   ++K  ++LH++ Q ++ P+G+     P ++ ++  VA  AA  L+  H   Y VG    ++Y ASG S D+    L I +SF  EL D   +GF LP K I     + W  + T+   +
Sbjct:   22 GDQVLEIIPSHEE---QIRTLLQLEAEEHLELDFWKSPTIPGETVHVRVPFASIQAVKVFLESQGIDYSIMIEDVQVLLDQE---REEMLFNQQRERGGNFNFEAYHTLEEIYQEMDNLVAENPGLVSK---VNLGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDIFLLPVTNPDGYVFSQTTNRMWRKTRSKRSGSGCVGVDPNRNWDANFGGPGASSSPCSDSYHGPKPNSEVEVKSIV-DFIKSHGKVKAFITLHSYSQLLMFPYGYKCTK-PDDFNELDEVAQKAAQALKRLHGTSYKVGPICSVIYQASGGSIDWAY-DLGIKYSFAFELRDTAFYGFLLPAKQILPTAEETWLGLKTIMEHV 412          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|P48052|CBPA2_HUMAN (Carboxypeptidase A2 OS=Homo sapiens OX=9606 GN=CPA2 PE=1 SV=3)

HSP 1 Score: 207.608 bits (527), Expect = 9.618e-60
Identity = 125/412 (30.34%), Postives = 210/412 (50.97%), Query Frame = 2
Query:  284 ALISVLFLGFISSFRYD-----GFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSE---TWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            A+  +LF G +    Y      G  V++I P    +  +I+   ++   + +   F + P  P     V V     + +   L  + I+Y   I + Q L+D+E   N + +F        N +  AY   ++I + +   V +       V  G ++ENR + ++K S     P +WLD GIHAREW+  ++AL+  +K++ +  +      IL     +++P+ NPDGY +S   +R+WRK RS+ + S C+GVD NRN+   +GG  +S NPC D Y GP+A SE E++SI+ +  K   ++K  ++LH++ Q ++ P+G+       ++ +++ VA  AA  L++ H   Y VG    ++Y ASG S D+      I +SF  EL D G +GF LP + I     + W
Sbjct:    2 AMRLILFFGALFGHIYCLETFVGDQVLEIVPS---NEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKE---NEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIV-DFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLD-DFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSY-DYGIKYSFAFELRDTGRYGFLLPARQILPTAEETW 404          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A183QJI9 (Peptidase_M14 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.474e-100
Identity = 173/432 (40.05%), Postives = 256/432 (59.26%), Query Frame = 2
Query:  245 IFLMVSMHPSSGCALISVLFLGFI-----SSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWG-GASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            IFL++++  S    L+S + +  I     S   Y  + V+ +   R  D+  I     +  N+  ++     P   N+++ ++VSP   E L   L++ + SY  T+ N Q  I  E  EN      S  RTG N  +  Y  + +I +++ +  Q  ++     FG T E R +  V +S + + PI+W+D GIHAREWIA ++AL II+KL+R S +T  +L  +QF++VP+VNPDGYEY+   +RLWRKNR++     CIG+D+NRNFPF+WG G  +SP+ C D YRG  A SE E QSII +L   + +I L +SLH+FGQYIL PFGFS   YP  Y  + S+       +Q +H  +Y VG   ++LY A+G++DD+V G LKIP+++T+EL D+G +GF LPP YI  VG QLW  +  L ++I
Sbjct:    3 IFLILNVSISGIILLLSSIEIILINTITASHVHYYNYKVLRM---RISDLQIINTIINLNLNEPENYDIWSFPRHNNNSMYILVSPVGFENLTNYLHQWNTSYEITVSNLQKAILDEKRENHLRRVSSYLRTGRNRPY--YKSFNEIVQYLDQLSQMRSHMTVEDFGYTAEGRPMKGVMISSDSTRPIIWIDAGIHAREWIAPATALSIINKLMRPSGQT--LLKHFQFFIVPVVNPDGYEYTRTKYRLWRKNRAQTEGESCIGIDLNRNFPFKWGVGNGASPHSCSDTYRGSEAASELETQSIIKKLNSLQKQIILYLSLHSFGQYILTPFGFSRYSYPPYYQKLMSMGKKVKQMIQNRHGYVYQVGSSSELLYEAAGATDDYVAGELKIPYAYTIELCDEGRYGFLLPPSYIGQVGRQLWTALTVLANDI 427          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: H2KUJ3 (Carboxypeptidase O OS=Clonorchis sinensis OX=79923 GN=CLF_109195 PE=4 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 6.268e-100
Identity = 157/407 (38.57%), Postives = 245/407 (60.20%), Query Frame = 2
Query:  284 ALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWG-GASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDII 1501
            +L +++     ++  Y+G+ ++ I P+   +   I+            +   R   RP   +S++VSP     L  +LN  +++    I N +  IDR+  E    +   +FRT   S+H  Y   ++IE  +    +   + +    G T ENR +  +K+SK+ S PI+W+D GIHAREWIA ++ L+ +D+LL    + +  L  +QF++VPLVNPDGY Y+H+  RLWRKNRS      C+GVD+NRNFP +WG G  +SP  CDD YRG    SE E Q++I++LT+ KD+I L ++LH+FGQ+IL P+GF+   YP NY +M ++      ++Q +++ +Y VG   D+LY ASG ++DFV G L +P+++T+EL D+G +GF LPP YI++VG QLW  +
Sbjct:    7 SLCTLILHILCANALYEGYRLVRIFPRGANETKAIQALEHRGSPHYDIWSIDRSTERP---VSMMVSPEGWNNLSRILNRFNMTSEVLIENLKTEIDRQAREKNSQLRLQMFRTKVKSEHDTYRTVEEIEAAVDRYARKHPFVQIEVLGYTAENRPVRALKISKDSSKPIIWIDAGIHAREWIAPAATLYFVDRLLTRGGQAF--LKDFQFFIVPLVNPDGYHYTHQADRLWRKNRSPTAGEHCVGVDLNRNFPLKWGYGDGTSPRACDDIYRGDGPASELESQALINKLTELKDQIVLYLNLHSFGQFILTPYGFARYRYPGNYNNMINLGELVQKEIQKRYNYVYRVGSASDLLYEASGGAEDFVAGVLNVPYAYTIELCDEGRYGFLLPPAYIRTVGRQLWTAV 408          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: C4QKW6 (Subfamily M14A unassigned peptidase (M14 family) OS=Schistosoma mansoni OX=6183 GN=Smp_088270 PE=4 SV=2)

HSP 1 Score: 318.931 bits (816), Expect = 8.968e-100
Identity = 174/432 (40.28%), Postives = 255/432 (59.03%), Query Frame = 2
Query:  245 IFLMVSMHPSSGCALISVLFLGFI-----SSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWG-GASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            IFL++++  S    L+S + +  I     S   Y  + V+ +   R  D   I     +  N+  ++     P   N+++ + VSP   E L   L++ + SY  T+ N Q  I  E  EN      S  RTG N  +  Y  + +I +++ +  Q  ++ K   FG T E R +  V +S + + PI+W+D GIHAREWIA ++AL II+KL+R S +T  +L  +QF++VP+VNPDGYEY+   +RLWRKNR++     CIG+D+NRNFPF+WG G  +SP+ C D YRG  A SE E QSII +L   + +I L +SLH+FGQYIL PFGFS   YP  Y  + S+       +Q +H  +Y VG   ++LY A+G++DD+V G LKIP+++T+EL D+G +GF LPP YI  VG QLW  +  L ++I
Sbjct:    3 IFLILNVSISGIILLLSSIEIILINTITASHVHYYNYKVLRM---RISDPQIINTIINLNLNEPENYDIWSFPRHNNNSMYISVSPVGFENLTNYLHQWNTSYEITVSNLQKAILDEKRENHLRRVSSYLRTGRNRPY--YKSFNEIVQYLDQLSQMRSHMKVEDFGYTAEGRPMKGVMISSDSTRPIIWIDAGIHAREWIAPATALSIINKLMRPSGQT--LLKHFQFFIVPVVNPDGYEYTRTKYRLWRKNRAQTEGELCIGIDLNRNFPFKWGVGNGASPHSCSDTYRGSEAASELETQSIIKKLNSLQKQIILYLSLHSFGQYILTPFGFSRYSYPPYYQKLMSMGKKVKQMIQNRHGYVYQVGSSSELLYEAAGATDDYVAGELKIPYAYTIELCDEGRYGFLLPPSYIGQVGRQLWTALTVLANDI 427          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A3R7CDE9 (Carboxypeptidase O OS=Clonorchis sinensis OX=79923 GN=CPO PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.837e-99
Identity = 155/392 (39.54%), Postives = 238/392 (60.71%), Query Frame = 2
Query:  329 YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWG-GASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDII 1501
            Y+G+ ++ I P+   +   I+            +   R   RP   +S++VSP     L  +LN  +++    I N +  IDR+  E    +   +FRT   S+H  Y   ++IE  +    +   + +    G T ENR +  +K+SK+ S P++W+D GIHAREWIA ++ L+ +D+LL    + +  L  +QF++VPLVNPDGY Y+H+  RLWRKNRS      C+GVD+NRNFP +WG G  +SP  CDD YRG    SE E Q++I++LT+ KD+I L ++LH+FGQ+IL P+GF+   YP NY +M ++      ++Q +++ +Y VG   D+LY ASG ++DFV G L +P+++T+EL D+G +GF LPP YI++VG QLW  +
Sbjct:   22 YEGYRLVRIFPRGANETKAIQALEHRGSPHYDIWSIDRSTERP---VSMMVSPEGWNNLSRILNRFNMTSEVLIENLKTEIDRQAREKNSQLRLQMFRTKVKSEHDTYRTVEEIEAAVDRYARKHPFVQIEVLGYTAENRPVRALKISKDSSKPVIWIDAGIHAREWIAPAATLYFVDRLLTRGGQAF--LKDFQFFIVPLVNPDGYHYTHQADRLWRKNRSPTAGEHCVGVDLNRNFPLKWGYGDGTSPRACDDIYRGDGPASELESQALINKLTELKDQIVLYLNLHSFGQFILTPYGFARYRYPGNYNNMINLGELVQKEIQKRYNYVYRVGSASDLLYEASGGAEDFVAGVLNVPYAYTIELCDEGRYGFLLPPAYIRTVGRQLWTAV 408          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A4S2LGI6 (Peptidase_M14 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007731 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 5.652e-99
Identity = 155/408 (37.99%), Postives = 247/408 (60.54%), Query Frame = 2
Query:  281 CALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWG-GASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDII 1501
             +L +++     ++  Y+G+ ++ I P+   +   I+    +       +   R   RP   + ++VSP     L  +L+  ++++   I N +  IDR+  E  + +   +FRT   S+H  Y   ++IE  +    +   + +    G T ENR +  +K+SK+ S PI+W+D GIHAREWIA ++ L+ +D+LL    + +  L  +QF++VPLVNPDGY Y+H+  RLWRKNRS      C+GVD+NRNFP +WG G  +SP  CDD YRG    SE E Q++I++LT+ KD+I L ++LH+FGQ+IL P+GF+   YP NY +M ++      ++Q +++ +Y VG   D+LY ASG ++DFV G L +P+++T+EL D+G +GF LPP YI++VG QLW  +
Sbjct:   10 ASLCTLVLHILCANALYEGYRLVRILPRGKNETKAIQVLEHLESPHYDIWSIDRRMERP---VCMMVSPEGWNNLSRILDRFNMTFEVLIENLKAEIDRQAREKNRQLRLQMFRTKIKSEHDTYRTVEEIEAAVDRYARKHPFVQIEVLGYTAENRPVRALKISKDVSKPIIWIDAGIHAREWIAPAATLYFVDRLLTRGGQAF--LKDFQFFIVPLVNPDGYHYTHQADRLWRKNRSPTAGEHCVGVDLNRNFPLKWGFGDGTSPRACDDIYRGDGPASELESQALINKLTELKDQIVLYLNLHSFGQFILTPYGFARYRYPGNYNNMINLGELVQKEIQKRYNYVYRVGSASDLLYEASGGAEDFVAGVLNVPYAYTIELCDEGRYGFLLPPTYIRTVGRQLWTAV 412          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpa2 (carboxypeptidase A1 [Source:NCBI gene;Acc:103026101])

HSP 1 Score: 199.519 bits (506), Expect = 1.347e-57
Identity = 121/370 (32.70%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  401 KIFENDE-ISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQG-VNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            K  E+DE     F   P   +  + + V   +     + L+  +IS+   I N Q L+D E         Q   R+ ++ +  AY     I  W+   V    N    V  G +YENR ++++K S   +  P +W+D GIHAREW++T+SA+++ +K+  +         +L +   Y++ + NPDGY Y+H ++R+WRK RS    S C GVD NRN+   +GG  +S NPC D Y GP+A SE E+++++ +L K     K  +S+H++ Q ++ P+G+S  + P +  ++ +V  SA   L + +   Y VG    I+Y ASG S D+    + I +SF  EL D G +GF LP   I    S+ W
Sbjct:   40 KELEDDEGWELDFWTHPVSTDLPVDIHVPSASLHAAKSFLHLHNISFTVMINNVQELLDEEQESMEVNAMQE--RSVNSFNFGAYHTLDTIYSWMDTLVAAHANLVSKVHIGFSYENRPMYVLKFSTGGNKRPAIWIDAGIHAREWVSTASAVWMANKMATDYGVDPSVTSLLGRMDVYLMVVTNPDGYAYTHTSNRMWRKTRSINAGSVCRGVDPNRNWDAGFGGPGASKNPCSDSYHGPSAQSEIEVKNVV-DLVKNHGNFKAFISIHSYSQLLMYPYGYSCNNIP-DQAELGTVGRSAVQALSSLYGTSYRVGSICRIIYQASGGSIDWSY-DIGIKYSFAFELRDTGRYGFLLPANQIIPTASETW 404          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpa2 (carboxypeptidase A1 [Source:NCBI gene;Acc:103026101])

HSP 1 Score: 199.519 bits (506), Expect = 1.347e-57
Identity = 121/370 (32.70%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  401 KIFENDE-ISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQG-VNYAKFVKFGETYENRKLFMVKLSKN-DSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            K  E+DE     F   P   +  + + V   +     + L+  +IS+   I N Q L+D E         Q   R+ ++ +  AY     I  W+   V    N    V  G +YENR ++++K S   +  P +W+D GIHAREW++T+SA+++ +K+  +         +L +   Y++ + NPDGY Y+H ++R+WRK RS    S C GVD NRN+   +GG  +S NPC D Y GP+A SE E+++++ +L K     K  +S+H++ Q ++ P+G+S  + P +  ++ +V  SA   L + +   Y VG    I+Y ASG S D+    + I +SF  EL D G +GF LP   I    S+ W
Sbjct:   40 KELEDDEGWELDFWTHPVSTDLPVDIHVPSASLHAAKSFLHLHNISFTVMINNVQELLDEEQESMEVNAMQE--RSVNSFNFGAYHTLDTIYSWMDTLVAAHANLVSKVHIGFSYENRPMYVLKFSTGGNKRPAIWIDAGIHAREWVSTASAVWMANKMATDYGVDPSVTSLLGRMDVYLMVVTNPDGYAYTHTSNRMWRKTRSINAGSVCRGVDPNRNWDAGFGGPGASKNPCSDSYHGPSAQSEIEVKNVV-DLVKNHGNFKAFISIHSYSQLLMYPYGYSCNNIP-DQAELGTVGRSAVQALSSLYGTSYRVGSICRIIYQASGGSIDWSY-DIGIKYSFAFELRDTGRYGFLLPANQIIPTASETW 404          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:103039184])

HSP 1 Score: 193.741 bits (491), Expect = 2.252e-55
Identity = 123/400 (30.75%), Postives = 214/400 (53.50%), Query Frame = 2
Query:  344 VIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPY-RPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGV-NYAKFVKFGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            V+ I     + V+ ++  ++  +N  + +Q   P +    +++ + V   +   +   L+   I+Y   + N Q+LI+++  +N     +S    G N D   YL  + I  WI +  Q   + A+ +  G ++E R ++++KLS         +W+D GIHAREWI+ +  L+ I   L      S+  ++L+K   YV+P++NPDGY+Y+  T+R+WRKNRS    S C+GVD+NRNF  +W    +S  PC + Y G    SE E++++   L   K+ +KL +S+H++ Q +L P+ ++ E    N+ ++  +A  AA  ++  +  +Y  G     +Y A G SDD+      IP+SFT EL D+G +GF LPP+ I S  ++    + T+T  +
Sbjct:   32 VLSIRATTEEQVNVLKNITR--DNQTVLWQPASPSHITTRTDVHLYVHSGSVHHVTHQLDAHKITYSVLLENAQHLIEKQ-TKNETTDPRS---GGMNKDR--YLSLEDIYYWINKTSQEYPDMAEMMLIGSSFEKRPIYVLKLSGKRPAVDKAMWMDCGIHAREWISPAFCLYFIKYALTYYNQYSDITKMLNKMDIYVLPVLNPDGYKYTWTTNRMWRKNRSVKEGSDCVGVDLNRNFDAKWCTEGASSFPCSEIYCGSYPESEPEVEAVAKFLRSKKEVVKLYLSIHSYSQMLLFPYSYTYE-LARNHAELLDLAQDAATKIRRFYGNIYQYGAGAKTIYLAPGGSDDWAYNQ-GIPYSFTFELQDRGKYGFLLPPELISSACNEALLAVKTITLRV 421          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000011968.2 (carboxypeptidase A1-like [Source:NCBI gene;Acc:111195717])

HSP 1 Score: 192.971 bits (489), Expect = 3.198e-55
Identity = 129/421 (30.64%), Postives = 214/421 (50.83%), Query Frame = 2
Query:  287 LISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAE-NRQAIFQSLFRTGSNSDHIAYLRYQQIEE-------WIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPL-NYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            +++ L +       ++G  V+ I  +    ++ ++  +++     +   F R P   +  + V V   + + L + L   +I Y   I N Q+L+D E  E NR   FQ     GS  D+  Y  Y  + E        +KEK + V+    V  G++YE   L ++K S   + P +W+D GIH+REW+  +S  +   K+     RN++ T  IL K+  ++  + NPDGY+Y+H T R+WRK R   + S C+GVD NRN+   +GG  SS +PC + Y GP A SE E+++I+ +  K    +K  VS+H++ Q +L P+G++    P  +  ++  V   A   LQ  +   Y  G   +++Y ASG S D+      I +S+T EL D G++GF LP   I     + W  ++T+
Sbjct:    6 VLASLVVAVFGRKSFEGHQVLRITAEDDLQINLLKNLTQL---AYLKLDFWREPIHESLPVDVSVPSTSLQTLKSFLKNNNILYTIMIHNIQDLLDEEQREMNRSRAFQP----GSTDDY-DYANYHTLSEIYSFIDLLVKEKPKLVSK---VVIGKSYEGHPLNVLKFSTGANRPGIWIDTGIHSREWVTQASGTWFAKKIATDFGRNAALT-AILFKFDIFLEIVTNPDGYDYTHTTDRMWRKTRKPNSGSDCVGVDPNRNWDAFFGGPGSSRDPCSEIYHGPYAHSEPEVKAIV-DFVKSHGNLKAFVSIHSYSQMLLYPYGYTRT--PCKDQAELHEVVRRAVIALQRPYSTNYKYGSIINVVYEASGGSIDWTYNQ-GIKYSYTFELRDTGLYGFLLPANQIIPTAEETWLALMTI 410          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000011955.2 (carboxypeptidase A1-like [Source:NCBI gene;Acc:103029424])

HSP 1 Score: 188.348 bits (477), Expect = 1.716e-53
Identity = 128/418 (30.62%), Postives = 217/418 (51.91%), Query Frame = 2
Query:  278 GCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAEN-RQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKV-QGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPL-NYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITL 1510
            G  +++ +F+       + G  V+ I       +  +++ S++     +   F R P   +  I V V   + + + + L    I Y   I + Q+L+D E  E  R   F+   R+  + D+  Y    +I  +I   V +       V  G++YE R L ++K S  D+ P +W+D GIH+REWI  +S  +   K+     R+S+ T  IL KY  ++  + NPDGY+Y+H+T+R+WRK R     S C+GVD NRN+   +GG  SS NPC + YRGP   SE E+++I+  +  + + +K  VS+H++ Q +L P+G ++   P  +  ++  +A  A  DL++ +   Y  G   D +Y ASG++ D+      I +S+T EL D G++GF LP   I +   + W  ++T+
Sbjct:    3 GLLVLAAVFVAVFGKETFHGHQVLRITAVNEVQIKLLKELSEL---GHLQLDFWREPIHESLPIDVRVPFESLQPVRSFLAYNEIYYNVMIEDLQDLLDVELREMMRSRAFEP--RSTDDYDYTNYHTLDEIYSFIDMLVKENPKLVSKVVIGKSYEGRPLNVLKFSTGDNHPGIWIDTGIHSREWITQASGTWFAKKIATDYGRDSALT-AILDKYDIFLEIVTNPDGYDYTHKTNRMWRKTRKPNPESDCVGVDPNRNWGTGFGGGGSSGNPCSETYRGPYVNSESEVKAIVDFVGSHGN-LKAFVSIHSYSQMLLYPYGDTST--PCKDQAELHELAKKAITDLKSLYGTSYTYGSIYDTIYQASGTTVDWTYDQ-DIKYSYTFELRDTGIYGFLLPADQIIATAQETWLALMTI 410          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: cpa5 (carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-020514-1])

HSP 1 Score: 133.65 bits (335), Expect = 2.540e-34
Identity = 82/249 (32.93%), Postives = 129/249 (51.81%), Query Frame = 2
Query:  788 PIVWLDGGIHAREWIATSSALFIIDKLLR---NSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTS-VAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            P  W     H R  +   + ++I  KL+      S    +L+   +Y   + NPDGY Y+HE  R+WRK RS+++ + C+G D NRNF   +GG  SS + C + YRGP+  SE E+Q+I++ +  + + IK  + +H++ Q ++ PFG+ NE  P    D T  +A SA   L + ++  Y  G     +Y ASG S D+     K+ +S+  EL D G +GF LP   I     + W  I  +   +
Sbjct:  178 PWRWFATKNHHRRRVLRXTGIWIAKKLVSEYGQDSAITSLLNTMDWYFEIVANPDGYVYTHERDRMWRKTRSQYSGNSCVGTDPNRNFAAGFGGPGSSSSSCTETYRGPSVHSESEVQAIVNFVQAHPE-IKSFLDIHSYSQMLIFPFGYKNELAP----DHTELLAKSAVTALTSLYNTKYTYGPIITTIYQASGGSIDWTYEAAKVRYSYCFELRDTGRYGFILPANQILPTAQETWLAIKVIAEHV 421          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: cpz (carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-090313-267])

HSP 1 Score: 56.9954 bits (136), Expect = 7.966e-9
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 2
Query:  626 GSNSDHI-AYLRYQQIEEWIK-----EKVQGVNYAKFVKFGETYENRKLFMVKLSKNDS-----LPIVWLDGGIHAREWIA----TSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCI-GVDMNRNFPFEWGGA------SSSPNPCDDQY 1096
            G+++ H  A LR+++  E  +     EK  G   A+    G+++ENR L +++LS+N       +P V L G IH  E +      + A  +  +L         +L+  + +++P +NPDGYE + ++      N +  +    +  +D+NRNFP    G        + P P  DQY
Sbjct:  168 GADAGHRGAVLRHRRHAEMTRALRRAEKSCG-GAARLYSIGKSFENRDLLVIELSENPGKHELLVPEVRLVGNIHGNEVLGRELLVALAQHLCARLEDGDERVRRLLNTTRLHILPSMNPDGYELAADSVSGSVANAADSSGRNNMQNIDLNRNFPDLTSGVLRRPKRRTQPLPVPDQY 345          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: CPXM2 (carboxypeptidase X, M14 family member 2 [Source:HGNC Symbol;Acc:HGNC:26977])

HSP 1 Score: 51.6026 bits (122), Expect = 4.318e-7
Identity = 53/225 (23.56%), Postives = 97/225 (43.11%), Query Frame = 2
Query:  641 HIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSL-----PIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCI--GVDMNRNFP----FEWGGASSS------PN---PCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVV--SLHAFGQYILQPFGFSNE 1237
            H  Y   + + + + EK    N  +    G+++E  KL+ +++S N        P      G+H  E +     LF+++ L     R +     ++ + + +++P VNPDGYE ++E         S +TF +    G+D+N NFP      W   +        PN   P  D +   NA    E ++++S    + ++I  V+  +LH     +  PF  + E
Sbjct:  183 HHNYKEMRLLMKIVNEKCP--NVTRIYNIGKSHEGLKLYAMEISDNPGEHEIGEPEFRYVAGVHGNEALGRELTLFLMEFLCHEYNRGNPRIRRLVEETRIHLLPSVNPDGYEKAYEA----GSELSGWTFGRWTRNGIDLNHNFPDLNSVLWDAENRGHVSHGVPNHHLPLPDWFHSRNATVAVETRAVVS----WMEKIPFVLGGNLHGGELVVTYPFDAARE 397          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Yeast
Match: ECM14 (Putative metalloprotease with similarity to zinc carboxypeptidases; required for normal cell wall assembly [Source:SGD;Acc:S000001174])

HSP 1 Score: 131.724 bits (330), Expect = 7.990e-34
Identity = 85/271 (31.37%), Postives = 145/271 (53.51%), Query Frame = 2
Query:  725 FGETYENRKLFMVKLSKN--DSLP---IVWLDGGIHAREWIATSSALFIIDKLLR---NSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKL--VVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLV-----GRPPDILYP--ASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQ 1486
             G T+E R+L  + +S N  +S P    + + GGIHAREWI+ S+  + + +LL    +S +  + L    F V+P+ NPDGY Y+    RLWRKNR R    +C+G+D++ +F F+W  A +  + C ++Y G       E  +    + + K   K+   + +H++ Q IL P+ +S +  P +  ++  ++   +  +++K    Y V      R  DI +P   +GS+ DF+    +  ++F ++L D G HGF LPP+ IK VG +
Sbjct:  147 LGRTFEGRELKALHISGNKPESNPEKKTIVITGGIHAREWISVSTVCWALYQLLNRYGSSKKETKYLDDLDFLVIPVFNPDGYAYTWSHDRLWRKNRQRTHVPQCLGIDIDHSFGFQWEKAHT--HACSEEYSGETPFEAWEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSKSGRNYDVISACKDRGSDI-FPGLGAGSALDFMYHH-RAHWAFQLKLRDTGNHGFLLPPENIKPVGKE 413          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM7])

HSP 1 Score: 198.364 bits (503), Expect = 6.084e-58
Identity = 117/401 (29.18%), Postives = 208/401 (51.87%), Query Frame = 2
Query:  338 FSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETY--ENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLR---NSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHD-ALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
              V+ + PQ   D ++I   +++  + +I   F  PP RP   + + V+  A ++L   L+   I +   I + Q L+D++          S + T    D I    Y +++       +  N   F   G++Y  +++K   +K  +  + P+ +++ GIHAREW++ ++ ++I  +LL      +    +L K  F ++P++NPDGY ++ E  R WRK     + + C+G D NRN+ ++WG   +S +PC D YRGP+A SE EI ++   L K  DRIK  + +HA+ Q+ + P+G + +    +Y ++  V+ + A  +++  D  +Y VG    ++Y  SG S D+  G L I +SF +EL D G  GF LPP+ I     + ++ +I    E+
Sbjct:    1 MKVVRVIPQ---DEAEIHVINELRNHKDIKVDFWAPPSRPRHPVDLHVTAHAYKRLARHLSANRIPFTLQIPDVQRLVDQQKMATAGRASASWYSTYHTLDQI----YAELKNLYNTYYRNGNVRVFT-VGKSYNGKDQKAIEIKGKRARNKPVFFMNCGIHAREWVSPATCMYIAKQLLSRYGKDANVTSVLDKMDFVIMPVLNPDGYVFTWERQRFWRKTLKPNSGTFCVGTDPNRNWDYKWGAEGASTDPCADDYRGPHAFSEIEIVNVAKYLKKLGDRIKGYMDIHAYSQFWMIPWGHT-QTPSKDYQELMRVSKAGAEAIRSSGDNTVYKVGPSSTVIYVNSGGSKDYTYGALGIKYSFALELRDTGKEGFLLPPEQIIPTALETFNGVIAAAKEM 392          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO45321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT36])

HSP 1 Score: 169.088 bits (427), Expect = 2.623e-48
Identity = 90/277 (32.49%), Postives = 148/277 (53.43%), Query Frame = 2
Query:  710 AKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL----RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLV--VSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            A     G TYE R +  VK+S        +++ GIHAREWI  ++ +++++++L    ++ + T  +L K  F ++P++N DGY Y+H  +R+WRK R    +  C G D NRN+ F+WGG  +S +PC D YRGP   SE E  ++   L  Y++R  L+  + +HA+ Q  +  +GF+  + P     +      A   L+  +   Y +G    I+Y  SG + D+  G L I +S+ +EL D+G +GF LP   I   G + +  I  +  E+
Sbjct:   12 ATMQNLGNTYEGRPMKAVKISSGRGKKTFFMNCGIHAREWITQATCMYMLNQILYKYGKDQTVT-AMLDKMDFVIMPILNVDGYVYTHTHNRMWRKTRK--PYGGCYGADPNRNWSFKWGGVGTSSDPCRDTYRGPRPFSEVEALNVARYL--YRNRKSLIGYMDIHAYSQLWMTSWGFNRAYPPAYNTKVKPAGQKAVEALRKVYGTHYRLGPSSIIIYATSGGTMDWATGVLGIEYSYGLELRDEGKYGFVLPANQILPTGVETFAAIKAMVQEM 283          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH7])

HSP 1 Score: 169.088 bits (427), Expect = 3.511e-48
Identity = 89/264 (33.71%), Postives = 151/264 (57.20%), Query Frame = 2
Query:  716 FVKFGETYENRKLFMVKLSK-NDSLPIVWLDGGIHAREWIATSSALFIIDKLLR---NSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPN-PCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPD--QGMHGFTLPPKYIKSVGSQ 1486
             V FG+TYE RK++ +K+     + PI +++ GIH+REWI+ S+ +++  KL++   N+S   +++ K+++ ++P+ N DGY Y++   R+WRKN++      C+G D+NRNF + WGG  S+PN PC   Y G    SE E +++   L K + R++  V  H++GQ  + P+GF+ + +P NY        +    ++  H   +  G    ++YP SG + D+  G L +  S+ VEL      ++GF LPP  I  VG +
Sbjct:   14 LVDFGKTYEGRKIYGLKVGTIYANKPIFFINCGIHSREWISISTCMYVARKLVQTYPNNSRVQQMVEKFEWIILPVFNVDGYIYTNNRDRMWRKNKNP-GVGGCMGTDLNRNFNYHWGGIGSAPNKPCSPIYPGSRPFSEVETRNVARYLYKKRKRLRAYVDFHSYGQLWMSPWGFTKK-FPPNYRRHARAMNAVVKAIKRVHGTEFTYGPSSIMIYPTSGDATDWTFGVLGVTHSYGVELRPGLSDLYGFFLPPSSIIPVGKE 275          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO43305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY0])

HSP 1 Score: 166.777 bits (421), Expect = 3.812e-46
Identity = 91/286 (31.82%), Postives = 150/286 (52.45%), Query Frame = 2
Query:  692 VQGVNYAKFVKFGETYENRKL-FMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLL---RNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNR-----SRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            VQ +        G TYE   L F +K       P+ +++ GIHAREWI  ++ ++II + +   R+     E+L K  F ++P++N DGY Y+   +R+WRK R     S +    C G D NRN+ ++WG   +S NPC D +RG  A SE E+ ++   L     R+K  + +HA+ Q+ + P+G++  +   ++ ++  V+      ++  +   Y  G   +I+Y  SGSS D+  G L I +SF +EL D G +GF LPP  I     + ++ II +   +
Sbjct:  110 VQTLAQVTMNTVGSTYEGPNLVFQIKGRSLPEKPVFFMNCGIHAREWITPATCMYIITQFITKYRSDKSVTEVLDKMDFIIMPVLNADGYVYTWTGNRMWRKTRKPNIQSWWGQKTCYGTDPNRNWGYKWGLPGASSNPCSDTFRGKTAQSEVEVDNVAKFLKGLGPRVKGYMDIHAYSQFWMIPWGYTTAN-AKDHKELMRVSKIGVDAIRQTYGTAYRYGSSSNIIYKNSGSSKDYTYGHLNIKYSFALELRDTGRYGFLLPPGQILPTALETFNGIIAMAKAM 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH8])

HSP 1 Score: 145.591 bits (366), Expect = 8.952e-39
Identity = 109/418 (26.08%), Postives = 180/418 (43.06%), Query Frame = 2
Query:  290 ISVLFLGFISSF------RYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVEL-PDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            +SV FL  ++         Y G  +  + P+   D +++     + + D     F   P  P  N+ + VSP  ++    LL    + +   + ++ +++ +E    R   F S + + S   H   L   +    +         A     G++YENR          D L I  L+ G                     + S+  ++L  Y++ ++P++N DGYEY+    R+WRK R+  T  KC+GVD NRNF + +G   +S N C   YRG  A SEK   ++   L + + R+K  +  HA+ Q  L P+G+++   P NY +      +A   LQ  H   Y+ G     +YP +G + D+  G L    S+ VEL P     GF LPP  I   G + +  +  L   +
Sbjct:    3 VSVTFLVLLAGVLACNGNDYQGHKLYRVVPR---DQAQVDFLDDLLKTDG-ELDFWAFPVAPMKNVDIHVSPDKRQAFEELLEASDMEFKIVVQDFSSMLAQEKVSARSGGFDSDYHSLSEI-HAEILALAKAYSSV---------ASNFSLGKSYENR----------DQLAIKILETG--------------------DSDSDVTDMLDNYEWVILPVLNVDGYEYTRTKDRMWRKTRTPGT--KCVGVDPNRNFNYRFGVTGTSNNECSQIYRGKQAFSEKVTYNVAKFLYENRHRLKGYIDFHAYSQMFLSPWGYTDAK-PSNYTEHMKAMTAAVNALQAVHGTRYVFGPASTTIYPTAGDTTDWTYGVLGCVHSYCVELRPTGNPPGFILPPAQIIPTGQETFAALKALVRNM 373          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpa6 (carboxypeptidase A6 [Source:NCBI gene;Acc:101171451])

HSP 1 Score: 201.445 bits (511), Expect = 9.670e-58
Identity = 131/418 (31.34%), Postives = 204/418 (48.80%), Query Frame = 2
Query:  308 GFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPP----YRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKE--KVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTA 1534
             F+ + RY G  V+ I P   Q+V  ++    + + D     F +P       PN ++ V V       +   L +E I Y   I N Q  I+++        F    R  S  D+  Y   ++I+ W+ E  + Q    A F   G++YE R L++++L K +    VW+D G+HAREWI  +   + + + + +    S   ++L++  FY++P+ N DGY YS  T R WRK RS+     C GVD NRN+  +W    +S +PCDD Y GP   SE E++++   L K K RIK  +S+HA+ Q +L P+ +     P N+  + S A SA   L + +   Y  G     LY +SGSS D+      IP++F  EL D G  GF LP   IK   ++    +  + S + +  
Sbjct:   65 AFLYNNRYVGDQVLRIIPTNEQEVRALKGILGLMKVD-----FWQPNSASLIHPNRSVDVHVKNHDIRGMHERLTDEKIQYQVLISNLQKEIEKQTGHR----FSRKRRAESQYDYEVYHSLEEIQSWMFEMNRTQPDLVALF-SIGKSYEGRPLYVLQLGKGNQKKAVWIDCGVHAREWIGPAFCQWFVKEAINSYQYDSAMTKLLNQLSFYIMPVFNVDGYHYSWNTDRFWRKTRSKIRKFHCRGVDANRNWKVKWCDEGASSHPCDDTYCGPFPESEPEVKAVAKFLRKNKKRIKAYISIHAYAQMLLYPYSYKYAMIP-NFNCVESAASSAVKALYSAYGVRYRYGPASTTLYVSSGSSIDWAYKN-GIPYAFAFELRDTGYFGFLLPESLIKPTCTETTRAVKAIASGLLKKC 470          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000024618.2 (carboxypeptidase A1 [Source:NCBI gene;Acc:101163721])

HSP 1 Score: 199.134 bits (505), Expect = 1.532e-57
Identity = 123/425 (28.94%), Postives = 217/425 (51.06%), Query Frame = 2
Query:  278 GCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEK----VQGVNYAKFVKFGETYENRKLFMVKLSKNDS-LPIVWLDGGIHAREWIATSSALFIIDKLLRN---SSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYR 1528
            G    ++LF+  +S   + G  V+ I P+     S+++   ++ E++     F R   R ++ + V V   A + +   L  ++I Y   I + Q L+D E  E   A F    R   N+D   Y  Y  + E    +     +  N    +  G +YE R L ++K S   +  P +W+D GIH+REW+  +S  +   K++++        +IL+    ++  + NPDGY+Y+  ++R+WRK R     S C+GVD NRN+   +G   +S +PC + YRGP+A SE E+++I+  +  +K+ IK  +++H++ Q +L PFG+++     +  ++ S+A  A  DL + +   Y  G   D +Y ASG++ D+      I +S+T EL D G +GF LP K I     + W  ++ + S  ++
Sbjct:    3 GILAFTLLFVAVLSKETFVGHQVLRIVPKDEVQRSQLKNLEEMMESE---LDFWREVTRVSTPVDVRVPSHALQFVKDFLGNQNIEYSVMIQDLQALLDEEQEEMDAAAFSGSPR---NTDSFDYENYHTLNELYSFQDMLVAENPNLVSKLVIGNSYEGRPLNVLKFSTGGTNRPAIWIDTGIHSREWVTQASGTWFAKKIVKDYGSDPALTDILNNMDIFLETVTNPDGYDYTQNSNRMWRKTRKPNPGSSCVGVDPNRNWDSGFGEPGASSSPCSETYRGPSAHSESEVKAIVDFVVAHKN-IKAFITIHSYSQMLLYPFGYTSAPSK-DEAELHSLAQKAITDLASLYGTRYTYGSIIDTIYQASGNTVDWTYEQ-GIKYSYTFELRDTGFYGFLLPAKQIVPTAEETWLALMAIMSHTFK 418          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: CPA1 (carboxypeptidase A1 [Source:NCBI gene;Acc:101163471])

HSP 1 Score: 189.119 bits (479), Expect = 1.078e-53
Identity = 127/400 (31.75%), Postives = 200/400 (50.00%), Query Frame = 2
Query:  329 YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNE----ESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEK----VQGVNYAKFVKFGETYENRKLFMVKLSKNDS-LPIVWLDGGIHAREWIATSSALFIIDKLLRNSSET---WEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLW 1492
            + G  V+ I P+    ++ ++    + E  E+ F      ++  + +S  V   A  + L LL      + ISY+T I + Q ++D E  E    +F    +   N+D   Y RY ++ E    +     +  N    +  G++YE R L ++K S   +    +W+D GIHAREWI  +S ++   K++ +        +IL+     +  + NPDGYEY+H T+RLWRK+R     S CIGVD+NRN+   +GG  +S NPC + Y GP A SE E++SI+ +  K    IK  +S+HA+ Q +L P+G +      +  ++ S+A  A  DL + +   Y  G     +Y ASG S D+      I +S+T EL D G HGF LP   I     + W
Sbjct:   20 FKGHQVLQIIPKNDAQLAFLKDLEDVLEF-ELDF------WKGVTAVSCPVHVRAPFQFLQLLKRMLKRKDISYVTMIDDLQAVLDEEQKEIE--LFARSLKP-KNTDSFNYSRYHKLSEIYSFQDMLVAENPNLVSKIVIGQSYEARPLSVLKFSTGGTNRRAIWIDTGIHAREWITQASGIWFAKKIVTDYGRDPILTDILNGMDILLEIVTNPDGYEYTHSTNRLWRKSRKPNPRSNCIGVDLNRNWDSGFGGPGASSNPCSETYHGPRAHSESEVKSIV-DFVKTHGNIKAFISIHAYSQLLLYPYGHTRNPAK-DQTELDSLAQKAVKDLASLYGTRYRYGSIISTIYQASGGSIDWAYDQ-GIKYSYTFELRDTGRHGFLLPSSQIIPTSEETW 406          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:101175299])

HSP 1 Score: 185.267 bits (469), Expect = 1.454e-52
Identity = 105/312 (33.65%), Postives = 171/312 (54.81%), Query Frame = 2
Query:  605 FQSLFRTGSNSDHIAYLRYQQIEE---WIKEKVQ-GVNYAKFVKFGETYENRKLFMVKLSKND--SLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
             Q++  T   S    Y RY ++E+   W+           K +  G ++E R L+ +KLS +D  +   +W+D GIHAREWI+ +  L+ +  +     E  +IL+    YV+P++NPDGY+Y+  T+R+WRKNR+     KC+GVD+NRNF   W    + P PC + Y G    SE E +++   L ++KD I+L +S+H++ Q +L P+  + E    N+ D+  +   AA  ++T + + Y  G     +Y A G SDD+    L I +SFT EL D+G +GF LPP  I +  ++    + T+  ++
Sbjct:   80 MQTMNGTDPRSTSTFYERYHRLEDIYDWLNRTAHDNPRTVKTILVGSSHEKRPLYALKLSFSDRPNRKAMWIDCGIHAREWISPAFCLWFVHHVSTVKVEITDILNNMDVYVLPVMNPDGYKYTWTTNRMWRKNRAPSHNPKCVGVDLNRNFDANWCTEGALPYPCSEIYCGAFPESEPESRAVADFLREHKDSIQLYISIHSYSQMLLFPYSCTVEE-AGNHNDLLEMVQEAARKIRTFYRSTYKYGAGAKTIYLAPGGSDDWAYD-LGIKYSFTFELQDRGEYGFLLPPSRIGNACNEALTAVKTIALKV 389          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpb1 (carboxypeptidase B1 [Source:NCBI gene;Acc:101169819])

HSP 1 Score: 182.956 bits (463), Expect = 1.565e-51
Identity = 124/406 (30.54%), Postives = 206/406 (50.74%), Query Frame = 2
Query:  296 VLFLGFISSF-----RYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAK--EKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVK--FGETYENRKLFMVKLSKNDSL--PIVWLDGGIHAREWIATSSALFIIDKLLR---NSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIK 1471
            +LF G +++      R+DG  V+ + P   + V+ IR  +   E+ E+ F     P     +I V +   A+    + T L + S+++   I + Q  I+R+ A+N                +  Y  +  +  WI   +   N +   K   G T+E R + ++KL K+     P ++LD GIHAREWI+ +   + + + L    + S+   +L +   YV+P+ N DGYEYSH T+R+WRK RS+ + S C+G D NRNF   W    +S NPC + + G    SE E++++   + K K  IK  +++H++ Q +L P+ +S  +   ++ ++ SVA  A+  L + +   Y  G     +Y A+G SDD+    L + +S+T EL D G HGF LP   IK
Sbjct:    4 LLFFGLVAAALADVTRFDGEKVLRLKPVLAEHVTLIRDLA---ESIEVDFWSPDSPELVTIDIDVDIRVPARYLSIVYTTLGQSSMAHEILIEDVQVAINRQ-ADNG-------ISPKELHSYTKYNTWDTVLSWIN-SIASSNPSLVSKQVIGNTFEGRPMTLLKLGKSSGTTKPSIFLDCGIHAREWISPAFCQWFVKEALETYGSDSQMTSLLDQMDVYVLPVFNIDGYEYSHTTNRMWRKTRSKLSGSSCLGTDPNRNFDAGWCTVGASSNPCSETFCGSTPESEIEVKNVADFIRKNKSSIKAYLTIHSYSQLLLFPYSYS-YNLAADHSELMSVAQGASAALTSLYGTRYTSGPGASTIYLAAGGSDDWAYD-LGVKYSYTFELRDTGYHGFLLPESQIK 395          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000048042.1 (SMESG000048042.1)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 426/429 (99.30%), Postives = 428/429 (99.77%), Query Frame = 2
Query:  254 MVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            MVSMHPSSGCALISVLFLGFISSFRYDGFSVIDI PQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWA+EKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGS+SDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY
Sbjct:    1 MVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIVPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAREKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSSSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 429          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000048042.1 (SMESG000048042.1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 423/426 (99.30%), Postives = 425/426 (99.77%), Query Frame = 2
Query:  263 MHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 1540
            MHPSSGCALISVLFLGFISSFRYDGFSVIDI PQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWA+EKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGS+SDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY
Sbjct:    1 MHPSSGCALISVLFLGFISSFRYDGFSVIDIVPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAREKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSSSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEIYRTALY 426          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000056472.1 (SMESG000056472.1)

HSP 1 Score: 327.791 bits (839), Expect = 7.309e-107
Identity = 139/311 (44.69%), Postives = 217/311 (69.77%), Query Frame = 2
Query:  590 NRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            NR+  F++ F+         Y+R+ +I++W+ EK + V++ K    G + ENR++ +VK+SK+DS PI+W+D GIHAREWI+ S+A+F+I+KLL N   + ++L  YQ Y++PL+NPDGYEY+HE +R+WRKNR   ++  C GVD+NRN+P+ WG   +SP+PC   ++G +  SEKE +++I++LT+ K  +KL ++LH+FGQYI+ P+G+S   +P  Y  + S+  S +  LQ  +   Y VG   ++LY ASG+SDD+  G L+IP+S+T+ELPD+G +GF LPP YI+SVG+Q +  +I  T  +
Sbjct:  113 NRRQYFKTKFQRTDQGSISYYMRFVEIKQWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 423          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000066311.1 (SMESG000066311.1)

HSP 1 Score: 215.698 bits (548), Expect = 8.206e-64
Identity = 137/423 (32.39%), Postives = 219/423 (51.77%), Query Frame = 2
Query:  296 VLFLGFISSFR-YDGFSVIDIAPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKL----LRNSSETWEILSKYQFYVVPLVNPDGYEYSH-ETHRLWRKNRSRFTFS--KCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVA-ISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPD-----QGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
             L LG   +   Y+G+ VI+++ +  +++  + + S+ ++ D       + P +  +   V++SP   +  +  L +  I Y   I N Q +ID E   N    F   F     + +  +  Y++I +WI       ++     +G++YE R L  VK+S   +   V ++GGIH+REW+ATS+  +II+K+    L N+S    +LSK+  Y +P+ NPDG  YSH   +RLWRKNR  F      C GVD+NRNF  ++G A +S NPCDD YRGPNA SE E +     + K    + L  SLHA+ Q+   P+GF     P++ L++  VA I      +  H+  Y +G PP++LY A+G S D+V    ++ +++T+EL       +G  GF  P   I   G +++   I     I
Sbjct:    9 ALLLGATQALESYNGYKVIEMSLKTDEEIKHVLQISEKYQAD-----IWKGPSKITTT-HVMLSPEYFDGFIESLTKYEIQYKIMINNVQKIIDEETGMNENVKFMKSFSATRPTINDHFADYEEIMDWINYLTVKYSFVSSGSYGKSYEGRDLRYVKISTGQNRKAVLVEGGIHSREWLATSTVTYIIEKMISNILTNNSRIVSLLSKFDVYFIPVFNPDGNVYSHLHGNRLWRKNRRPFPLDGRTCFGVDLNRNFDAQFGVAGTSSNPCDDLYRGPNAFSEPETKHFSIFVKKLGLNLSLFFSLHAYAQFWFVPYGFGFSR-PVDDLELRRVANIGNQALYEVNHERFY-IGSPPELLYAAAGGSFDWVKMKARVKYAYTLELRPSRYNVRGSSGFIAPISDISKSGEEVYAGFIATIQAI 423          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000063633.1 (SMESG000063633.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.663e-49
Identity = 105/333 (31.53%), Postives = 179/333 (53.75%), Query Frame = 2
Query:  554 NYQNLIDREFAENRQAIFQSLFRT-GSNSDHIAYLRYQQIEEWIKE-KVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLR----NSSETWEILSKYQFYVVPLVNPDGYEYSHE--THRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFV--VGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 1522
            N  + I +E  +N      S F+  G+      +  +++   W++    Q   +   V  G++YE + + ++KLS       +++DGGIHAREW+  SS ++I++KL+     N+++  +IL++++ Y++P+ NPDGYE + +    RLWRKN      + C+GVD+NRNF  ++G    S +PC+  Y G  A    E  +    +   KD++KL VS HA+ Q +L P+ ++ +  P +  +M  VA   A  +  K    Y+VG P +ILY ASG   D+V  +G +K  ++F V   +Q   GF  P ++I   G +L++ II     +
Sbjct:   88 NLDDTISKEIKDNEVKRIHSQFKAAGAAGIETYFAPHKEYNNWLQSLSDQNSKFISVVNIGKSYEGKDMNVIKLSTGPKKETIFIDGGIHAREWLGVSSVVWILNKLVSGFKTNNADVKDILNRFEIYILPITNPDGYEKTRKGGKDRLWRKNTMPVE-NGCLGVDLNRNFDADFGRTGVSSDPCNIVYPGSRAFIAPETINFRDFVLSIKDKLKLFVSFHAYSQLLLTPWAYT-QTPPSDNDEMMRVANLMADSIYKKSGKRYIVGSPANILYAASGGCYDWVKKIG-VKYSYTFEVRPDNQDRSGFVAPVEWISPAGDELYEAIIVAAKSV 417          
The following BLAST results are available for this feature:
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPA45.843e-6133.08carboxypeptidase A4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CPA22.003e-6030.34carboxypeptidase A2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
CPO8.076e-5535.37carboxypeptidase O [Source:HGNC Symbol;Acc:HGNC:21... [more]
CPA41.211e-5431.89carboxypeptidase A4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CPA12.157e-5430.91carboxypeptidase A1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T06A4.14.177e-6031.67pep chromosome:WBcel235:I:770892:776369:1 gene:WBG... [more]
T06A4.33.673e-5831.72pep chromosome:WBcel235:I:763625:768917:1 gene:WBG... [more]
F02D8.45.345e-5833.24pep chromosome:WBcel235:V:14984893:14987571:1 gene... [more]
F02D8.45.345e-5833.24pep chromosome:WBcel235:V:14984909:14987571:1 gene... [more]
T06A4.31.232e-5731.81pep chromosome:WBcel235:I:763597:770720:1 gene:WBG... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG85608.634e-6331.59gene:FBgn0035781 transcript:FBtr0332725[more]
CG85608.634e-6331.59gene:FBgn0035781 transcript:FBtr0076868[more]
CG123745.200e-6130.68gene:FBgn0033774 transcript:FBtr0087854[more]
CG185851.160e-6030.46gene:FBgn0031929 transcript:FBtr0335489[more]
CG185851.160e-6030.46gene:FBgn0031929 transcript:FBtr0079516[more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpa21.563e-5731.64carboxypeptidase A2 (pancreatic) [Source:ZFIN;Acc:... [more]
cpa69.579e-5630.11carboxypeptidase A6 [Source:ZFIN;Acc:ZDB-GENE-0912... [more]
cpo7.292e-5534.10carboxypeptidase O [Source:NCBI gene;Acc:100005630... [more]
cpa15.861e-5427.45carboxypeptidase A1 (pancreatic) [Source:ZFIN;Acc:... [more]
cpb21.522e-5330.10carboxypeptidase B2 (plasma) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb27.060e-5633.83carboxypeptidase B2 [Source:NCBI gene;Acc:595005][more]
pex61.076e-5333.24peroxisomal biogenesis factor 6 [Source:Xenbase;Ac... [more]
kpna11.256e-5330.73karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
kpna12.320e-5331.00karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
cpb21.891e-5133.53carboxypeptidase B2 [Source:NCBI gene;Acc:595005][more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpa21.188e-6130.31carboxypeptidase A2, pancreatic [Source:MGI Symbol... [more]
Cpa41.715e-5530.38carboxypeptidase A4 [Source:MGI Symbol;Acc:MGI:191... [more]
Cpa52.850e-5229.43carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:192... [more]
Cpa52.850e-5229.43carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:192... [more]
Cpa13.204e-5230.47carboxypeptidase A1, pancreatic [Source:MGI Symbol... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q504N0|CBPA2_MOUSE8.307e-6130.31Carboxypeptidase A2 OS=Mus musculus OX=10090 GN=Cp... [more]
sp|Q9UI42|CBPA4_HUMAN2.806e-6033.08Carboxypeptidase A4 OS=Homo sapiens OX=9606 GN=CPA... [more]
sp|Q29NC4|CBPA1_DROPS5.116e-6029.90Zinc carboxypeptidase A 1 OS=Drosophila pseudoobsc... [more]
sp|P19222|CBPA2_RAT9.437e-6030.77Carboxypeptidase A2 OS=Rattus norvegicus OX=10116 ... [more]
sp|P48052|CBPA2_HUMAN9.618e-6030.34Carboxypeptidase A2 OS=Homo sapiens OX=9606 GN=CPA... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183QJI91.474e-10040.05Peptidase_M14 domain-containing protein OS=Schisto... [more]
H2KUJ36.268e-10038.57Carboxypeptidase O OS=Clonorchis sinensis OX=79923... [more]
C4QKW68.968e-10040.28Subfamily M14A unassigned peptidase (M14 family) O... [more]
A0A3R7CDE91.837e-9939.54Carboxypeptidase O OS=Clonorchis sinensis OX=79923... [more]
A0A4S2LGI65.652e-9937.99Peptidase_M14 domain-containing protein OS=Opistho... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpa21.347e-5732.70carboxypeptidase A1 [Source:NCBI gene;Acc:10302610... [more]
cpa21.347e-5732.70carboxypeptidase A1 [Source:NCBI gene;Acc:10302610... [more]
cpb22.252e-5530.75carboxypeptidase B2 [Source:NCBI gene;Acc:10303918... [more]
ENSAMXT00000011968.23.198e-5530.64carboxypeptidase A1-like [Source:NCBI gene;Acc:111... [more]
ENSAMXT00000011955.21.716e-5330.62carboxypeptidase A1-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cpa52.540e-3432.93carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-0205... [more]
cpz7.966e-926.82carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
CPXM24.318e-723.56carboxypeptidase X, M14 family member 2 [Source:HG... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ECM147.990e-3431.37Putative metalloprotease with similarity to zinc c... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469546.084e-5829.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453212.623e-4832.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468633.511e-4833.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433053.812e-4631.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469248.952e-3926.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpa69.670e-5831.34carboxypeptidase A6 [Source:NCBI gene;Acc:10117145... [more]
ENSORLT00000024618.21.532e-5728.94carboxypeptidase A1 [Source:NCBI gene;Acc:10116372... [more]
CPA11.078e-5331.75carboxypeptidase A1 [Source:NCBI gene;Acc:10116347... [more]
cpb21.454e-5233.65carboxypeptidase B2 [Source:NCBI gene;Acc:10117529... [more]
cpb11.565e-5130.54carboxypeptidase B1 [Source:NCBI gene;Acc:10116981... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048042.10.000e+099.30SMESG000048042.1[more]
SMESG000048042.10.000e+099.30SMESG000048042.1[more]
SMESG000056472.17.309e-10744.69SMESG000056472.1[more]
SMESG000066311.18.206e-6432.39SMESG000066311.1[more]
SMESG000063633.11.663e-4931.53SMESG000063633.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030305 ID=SMED30030305|Name=Peptidase_M14 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1721bp
AGATAATTCAGAATTTACCTGCTAGATTAATTTAATTAATTTGAAATTTG
TATTAAACATTTATTGGCAGATGTGCCATCAAATACACGAATGATGTAGA
ATTATCGCTGCACAAATCCATCCAAGTGCTTACACAACCACACTGTCAAT
GCGTCACATGTTAGTTTTGCATTGAAAATATCTACCAAATCATGCCTACT
AAAATTTATACAAATTACCTTCATAGACAAAACTCCCTCGCATCATTTTT
CTAATGGTATCGATGCATCCTAGTTCAGGCTGTGCCCTAATTTCTGTTCT
GTTCCTAGGATTTATCAGCAGCTTTCGATACGATGGTTTTTCAGTGATTG
ACATAGCTCCCCAGAGGTTTCAGGATGTTTCAAAAATAAGAAAATTTTCA
AAGATCTTTGAGAACGATGAAATAAGCTTTCAATTTATCCGGCCACCTTA
CCGGCCGAATAGTAATATCAGTGTGATTGTTTCGCCATGGGCCAAAGAAA
AGCTTTTAACTCTATTAAATGAAGAATCAATCTCATATATTACTACGATT
GGGAATTATCAAAATTTAATAGATCGTGAGTTTGCAGAAAACAGACAGGC
GATCTTCCAAAGCTTATTCAGGACGGGCTCCAACTCCGATCATATAGCCT
ACTTGCGCTATCAACAAATCGAGGAATGGATCAAGGAGAAAGTTCAAGGA
GTAAATTACGCGAAATTTGTGAAATTCGGTGAAACCTATGAGAATCGGAA
GTTGTTTATGGTGAAGCTCTCAAAAAATGACAGCCTTCCTATCGTCTGGC
TCGACGGAGGAATTCACGCAAGAGAATGGATTGCTACAAGTTCCGCTCTG
TTTATTATAGACAAATTGCTAAGGAATTCTTCTGAAACGTGGGAAATTCT
GTCGAAATACCAATTCTATGTCGTGCCTTTGGTGAATCCAGATGGATATG
AATACAGCCATGAGACACATCGGTTATGGAGAAAAAACAGATCTAGATTT
ACGTTTTCTAAATGCATTGGGGTAGACATGAACAGGAATTTCCCGTTTGA
ATGGGGAGGAGCCAGTTCTTCTCCGAATCCATGTGATGACCAATATCGAG
GACCGAATGCAGGATCAGAAAAAGAGATTCAATCCATCATTAGTGAACTG
ACAAAGTATAAAGATCGAATAAAGTTAGTAGTCAGCCTCCATGCCTTTGG
TCAGTATATCCTACAACCGTTTGGGTTTAGCAATGAGCATTATCCATTGA
ACTACTTGGATATGACAAGTGTTGCGATATCTGCTGCTTTTGACCTTCAA
ACGAAACATGATGCCCTCTATTTGGTAGGAAGGCCTCCTGATATTCTTTA
TCCAGCCAGTGGAAGCTCAGATGACTTTGTGGTTGGAACTCTGAAAATCC
CTTTCAGTTTTACCGTTGAATTACCAGATCAAGGAATGCACGGATTTACA
CTGCCTCCAAAATACATAAAGTCCGTTGGATCGCAGCTCTGGGATATAAT
CATCACTCTGACATCAGAGATTTATAGAACAGCTTTATATTAGTGAATTT
TATCATTGCCACCGCAAAGAATTTCTTAAAGCCGGAACTGGTTTTGAAAT
GTCCTAATCTTTGATTTGTCCGTCAATTATTTTATTATAACGTTGATTTG
TTGTTAGAAATTTATTCAAATGTTAAAATTTGGACCTTTTAACAATATAA
AAAGTTTTTTTTGGAAAAAAA
back to top

protein sequence of SMED30030305-orf-1

>SMED30030305-orf-1 ID=SMED30030305-orf-1|Name=SMED30030305-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=430bp
MVSMHPSSGCALISVLFLGFISSFRYDGFSVIDIAPQRFQDVSKIRKFSK
IFENDEISFQFIRPPYRPNSNISVIVSPWAKEKLLTLLNEESISYITTIG
NYQNLIDREFAENRQAIFQSLFRTGSNSDHIAYLRYQQIEEWIKEKVQGV
NYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALF
IIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFT
FSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELT
KYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQT
KHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTL
PPKYIKSVGSQLWDIIITLTSEIYRTALY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036990M14A-like_propep
IPR000834Peptidase_M14
IPR003146M14A_act_pep
IPR009020Propept_inh
Vocabulary: molecular function
TermDefinition
GO:0004180carboxypeptidase activity
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000834Peptidase M14, carboxypeptidase APRINTSPR00765CRBOXYPTASEAcoord: 179..193
score: 44.49
coord: 158..170
score: 28.85
coord: 256..264
score: 69.44
coord: 310..323
score: 27.47
IPR000834Peptidase M14, carboxypeptidase ASMARTSM00631zn_carbcoord: 133..411
e-value: 3.4E-91
score: 318.9
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 151..413
e-value: 2.6E-69
score: 234.2
IPR000834Peptidase M14, carboxypeptidase APROSITEPS00132CARBOXYPEPT_ZN_1coord: 179..201
IPR036990Metallocarboxypeptidase-like, propeptideGENE3DG3DSA:3.30.70.340coord: 25..115
e-value: 6.3E-12
score: 47.2
IPR003146Carboxypeptidase, activation peptidePFAMPF02244Propep_M14coord: 34..109
e-value: 3.2E-8
score: 33.9
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 123..427
e-value: 5.4E-89
score: 300.4
NoneNo IPR availablePANTHERPTHR11705:SF86coord: 69..423
NoneNo IPR availablePANTHERPTHR11705PROTEASE FAMILY M14 CARBOXYPEPTIDASE A,Bcoord: 69..423
NoneNo IPR availableCDDcd03860M14_CP_A-B_likecoord: 133..423
e-value: 4.30846E-109
score: 321.784
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.625
NoneNo IPR availableSUPERFAMILYSSF54897Protease propeptides/inhibitorscoord: 24..112
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 130..423