NFKB repressing factor

Overview
NameNFKB repressing factor
Smed IDSMED30030301
Length (bp)1749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NFKB repressing factor (SMED30030301) t-SNE clustered cells

Violin plots show distribution of expression levels for NFKB repressing factor (SMED30030301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NFKB repressing factor (SMED30030301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NFKB repressing factor (SMED30030301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030301h1SMcG0009582 SmedASXL_014382SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030301h1SMcG0009582 SmedASXL_014382SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NFKB repressing factor vs. Ensembl Human
Match: NKRF (NFKB repressing factor [Source:HGNC Symbol;Acc:HGNC:19374])

HSP 1 Score: 66.2402 bits (160), Expect = 1.112e-10
Identity = 44/139 (31.65%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDD-DLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  ++   DL F R+  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  553 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 687          
BLAST of NFKB repressing factor vs. Ensembl Human
Match: NKRF (NFKB repressing factor [Source:HGNC Symbol;Acc:HGNC:19374])

HSP 1 Score: 66.2402 bits (160), Expect = 1.112e-10
Identity = 44/139 (31.65%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDD-DLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  ++   DL F R+  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  553 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 687          
BLAST of NFKB repressing factor vs. Ensembl Human
Match: NKRF (NFKB repressing factor [Source:HGNC Symbol;Acc:HGNC:19374])

HSP 1 Score: 66.2402 bits (160), Expect = 1.117e-10
Identity = 44/139 (31.65%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDD-DLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  ++   DL F R+  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  568 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 702          
BLAST of NFKB repressing factor vs. Ensembl Fly
Match: CG31301 (gene:FBgn0051301 transcript:FBtr0083087)

HSP 1 Score: 62.3882 bits (150), Expect = 5.939e-10
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 1
Query: 1087 KWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQD-DDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVV 1542
            K    R+T+ +  N +   NI  +     +  DP K++  SN G ++M  MGW    GLG++  G +EP+ + + N R GLG       + K    + R++++ ++ + D  D+ F+  F  +ER  +H+  R+ G+ S SY +    R L+ 
Sbjct:  246 KLNATRDTIKVEKNKD-GVNIKVTNESADSPCDP-KLDP-SNKGYRMMRLMGWTG-GGLGRLKQGREEPVCYLLKNNRNGLGL-----INPKGNFADYRRLIENYVRSDDIRDMQFEPTFSKEERTTLHQIARQFGLRSASYGSGESRRLLIT 389          
BLAST of NFKB repressing factor vs. Ensembl Zebrafish
Match: nkrf (NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-030616-73])

HSP 1 Score: 57.7658 bits (138), Expect = 2.956e-8
Identity = 45/143 (31.47%), Postives = 72/143 (50.35%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDL---GSSTDMKSFCNNVRKVLKEWISAQ-DDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPP 1626
            NIG +L+ KMGW       +    I EPI  +    R+GLG D+   GS    +    ++  +++ + S++  DDL F  + +N+ER  IH+  ++ G+ SKSY     +RFLVV+     E L   +    G+   Y L+ P
Sbjct:  723 NIGNQLLRKMGWTGGGLGREGDG-IAEPIKVKEQFTREGLGMDMDRHGSQLTKR----DIEDIIRNYASSERQDDLRFSTELNNEERRQIHQVSQRYGLRSKSYGQ-GRQRFLVVSRRVQKEQLIGQLLQE-GQVGRYELVKP 858          
BLAST of NFKB repressing factor vs. Ensembl Xenopus
Match: nkrf (NFKB repressing factor [Source:NCBI gene;Acc:733948])

HSP 1 Score: 62.3882 bits (150), Expect = 1.481e-9
Identity = 53/139 (38.13%), Postives = 81/139 (58.27%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQD-DDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMG  +  GLGK G+GI EPI  +    R+GLG    S T  K    ++ K+++ + ++ + DDL F ++  N+ER  IH+  +K G+ SKS+ + N ERFLVV+  R+ ++L H +   G       LMP
Sbjct:  654 NIGNQLLRKMG-WKGGGLGKEGEGISEPISVKEQFSREGLGLTSNSHTINK---RDIEKIIRNYAASYNQDDLTFSKELSNEERKYIHQISQKYGLKSKSHGHGN-ERFLVVSRKRNKQDLIHQLIQDGQVGSYALLMP 787          
BLAST of NFKB repressing factor vs. Ensembl Xenopus
Match: gpank1 (G-patch domain and ankyrin repeats 1 [Source:NCBI gene;Acc:779861])

HSP 1 Score: 50.0618 bits (118), Expect = 6.365e-6
Identity = 23/58 (39.66%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1204 NSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNN 1377
            + N+G K+M+K GWN E+GLG  G+G K P+   +   +KGLGF     + +  F  N
Sbjct:  244 DHNVGFKMMLKEGWNRESGLGPDGEGRKFPVKTLLKRDKKGLGFHTDQKSKVTHFSAN 301          
BLAST of NFKB repressing factor vs. Ensembl Mouse
Match: Nkrf (NF-kappaB repressing factor [Source:MGI Symbol;Acc:MGI:1924536])

HSP 1 Score: 63.1586 bits (152), Expect = 5.984e-10
Identity = 44/139 (31.65%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWI-SAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  S    DL F  +  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  553 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHSDLTFSTELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 687          
BLAST of NFKB repressing factor vs. Ensembl Mouse
Match: Nkrf (NF-kappaB repressing factor [Source:MGI Symbol;Acc:MGI:1924536])

HSP 1 Score: 62.7734 bits (151), Expect = 9.484e-10
Identity = 44/139 (31.65%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWI-SAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  S    DL F  +  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  647 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHSDLTFSTELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 781          
BLAST of NFKB repressing factor vs. UniProt/SwissProt
Match: sp|O15226|NKRF_HUMAN (NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.341e-10
Identity = 44/139 (31.65%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDD-DLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  ++   DL F R+  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  553 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 687          
BLAST of NFKB repressing factor vs. UniProt/SwissProt
Match: sp|Q8BY02|NKRF_MOUSE (NF-kappa-B-repressing factor OS=Mus musculus OX=10090 GN=Nkrf PE=2 SV=3)

HSP 1 Score: 63.1586 bits (152), Expect = 4.186e-9
Identity = 44/139 (31.65%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWI-SAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMP 1623
            NIG +L+ KMGW          +GI+EPI  +  +KR+GLG D+     +     ++ ++++ +  S    DL F  +  N ER  IH+  +K G+ SKS+  V  +R+LVV   R  E+L   ++  G       +MP
Sbjct:  553 NIGNQLLRKMGWTGGGLGKSG-EGIREPISVKEQHKREGLGLDVERVNKIAK--RDIEQIIRNYARSESHSDLTFSTELTNDERKQIHQIAQKYGLKSKSH-GVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMP 687          
BLAST of NFKB repressing factor vs. TrEMBL
Match: V4ANW1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_113738 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.548e-21
Identity = 69/183 (37.70%), Postives = 103/183 (56.28%), Query Frame = 1
Query: 1090 WTLMRNTLYINDN---TESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDD-DLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPP 1626
            WT+   T+   DN   ++ +   DK ++   N  +  K   +SNIG KLM KMGW+   G+GK   G  EP++     +R GLG D  SS   K   N V K++ ++  + DD D+ F   F + ER VIH  CRK G+ SKSY +   +R+LV++  R P+ L+ ++ S+GG+T  Y L+PP
Sbjct:  265 WTMKYKTIVDADNDMLSKDSVMEDKEKV--SNEIEHGKKLGDSNIGSKLMKKMGWSG-GGIGKNQQGRAEPVLINKVVERSGLGADGKSS--QKELKNVVFKIVNDYYHSNDDTDIAFAPDFSSFERKVIHDACRKFGLKSKSYGS-GDDRYLVISRQRTPQELYQYVLSKGGETHKYKLIPP 441          
BLAST of NFKB repressing factor vs. TrEMBL
Match: A0A154PRB4 (NF-kappa-B-repressing factor OS=Dufourea novaeangliae OX=178035 GN=WN55_06925 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.813e-21
Identity = 85/235 (36.17%), Postives = 120/235 (51.06%), Query Frame = 1
Query:  943 LNMNFSEIDN--KLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINS--NSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSST--DMKSFCNNVRKVLKEWISAQ-DDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPP 1626
            L   F  ++N  K  + VN K LA + + L    A+   S   L+ LQK  +T+      I  N    AN+  + M    LND +K +S  + NIG KLM  MGW    GLGK   GI EP+  +    RKGLG    S T  D+K   N  + +++++++    DDLIF   F N ERA+IH+  R++G+ S SY     ER LVV+   D  +L   ++S GG T  Y L+ P
Sbjct:  170 LEWKFDRVNNSCKCSIFVNSKLLAEA-MGLTQKLAKKDASVIGLQKLQKYYYTIK-----IKQNIHGGANVTTTTM----LNDTSKEDSISDDNIGRKLMKLMGWTG-GGLGKSQQGIVEPVTIKQQISRKGLGLKSSSCTTNDLK---NKSKDIMRKYLAGDMKDDLIFSADFTNDERAIIHQVARQMGLKSNSYGP-KKERTLVVSRKIDIRDLVEELKSLGGVTSKYELIEP 389          
BLAST of NFKB repressing factor vs. TrEMBL
Match: A0A0L8IFX4 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22004994mg PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.537e-19
Identity = 79/262 (30.15%), Postives = 136/262 (51.91%), Query Frame = 1
Query:  871 FYLKNNRMVTSPSGILMESFQFFKLNMNF---SEIDNKL-HLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGD-GIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQD-DDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPPGSWL 1638
            F + +N MV   + IL  S  F K+ + +     ++     +L+N +S+    +    + A++ +S+  L  LQ+  WT++      +D+   + +   +E+ +K    P  I S+ N+G +L+ KMGW    G+G  G+ GI+ PI  +    R+GLG   G S     F +++  VL  ++ +++ +DL+F   F  +ERA++HKE RKL + S S       R+LV++  R+P  LF+ I   GG T  Y L+PP   L
Sbjct:  399 FLIMSNTMVNHATDILRRSANFNKMPIEYVYRPAVNGTCCRILLNEESIMEC-VAESKSKAKTAVSKKALEWLQEKCWTILIKQTADSDDVSLSRDELMNEIQKK---QPQAIPSD-NVGNQLLRKMGW-AGGGIGAEGNKGIENPITVDQVIDRQGLGCRSGVSAQ---FDSSIHDVLVNYVKSKNQNDLVFATNFSKQERAIMHKEARKLNLKSVS-RGTGASRYLVISRKRNPCQLFNHIMESGGSTMKYELIPPKKLL 650          
BLAST of NFKB repressing factor vs. TrEMBL
Match: A0A088A109 (Uncharacterized protein OS=Apis mellifera OX=7460 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.215e-19
Identity = 85/248 (34.27%), Postives = 131/248 (52.82%), Query Frame = 1
Query:  904 PSGILMESFQFFKLNMN--FSEIDN--KLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGDGIKEPII--HEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQ-DDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPP 1626
            P  IL+ +      N+   F +I +  K ++ VN K LA +    +   A+ + S   L  LQK  +T+      I  N    AN+  + M  KN++    I S+ NIG KLM  MGW+   GLGK   GI EPI+  H++  +  GL  +  S+ D+K  CN++   ++++++    +DLIF   F N ERA+IH+  R+LG+ S SY   N +R LVV+   D ++L   ++S GG T  Y L+ P
Sbjct:  158 PQNILVHAINASGGNLEWKFDKIGDSCKCNIFVNSKLLAEA-CSSNQKLAKKEASVIGLHELQKYYYTIK-----IKHNINRNANVIATTMI-KNISKDNYI-SDDNIGRKLMRLMGWSG-GGLGKSQQGIIEPIMIKHQISKEGLGLKSNFCSTNDLKFKCNDI---MRKYLTGDMRNDLIFSTDFTNDERAIIHQVARQLGLKSHSYGPKN-QRTLVVSRKIDVQDLVEELKSLGGVTNKYELIEP 392          
BLAST of NFKB repressing factor vs. TrEMBL
Match: K1QD27 (NF-kappa-B-repressing factor OS=Crassostrea gigas OX=29159 GN=CGI_10018874 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.174e-17
Identity = 74/243 (30.45%), Postives = 122/243 (50.21%), Query Frame = 1
Query:  946 NMNFSEIDNKLH---------LLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTL-MRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGD-GIKEPIIHEMGNK----RKGLGFDLGSSTDMKSFCNNVRKVLKEWI-SAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPP 1626
            +MN +E++   H         +L++G +L    +     +++S  S+  L  L++  WT+ ++  +   D +ES  + DK  M E  +    K  S+ NIG +L+ KMGW    G+G  G+ G+ EP+   M N     R+GLG     +  M  F   + +V+  +  S + DDL F  +F  +ERA IH+  +KLG+ ++S      ER+L+++  R    LF  I   GG T  Y L+PP
Sbjct:  424 DMNHAELEYDFHPDMSGTRCRVLLDGHNLVEY-MGTTKASSKSVASEKALERLKQICWTIKIKQAV---DASESEVSRDKV-MGE--IQKQVKTISDDNIGSRLLKKMGWTG-GGVGAKGNKGLAEPVAVTMTNHILLNREGLGLHGDHAKAMVDFKKKITEVIDNYAKSEKQDDLAFSPEFSKEERAFIHQYSQKLGLKTQS-RGTGSERYLIISRKRSVSQLFDHIMEEGGATHKYELIPP 657          
BLAST of NFKB repressing factor vs. Ensembl Cavefish
Match: nkrf (NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-030616-73])

HSP 1 Score: 53.5286 bits (127), Expect = 5.661e-7
Identity = 39/113 (34.51%), Postives = 58/113 (51.33%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWI-SAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVT 1545
            NIG +L+ KMGW    GLG+ G   +E           GLG D+    +  S   ++ ++++ +  S + DDL F  + +N ER  IH   +K G+ SKSY      RFLVV+
Sbjct:  627 NIGNQLLRKMGWTG-GGLGREGRFTRE-----------GLGMDMDRHGNQLS-KRDIEEIIRNYACSDRQDDLRFSTELNNDERKQIHHVSQKYGLRSKSYGQGR-HRFLVVS 725          
BLAST of NFKB repressing factor vs. Ensembl Cavefish
Match: nkrf (NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-030616-73])

HSP 1 Score: 53.5286 bits (127), Expect = 6.150e-7
Identity = 39/113 (34.51%), Postives = 58/113 (51.33%), Query Frame = 1
Query: 1210 NIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEW-ISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVT 1545
            NIG +L+ KMGW    GLG+ G   +E           GLG D+    +  S   ++ ++++ +  S + DDL F  + +N ER  IH   +K G+ SKSY      RFLVV+
Sbjct:  722 NIGNQLLRKMGWTG-GGLGREGRFTRE-----------GLGMDMDRHGNQLS-KRDIEEIIRNYACSDRQDDLRFSTELNNDERKQIHHVSQKYGLRSKSYGQ-GRHRFLVVS 820          
BLAST of NFKB repressing factor vs. Ensembl Nematostella
Match: EDO37369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ4])

HSP 1 Score: 81.6481 bits (200), Expect = 4.969e-17
Identity = 57/220 (25.91%), Postives = 114/220 (51.82%), Query Frame = 1
Query:  904 PSGILMESFQFFKLNMNFSEIDNK----LHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTIN 1551
            P  IL ES Q  K  +NF E+ +       +++  K +A+ +   +   A+   ++  L  L+  +  + +  +    + ++A  + K+E+  K   + + I   SN+G +L+ KMGW    G+GK G G  EP++    + ++GLG +     D      +V KV+ ++I++ D D+ F  +   ++RA++H+  ++ G+  +SY   + ER+LV++ N
Sbjct:   99 PISILTESAQKSKKTINFQELQSTNLFTCAVIIQDKLVATGEAS-NKKDAKRNAAENALDVLKSCQPVVKKRKI----DHDAATKVTKTELTMKAYEEASVI-PESNLGNQLLRKMGWKGSGGIGKEGQGRAEPVMVTGVDGKQGLGVN----QDTALHKGSVHKVILDFINSSDQDMKFSPELSKEDRALVHQLSKRYGLRHQSYGK-DAERYLVISKN 307          
BLAST of NFKB repressing factor vs. Ensembl Nematostella
Match: EDO48106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK53])

HSP 1 Score: 48.521 bits (114), Expect = 6.503e-6
Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 1
Query: 1114 YINDNTESAANIDKSEMYEKNLNDPTKIN-SNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSS 1350
            Y   N +  A    +  YE+    PTK     +NIG +++  MGW+E  GLGK G GI  PI   M ++  GLG   GSS
Sbjct:  886 YAPPNRKRKAGFTPTSPYEQ----PTKAKIPENNIGNQMLKAMGWSEGRGLGKEGQGIVNPIQATMRSQNAGLG-SRGSS 960          
BLAST of NFKB repressing factor vs. Ensembl Medaka
Match: nkrf (NFKB repressing factor [Source:NCBI gene;Acc:101158454])

HSP 1 Score: 51.6026 bits (122), Expect = 1.857e-6
Identity = 54/219 (24.66%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  913 ILMESFQFFKLNMN--FSEIDN---KLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKIN-SNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLG-SSTDMKSFCNNVRKVLKEWISA-QDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVT 1545
            I+ ++ QF K+  +  FS + +   +  + + G+ +A+   +    T +   +Q  L  L++T+  ++++ L+   ++++   I +S++  ++  +  +      NIG +L+ KMGW            I EPI  +    R+GLG D   + T +     ++ ++++ + ++ + DDL F     N ER  IH+  +K G+ SKSY     +RFLVV+
Sbjct:  534 IINDTAQFNKVTADYKFSVLQDHRWRCEVYLEGQFVAAG--IGPKKTVKHIAAQEALATLKQTQ-AVVKSNLWKEGHSDA---ISRSQILARSSEEAMRQEIKEDNIGNQLLRKMGWKGGGLGRDGEG-IAEPIRVKEQFSREGLGMDTDKAGTQLNK--RDIEEIIRNYATSDRQDDLRFSTDLTNDERKQIHQISQKYGLRSKSYGQ-GWQRFLVVS 742          
BLAST of NFKB repressing factor vs. Ensembl Medaka
Match: nkrf (NFKB repressing factor [Source:NCBI gene;Acc:101158454])

HSP 1 Score: 51.6026 bits (122), Expect = 1.857e-6
Identity = 54/219 (24.66%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  913 ILMESFQFFKLNMN--FSEIDN---KLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKIN-SNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLG-SSTDMKSFCNNVRKVLKEWISA-QDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVT 1545
            I+ ++ QF K+  +  FS + +   +  + + G+ +A+   +    T +   +Q  L  L++T+  ++++ L+   ++++   I +S++  ++  +  +      NIG +L+ KMGW            I EPI  +    R+GLG D   + T +     ++ ++++ + ++ + DDL F     N ER  IH+  +K G+ SKSY     +RFLVV+
Sbjct:  534 IINDTAQFNKVTADYKFSVLQDHRWRCEVYLEGQFVAAG--IGPKKTVKHIAAQEALATLKQTQ-AVVKSNLWKEGHSDA---ISRSQILARSSEEAMRQEIKEDNIGNQLLRKMGWKGGGLGRDGEG-IAEPIRVKEQFSREGLGMDTDKAGTQLNK--RDIEEIIRNYATSDRQDDLRFSTDLTNDERKQIHQISQKYGLRSKSYGQ-GWQRFLVVS 742          
BLAST of NFKB repressing factor vs. Planmine SMEST
Match: SMESG000051484.1 (SMESG000051484.1)

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 500/508 (98.43%), Postives = 504/508 (99.21%), Query Frame = 1
Query:  127 ILGVLYSHEIMKIIDDFDEAFPLIKCNFSIDKVNAIENTDIESTFKYYRTPKYAYAQSRVNFKFIDFIKSTNNLQKCTXXXXXXXXXXXXXXXTKPNECQKKLSDKFISYSDAIESDIYRDCVEKFREVYIQMKIVEVSMLSPKKIILNVASKTNQNIQFKFEKDIDKEICCQIILEKMILLGKTRHINKKLAKIQALKNLHLNLIGGIDVSKYFTATPLACPPELXXXXXXXXXXGSEFYDLPVLKNFYLKNNRMVTSPSGILMESFQFFKLNMNFSEIDNKLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPPGSWLIDVL 1650
            ILGVLYSHEIMKII DFDEAFPLIKCNFSIDKVNAIENTDIESTF+YYRTPKYAYAQSRVNFKFIDFIKSTNNLQKCTIE QEIPIQEPIQELTKPNECQK +SDKFISYSDAIESDIYRDCVEKFREVYIQMKIVEVSMLSPKKIILNVASKTNQNIQFKFEKDIDKEICCQIILEKMILLGKTRHINKKLAKIQALKNLHLNLIGGIDVSKYFTATPLACPPELDSDP SDPPPGSEFYDLPVLKNFYLKNNRMVTSPSGILMESFQFFKLNMNFSEIDNKLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSN+GGKLMMKMGWNEE+GLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPPGSWLIDVL
Sbjct:   43 ILGVLYSHEIMKIIYDFDEAFPLIKCNFSIDKVNAIENTDIESTFEYYRTPKYAYAQSRVNFKFIDFIKSTNNLQKCTIEPQEIPIQEPIQELTKPNECQKIVSDKFISYSDAIESDIYRDCVEKFREVYIQMKIVEVSMLSPKKIILNVASKTNQNIQFKFEKDIDKEICCQIILEKMILLGKTRHINKKLAKIQALKNLHLNLIGGIDVSKYFTATPLACPPELDSDPGSDPPPGSEFYDLPVLKNFYLKNNRMVTSPSGILMESFQFFKLNMNFSEIDNKLHLLVNGKSLASSDLMLDNTTARSQLSQFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSNSNVGGKLMMKMGWNEESGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTDMKSFCNNVRKVLKEWISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKSYNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPPGSWLIDVL 550          

HSP 2 Score: 58.9214 bits (141), Expect = 7.368e-9
Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = 2
Query:    2 MNCKENELPGYAKYKNHFTNNFKTAY 79
            MNCKENELPGYAKYKNHFTNNFKTAY
Sbjct:    1 MNCKENELPGYAKYKNHFTNNFKTAY 26          
The following BLAST results are available for this feature:
BLAST of NFKB repressing factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NKRF1.112e-1031.65NFKB repressing factor [Source:HGNC Symbol;Acc:HGN... [more]
NKRF1.112e-1031.65NFKB repressing factor [Source:HGNC Symbol;Acc:HGN... [more]
NKRF1.117e-1031.65NFKB repressing factor [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NFKB repressing factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG313015.939e-1028.10gene:FBgn0051301 transcript:FBtr0083087[more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nkrf2.956e-831.47NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nkrf1.481e-938.13NFKB repressing factor [Source:NCBI gene;Acc:73394... [more]
gpank16.365e-639.66G-patch domain and ankyrin repeats 1 [Source:NCBI ... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nkrf5.984e-1031.65NF-kappaB repressing factor [Source:MGI Symbol;Acc... [more]
Nkrf9.484e-1031.65NF-kappaB repressing factor [Source:MGI Symbol;Acc... [more]
back to top
BLAST of NFKB repressing factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O15226|NKRF_HUMAN5.341e-1031.65NF-kappa-B-repressing factor OS=Homo sapiens OX=96... [more]
sp|Q8BY02|NKRF_MOUSE4.186e-931.65NF-kappa-B-repressing factor OS=Mus musculus OX=10... [more]
back to top
BLAST of NFKB repressing factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4ANW17.548e-2137.70Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A154PRB47.813e-2136.17NF-kappa-B-repressing factor OS=Dufourea novaeangl... [more]
A0A0L8IFX42.537e-1930.15Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A088A1094.215e-1934.27Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
K1QD272.174e-1730.45NF-kappa-B-repressing factor OS=Crassostrea gigas ... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nkrf5.661e-734.51NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-0... [more]
nkrf6.150e-734.51NFKB repressing factor [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NFKB repressing factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NFKB repressing factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO373694.969e-1725.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481066.503e-638.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NFKB repressing factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nkrf1.857e-624.66NFKB repressing factor [Source:NCBI gene;Acc:10115... [more]
nkrf1.857e-624.66NFKB repressing factor [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of NFKB repressing factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051484.17.368e-998.43SMESG000051484.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030301 ID=SMED30030301|Name=NFKB repressing factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1749bp
AATGAATTGTAAAGAGAATGAATTACCTGGATATGCAAAATATAAAAATC
ATTTCACCAATAATTTTAAGACTGCTTATAATATAAAAAATATTATTGCT
ATTTCAATTGCTATGCCAATTATAAAATATTAGGTGTACTTTATTCTCAT
GAAATTATGAAAATTATTGACGATTTTGACGAAGCTTTTCCATTAATCAA
ATGTAACTTTTCAATAGACAAAGTCAATGCAATAGAAAATACTGATATCG
AATCTACGTTTAAATATTATAGAACTCCAAAATACGCTTATGCTCAGTCT
AGAGTGAATTTTAAATTTATAGATTTTATTAAATCCACTAATAACCTTCA
AAAATGTACTATTGAACTACAAGAAATTCCAATTCAAGAGCCAATCCAAG
AATTAACAAAGCCAAATGAATGTCAAAAAAAATTATCTGATAAGTTTATT
AGCTATAGCGATGCAATCGAATCGGACATTTATCGAGACTGTGTCGAGAA
ATTCCGAGAAGTTTATATTCAAATGAAAATTGTCGAAGTGTCAATGTTAT
CACCAAAGAAAATCATTTTAAATGTTGCTTCAAAAACCAATCAAAATATA
CAATTCAAATTCGAGAAAGACATCGATAAAGAGATTTGTTGTCAAATAAT
TCTTGAAAAAATGATCCTTCTCGGCAAAACGCGTCACATTAACAAGAAAT
TAGCCAAAATTCAAGCACTGAAAAATCTACATCTTAATTTAATAGGAGGA
ATCGACGTGAGCAAATATTTCACAGCGACTCCTCTTGCTTGTCCACCTGA
GTTAGATTCTGATCCCGACAGCGATCCTCCTCCAGGATCTGAGTTTTATG
ATTTGCCGGTTCTCAAGAATTTCTATTTGAAAAATAATAGAATGGTGACC
AGTCCATCAGGAATTCTCATGGAGTCATTTCAGTTCTTCAAGCTCAATAT
GAACTTTTCTGAAATAGACAACAAACTGCATTTATTGGTCAATGGGAAAT
CTCTAGCTAGCAGCGATTTGATGCTGGATAACACGACAGCAAGGTCTCAG
CTGTCACAGTTTGTGTTGCGCCACTTGCAAAAGACCAAATGGACATTAAT
GAGGAACACATTGTACATCAATGACAACACCGAGTCTGCCGCCAATATTG
ATAAATCGGAAATGTATGAGAAAAATCTGAATGATCCAACGAAAATCAAT
TCAAATTCAAATATCGGCGGGAAATTGATGATGAAAATGGGCTGGAATGA
AGAAAATGGTCTCGGTAAAATTGGCGATGGAATCAAAGAGCCAATTATTC
ACGAGATGGGCAATAAACGCAAAGGACTTGGATTTGATTTGGGGTCGTCG
ACAGACATGAAAAGCTTCTGCAACAATGTCAGAAAAGTTCTGAAGGAATG
GATATCAGCACAGGATGACGACTTGATATTCGACCGGCAGTTTGACAATA
AAGAACGGGCTGTGATACACAAGGAGTGCCGGAAACTGGGAGTCAGCAGC
AAGTCCTATAATAATGTCAATGGAGAGCGGTTTCTTGTGGTGACAATCAA
TCGGGACCCGGAAAACCTTTTCCACTGGATTCAGTCAAGGGGAGGCAAAA
CAAAACTGTACACATTGATGCCGCCGGGAAGCTGGCTGATTGATGTGTTG
TGATGATTCCGTGCAAGACCTATGCAAATATGTGTGTAAATAAATTTTTA
TTCCAGTTGTGTGGAGATGCTTGTGTGGACATTTCAATGGAAATTTCAC
back to top

protein sequence of SMED30030301-orf-1

>SMED30030301-orf-1 ID=SMED30030301-orf-1|Name=SMED30030301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MKIIDDFDEAFPLIKCNFSIDKVNAIENTDIESTFKYYRTPKYAYAQSRV
NFKFIDFIKSTNNLQKCTIELQEIPIQEPIQELTKPNECQKKLSDKFISY
SDAIESDIYRDCVEKFREVYIQMKIVEVSMLSPKKIILNVASKTNQNIQF
KFEKDIDKEICCQIILEKMILLGKTRHINKKLAKIQALKNLHLNLIGGID
VSKYFTATPLACPPELDSDPDSDPPPGSEFYDLPVLKNFYLKNNRMVTSP
SGILMESFQFFKLNMNFSEIDNKLHLLVNGKSLASSDLMLDNTTARSQLS
QFVLRHLQKTKWTLMRNTLYINDNTESAANIDKSEMYEKNLNDPTKINSN
SNIGGKLMMKMGWNEENGLGKIGDGIKEPIIHEMGNKRKGLGFDLGSSTD
MKSFCNNVRKVLKEWISAQDDDLIFDRQFDNKERAVIHKECRKLGVSSKS
YNNVNGERFLVVTINRDPENLFHWIQSRGGKTKLYTLMPPGSWLIDVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000467G_patch_dom
IPR001374R3H_dom