Transmembrane protein 231

Overview
NameTransmembrane protein 231
Smed IDSMED30030299
Length (bp)990
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 231 (SMED30030299) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 231 (SMED30030299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 231 (SMED30030299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 231 (SMED30030299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030299SMESG000037208.1 SmedASXL_009533SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030299SMESG000037208.1 dd_Smed_v6_13432_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030299SMESG000037208.1 dd_Smed_v4_13432_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 75.8702 bits (185), Expect = 6.440e-15
Identity = 49/144 (34.03%), Postives = 74/144 (51.39%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFG---SHYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKR 872
            Q++A  +  + VPG QL     L+L QK PL  G   + YN S    T+  A D  L  ++  Y  RN T +L+    ++    A  +P   N    IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  +
Sbjct:  154 QSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAI--IRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 295          
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 49/144 (34.03%), Postives = 74/144 (51.39%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFG---SHYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKR 872
            Q++A  +  + VPG QL     L+L QK PL  G   + YN S    T+  A D  L  ++  Y  RN T +L+    ++    A  +P   N    IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  +
Sbjct:  183 QSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAI--IRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 324          
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 57.3806 bits (137), Expect = 6.722e-9
Identity = 28/85 (32.94%), Postives = 46/85 (54.12%), Query Frame = 3
Query:  618 VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKR 872
            ++  Y  RN T +L+    ++    A  +P   N    IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  +
Sbjct:  165 IVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAI--IRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 247          
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 79.7221 bits (195), Expect = 1.818e-16
Identity = 55/187 (29.41%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  354 IKFKYFRANFSKQCYWSSCFGCFRL*IDTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHP 899
            +  K     FS Q   +  +  FR+   T + QT  LA  +    VPG QL     L+L Q+ PLP  G H  Y+ +++  +S      D   +++ Y +RN T  L     +  WT    + A F +  +I Y  + + Y   FW ++KFAW+QY+S++ IF   F  ++ ++F  +++ T  I P
Sbjct:  123 VPLKPAEQMFSVQLLLTFSYQLFRM--STVVMQT--LAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRGLHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPV--WTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITIPP 303          
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 57.3806 bits (137), Expect = 4.870e-9
Identity = 28/94 (29.79%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  618 VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHP 899
            +++ Y +RN T  L     +  WT    + A F +  +I Y  + + Y   FW ++KFAW+QY+S++ IF   F  ++ ++F  +++ T  I P
Sbjct:  164 IIRLYQQRNLTTHLSGVIPV--WTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITIPP 255          
BLAST of Transmembrane protein 231 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:100145127])

HSP 1 Score: 82.8037 bits (203), Expect = 1.935e-17
Identity = 54/164 (32.93%), Postives = 86/164 (52.44%), Query Frame = 3
Query:  432 IDTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNSADDPYLVMKN----YMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVPS 908
            + TF+ Q+ AL  +     +PG QL     LKL Q+ PL   G    Y+ +++  +S       + N    Y  RN T +L+    ++    A + P  F +   IRY  +S+ Y+  FW  LK+AW+QY+SI+ IF   F+R++ +VF  + V TT+  P+PS
Sbjct:  147 MSTFIMQSMALIQYSS--PIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINRSSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDP--FVIKAVIRYPVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQNQ-VLTTVPGPIPS 305          
BLAST of Transmembrane protein 231 vs. Ensembl Mouse
Match: Tmem231 (transmembrane protein 231 [Source:MGI Symbol;Acc:MGI:2685024])

HSP 1 Score: 82.8037 bits (203), Expect = 1.516e-17
Identity = 53/158 (33.54%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS--ADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F+ Q++A  +  ++VPG QL     L+L QK PL + G    Y+ +++   S  A D  L  ++  Y  RN T +L     +  W     + A F +   IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T+I   VP
Sbjct:  151 FEMQSMAFLQSSFAVPGSQLYVNGDLRLQQKQPLSYRGLDIRYNVSVINGTSPFAQDYDLTHIVAAYQERNVTTVLSDPNPI--WLVGRAAEAPFVIHAVIRYPTEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVV-TSIPVAVP 305          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|A7MB75|TM231_BOVIN (Transmembrane protein 231 OS=Bos taurus OX=9913 GN=TMEM231 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.048e-17
Identity = 54/158 (34.18%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGS---HYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F  Q++A  +  +++PG QL     L+L QK PL +G     YN S    T+  A D  L  ++  Y  RN T IL   + +  W     + A F +   IRY  + + YL  FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T  +  +P
Sbjct:  151 FVMQSMAFLQSSFALPGSQLYVNGDLRLQQKQPLGYGGLDVRYNVSVINGTSPFASDYDLTRIVAAYQERNVTTILTDPSPI--WLVGRAAEAPFVVNAVIRYPVEVISYLPGFWEMIKFAWIQYVSILLIFLWAFERIKRFVFQNQVVTTIPVTAMP 306          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|F7B645|TM231_XENTR (Transmembrane protein 231 OS=Xenopus tropicalis OX=8364 GN=tmem231 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.857e-17
Identity = 54/164 (32.93%), Postives = 86/164 (52.44%), Query Frame = 3
Query:  432 IDTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNSADDPYLVMKN----YMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVPS 908
            + TF+ Q+ AL  +     +PG QL     LKL Q+ PL   G    Y+ +++  +S       + N    Y  RN T +L+    ++    A + P  F +   IRY  +S+ Y+  FW  LK+AW+QY+SI+ IF   F+R++ +VF  + V TT+  P+PS
Sbjct:  147 MSTFIMQSMALIQYSS--PIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINRSSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDP--FVIKAVIRYPVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQNQ-VLTTVSGPIPS 305          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q3U284|TM231_MOUSE (Transmembrane protein 231 OS=Mus musculus OX=10090 GN=Tmem231 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.060e-16
Identity = 53/158 (33.54%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS--ADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F+ Q++A  +  ++VPG QL     L+L QK PL + G    Y+ +++   S  A D  L  ++  Y  RN T +L     +  W     + A F +   IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T+I   VP
Sbjct:  151 FEMQSMAFLQSSFAVPGSQLYVNGDLRLQQKQPLSYRGLDIRYNVSVINGTSPFAQDYDLTHIVAAYQERNVTTVLSDPNPI--WLVGRAAEAPFVIHAVIRYPTEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVV-TSIPVAVP 305          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q5RBT8|TM231_PONAB (Transmembrane protein 231 OS=Pongo abelii OX=9601 GN=TMEM231 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.920e-16
Identity = 54/155 (34.84%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFG---SHYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            Q++A  +  + VPG QL     L+L QK PL  G   + YN S    T+  A D  L  V+  Y  RN T IL+    ++    A  +P   N    IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T  +   P
Sbjct:  154 QSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNVSVINGTSPFAYDYDLTHVIAAYQERNVTTILNDPNPIWLVGRAADAPFVINAI--IRYPVEVISYQPGFWEMVKFAWVQYVSILLIFVWVFERIKIFVFQNQVVTTIPVTATP 306          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q5FVM1|TM231_RAT (Transmembrane protein 231 OS=Rattus norvegicus OX=10116 GN=Tmem231 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.175e-16
Identity = 53/158 (33.54%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS--ADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F+ Q++A  +  ++VPG QL     L+L QK PL + G    Y+ +++   S  A D  L  ++  Y  RN T +L     +  W     + A F +   IRY  + + Y   FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T+I   VP
Sbjct:  151 FEMQSMAFLQSSFAVPGSQLHVNGDLRLQQKQPLSYRGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTVLSDPNPI--WLVGRAAEAPFVIDAVIRYPVEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVV-TSIPVAVP 305          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A2C9K0K3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075234 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.882e-18
Identity = 48/153 (31.37%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS--ADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTI 890
            F  ++LA  E    +PG  L  +  L+L QK  L   G+   ++++++   S  AD   L  + KNY  RN T +L QD +   WT    S   F +   I Y  + + Y   FW  +K+ W+QY+S++ IF   F++V+ ++F  +LV T +
Sbjct:  149 FHMESLAYIEYVSPIPGASLHIFGDLRLRQKQLLGHKGTDIRFNSSLVNPASPYADSYSLATIFKNYTSRNVTTVL-QDANKI-WTSGRGSTNPFKITAVINYPEEVISYTPGFWNLIKWGWVQYVSVLLIFLYIFNKVKVFIFQHQLVPTIV 299          

HSP 2 Score: 46.595 bits (109), Expect = 5.882e-18
Identity = 47/146 (32.19%), Postives = 73/146 (50.00%), Query Frame = 1
Query:    1 EIFNHSEFRIHKTHIFSKATVFNVXXXXXXXXXXXXXINASRDFWISEVHQFQIPNVTFLNQVILEVFFQNXXXXXXXXXXXXXXXINNDNFLNCNMSFVAVKTFRNSLVLGETIDEGLNLNIFVRTS-QNNVIGVHALVVLDYKL 435
            EIF+H E R +KT I SKAT+   LIL  TF+ P +++  S  FW+ E    + PNV F  + IL+V  Q+ S +  +           +  +   +    VK  R     G+   + LNL++ V  + ++ V+GV  L+   YKL
Sbjct:    5 EIFSHPELRRYKTSIISKATLLMFLILIITFIPPLIIVYRSYGFWLREATYREQPNVAFKKEFILQVDLQSGSPAVYSTFQ------QYNQLMQSYLRIPLVKA-REDDTNGDGKYDVLNLDLEVPMNVEDEVVGVKLLLFFYYKL 143          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: H3CTW6 (Transmembrane protein 231 OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.088e-16
Identity = 56/155 (36.13%), Postives = 87/155 (56.13%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYN-YSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            Q+LA  +   SVPG +L     L+L QK PLP    Y+ Y+ +++  +S    A D   V+ +Y  RN T +L     +++   A  SP  F L +RIRY  + + Y   FW ++KFAW+QY+S++ IF   F+RV+ +VF  +++ T    PVP
Sbjct:  155 QSLAYLQHSSSVPGAKLFISGDLRLQQKTPLPHRGVYDIYNVSVIDGSSPFASAYDLENVIGSYRERNLTTVLSYPEPVWTVGRAAGSP--FELNVRIRYPLEVISYRPGFWETIKFAWVQYVSVLLIFLWVFERVKRFVFRNQILTTI---PVP 304          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: H2MK03 (Transmembrane protein 231 OS=Oryzias latipes OX=8090 GN=tmem231 PE=4 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.652e-16
Identity = 56/154 (36.36%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYN-YSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPV 902
            Q+LA  +    VPG +L     L+L Q+ PLP    YN Y+ +++  +S    A D   ++++Y  RN T +L     +++  PA  SP  F L + IRY  + + Y   FW ++KFAW+QY+SI+ IF   F+RV+ +VF  + V TT+  PV
Sbjct:  153 QSLAFVQLASPVPGAKLFISGDLRLQQRTPLPHRGLYNIYNVSVIDGSSPFASAYDLENIVRSYQARNLTTVLSCPMPVWTVGPAAGSP--FELNVEIRYPVEVITYRPGFWETIKFAWIQYVSILLIFIWVFERVQRFVFQNQ-VLTTVSIPV 303          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A2Y9F8X1 (transmembrane protein 231 isoform X2 OS=Physeter macrocephalus OX=9755 GN=TMEM231 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.658e-16
Identity = 57/158 (36.08%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGS---HYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F  Q++A F+  ++VPG QL     L+L QK PL +G     YN S    T+  A D  L  ++  Y  RN T IL     +  W     + A F +   IRY  + + YL  FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T  +  VP
Sbjct:  151 FVMQSMAFFQSSFAVPGSQLYVNGDLRLQQKQPLSYGGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTILTDPNPI--WLVGRAAEAPFVINAVIRYPMEVISYLPGFWEMIKFAWIQYVSILLIFLWVFERIKRFVFQNQVVTTIPVTAVP 306          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A340XS07 (transmembrane protein 231 OS=Lipotes vexillifer OX=118797 GN=TMEM231 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.903e-16
Identity = 57/158 (36.08%), Postives = 82/158 (51.90%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGS---HYNYSANILTTNSADDPYL--VMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVP 905
            F  Q++A F+  ++VPG QL     L+L QK PL  G     YN S    T+  A D  L  ++  Y  RN T IL     +  W     + A F +   IRY  + + YL  FW  +KFAW+QY+SI+ IF   F+R++ +VF  ++V T  +  VP
Sbjct:  151 FVMQSMAFFQSSFAVPGSQLYVNGDLRLQQKQPLSHGGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTILTDPNPI--WLVGRAAEAPFVINAVIRYPMEVISYLPGFWEMIKFAWIQYVSILLIFLWVFERIKRFVFQNQVVTTVPVRAVP 306          
BLAST of Transmembrane protein 231 vs. Ensembl Cavefish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:103032427])

HSP 1 Score: 80.8777 bits (198), Expect = 5.312e-17
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVAT 884
            Q++A  +   SVPG QL     L+L Q+ PLP  G H  Y+ +++ T S    + D   +++ Y  RN T  L   T ++    A  +P  F +   +RY  +++ Y   FW  +KFAW+QY+S++ +F   F+ ++ +VF  +++ T
Sbjct:  153 QSMAFIQHSSSVPGSQLFINGDLRLHQQIPLPHRGLHAAYNVSVVETGSPFATSYDLASIIRAYQARNLTTYLSCPTPVWIIGRAVNAP--FQINAEVRYPLETISYRPGFWEMIKFAWIQYVSVLLVFLWLFNHIQTFVFQNQVLPT 298          
BLAST of Transmembrane protein 231 vs. Ensembl Sea Lamprey
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 68.1662 bits (165), Expect = 2.115e-16
Identity = 44/151 (29.14%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTII 893
            Q++A  +    + G +L     L+L Q+ PL   G    Y+ +++  +S    A D   ++  Y  RN + +L    +M+    A T P   NL   IRY      Y   FW  +KF W+QY+S++ IF+  F R++ +VF  +++ T  I
Sbjct:  149 QSMALVQHSSPLHGSELSVNGDLRLRQREPLAHRGLDTRYNVSVVNGSSPFAEAYDFTEIIHAYQERNVSTVLGNTMAMWKSGRAGTIPFVINLL--IRYPDAIDTYQPGFWEQIKFGWVQYVSVLLIFHWVFQRIKTFVFENQVLRTIPI 297          

HSP 2 Score: 33.8834 bits (76), Expect = 2.115e-16
Identity = 40/163 (24.54%), Postives = 65/163 (39.88%), Query Frame = 1
Query:    1 EIFNHSEFRIHKTHIFSKATVFNVXXXXXXXXXXXXXINASRDFWISEVHQFQIPNVTFLNQVILEVFFQNXXXXXXXXXXXXXXXINNDNFLNCNMSFVAVKTFRNSLVLGETI--------DEGLNLN----------IFVRTSQNNVIGVHALVVLDYKL 435
            E+F+H     ++T +FSKA++F V  L  T++ P L++  S+ FW+      + P V F   ++L                           L  N   +A  TF N   L   +        +E +NL+              T+ + V+GVH L+   YKL
Sbjct:    4 EVFSHPALVRYRTSLFSKASLFIVATLLLTYIPPLLVVYRSQGFWLRTASFVEQPTVKFNYDIML--------------------------LLETNSMPIAWSTFENLNSLLPKLHTPFVTAREEDVNLDGKADRLHCSLSMPMTAADEVVGVHLLLTFSYKL 140          
BLAST of Transmembrane protein 231 vs. Ensembl Nematostella
Match: EDO45914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA3])

HSP 1 Score: 63.1586 bits (152), Expect = 2.135e-11
Identity = 44/153 (28.76%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  447 FQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPF-GSHYNYSANIL-TTNSADDPY---LVMKNYMRRNFTVILDQDTSMFS-WTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATT 887
             Q ++LA       + G +      L L Q+  LP  G +  Y+  I+  T++  D Y    + K+Y++RN +    +  S +S WT    +   F +   + Y  +++ Y   FW  +K+AW+QYL+I+FIF   F +V+ +VF +++V+T 
Sbjct:  150 LQMESLACISMSSPIAGAEFSTVGDLTLKQRSLLPHKGIYSTYNVPIIDGTSTLVDSYNLHQIFKSYIKRNVST---EYVSPYSIWTGGRAAGQPFVVKGTVNYPEETIMYRPGFWQMIKWAWVQYLAILFIFLFVFSQVKRFVFEEQIVSTV 299          
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 89.3521 bits (220), Expect = 6.219e-20
Identity = 56/154 (36.36%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  456 QALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYN-YSANILTTNS----ADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPV 902
            Q+LA  +    VPG +L     L+L Q+ PLP    YN Y+ +++  +S    A D   ++++Y  RN T +L     +++  PA  SP  F L + IRY  + + Y   FW ++KFAW+QY+SI+ IF   F+RV+ +VF  + V TT+  PV
Sbjct:  153 QSLAFVQLASPVPGAKLFISGDLRLQQRTPLPHRGLYNIYNVSVIDGSSPFASAYDLENIVRSYQARNLTTVLSCPMPVWTVGPAAGSP--FELNVEIRYPVEVITYRPGFWETIKFAWIQYVSILLIFIWVFERVQRFVFQNQ-VLTTVSIPV 303          
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 57.3806 bits (137), Expect = 3.552e-9
Identity = 48/158 (30.38%), Postives = 73/158 (46.20%), Query Frame = 3
Query:  432 IDTFMFQTQ-ALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYNYSANILTTNSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPV 902
            +D   FQ Q  L + E+ YSV      +Y     +     PF S Y+                ++++Y  RN T +L     +++  PA  SP  F L + IRY  + + Y         FAW+QY+SI+ IF   F+RV+ +VF  + V TT+  PV
Sbjct:  114 LDLLTFQLQLPLKNNEQVYSVQLLLTFSYQLFVSVIDGSSPFASAYDLEN-------------IVRSYQARNLTTVLSCPMPVWTVGPAAGSP--FELNVEIRYPVEVITY------PFCFAWIQYVSILLIFIWVFERVQRFVFQNQ-VLTTVSIPV 249          
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Match: SMESG000037208.1 (SMESG000037208.1)

HSP 1 Score: 338.961 bits (868), Expect = 1.676e-154
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 3
Query:  435 DTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYNYSANILTTNSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVPSKTTVDFM 929
            DTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYNYSANILTTNSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVPSKTTVDFM
Sbjct:  152 DTFMFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYNYSANILTTNSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTIIHPVPSKTTVDFM 316          

HSP 2 Score: 226.483 bits (576), Expect = 1.676e-154
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query:    1 EIFNHSEFRIHKTHIFSKATVFNVXXXXXXXXXXXXXINASRDFWISEVHQFQIPNVTFLNQVILEVFFQNXXXXXXXXXXXXXXXINNDNFLNCNMSFVAVKTFRNSLVLGETIDEGLNLNIFVRTSQNNVIGVHALVVLDYKL 435
            EIFNHSEFRIHKTHIFSKATVFNVLILFFTFLLPFLLINASRDFWISEVHQFQIPNVTFLNQVILEVFFQNSSKSWSTVSSYKTKYINNDNFLNCNMSFVAVKTFRNSLVLGETIDEGLNLNIFVRTSQNNVIGVHALVVLDYKL
Sbjct:    6 EIFNHSEFRIHKTHIFSKATVFNVLILFFTFLLPFLLINASRDFWISEVHQFQIPNVTFLNQVILEVFFQNSSKSWSTVSSYKTKYINNDNFLNCNMSFVAVKTFRNSLVLGETIDEGLNLNIFVRTSQNNVIGVHALVVLDYKL 150          
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Match: SMESG000054111.1 (SMESG000054111.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.996e-6
Identity = 39/138 (28.26%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  498 QQLIAYSRLKLIQKYPLPF--------GSHYNYS--ANILTTNSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYAPQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVA 881
            ++L+   RL + QK  LP          ++YN S  AN+L     + P     N   RNFT+ L   ++ +  +P   +P  F + + I Y P  ++Y + FW  +K+AW+Q+   + +F   F R + +VF    V+
Sbjct:  158 RKLVVTGRLDVYQKRRLPNSGVLTIYNNTYYNSSSSANVLANPFDNLP----GNISGRNFTLKLMDLSTGWQLSP---NPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 288          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 231 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM2316.440e-1534.03transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2311.136e-1434.03transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2316.722e-932.94transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2311.818e-1629.41transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
tmem2314.870e-929.79transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2311.935e-1732.93transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem2311.516e-1733.54transmembrane protein 231 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7MB75|TM231_BOVIN2.048e-1734.18Transmembrane protein 231 OS=Bos taurus OX=9913 GN... [more]
sp|F7B645|TM231_XENTR8.857e-1732.93Transmembrane protein 231 OS=Xenopus tropicalis OX... [more]
sp|Q3U284|TM231_MOUSE1.060e-1633.54Transmembrane protein 231 OS=Mus musculus OX=10090... [more]
sp|Q5RBT8|TM231_PONAB1.920e-1634.84Transmembrane protein 231 OS=Pongo abelii OX=9601 ... [more]
sp|Q5FVM1|TM231_RAT3.175e-1633.54Transmembrane protein 231 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Transmembrane protein 231 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K0K35.882e-1831.37Uncharacterized protein OS=Biomphalaria glabrata O... [more]
H3CTW61.088e-1636.13Transmembrane protein 231 OS=Tetraodon nigroviridi... [more]
H2MK031.652e-1636.36Transmembrane protein 231 OS=Oryzias latipes OX=80... [more]
A0A2Y9F8X11.658e-1636.08transmembrane protein 231 isoform X2 OS=Physeter m... [more]
A0A340XS071.903e-1636.08transmembrane protein 231 OS=Lipotes vexillifer OX... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2315.312e-1731.08transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2312.115e-1629.14transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO459142.135e-1128.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2316.219e-2036.36transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
tmem2313.552e-930.38transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037208.11.676e-154100.00SMESG000037208.1[more]
SMESG000054111.11.996e-628.26SMESG000054111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030299 ID=SMED30030299|Name=Transmembrane protein 231|organism=Schmidtea mediterranea sexual|type=transcript|length=990bp
GAAATATTTAATCATTCTGAATTTAGAATTCACAAAACACATATATTTTC
CAAAGCTACAGTTTTTAATGTTTTGATATTATTTTTCACATTTCTTTTAC
CATTTTTATTGATCAATGCTAGTAGAGATTTTTGGATAAGTGAAGTACAT
CAATTTCAAATACCCAATGTGACATTTTTAAACCAAGTAATATTAGAAGT
CTTTTTCCAGAATTCTTCAAAAAGCTGGTCAACTGTATCTAGTTATAAAA
CAAAATATATTAACAATGATAATTTTTTGAATTGCAATATGTCATTTGTA
GCCGTTAAAACATTTAGAAACAGTTTAGTACTTGGAGAAACTATTGATGA
AGGATTAAATTTAAATATTTTCGTGCGAACTTCTCAAAACAATGTTATTG
GAGTTCATGCTTTGGTTGTTTTAGATTATAAATTGATACTTTTATGTTTC
AAACACAAGCATTAGCCAGTTTTGAAAGATTTTATTCAGTACCTGGGCAG
CAGCTAATTGCATACAGCAGATTGAAATTAATACAAAAATACCCATTACC
GTTCGGTTCTCATTACAATTATTCGGCAAATATATTGACAACAAACTCAG
CTGACGATCCATATTTGGTGATGAAGAATTACATGAGGAGGAATTTCACT
GTTATTTTGGATCAAGATACGAGCATGTTTTCATGGACACCTGCTACTAC
TTCTCCAGCATTCTTTAATTTGTTTTTGAGAATTCGCTATGCACCTCAAT
CTGTCAGGTATTTATCGTCATTTTGGTATTCACTTAAATTTGCATGGCTT
CAATATTTATCAATAATGTTCATCTTTTATTTGTTTTTTGACCGGGTGAG
ATTTTATGTGTTCAGTAAGCGGCTGGTGGCCACAACTATTATCCATCCCG
TACCAAGCAAGACCACAGTGGACTTTATGTGAATAAAATTTGATTGATAG
CGATTATCTAATATTTTTATTATCAATTTTTTTATGTGAG
back to top

protein sequence of SMED30030299-orf-1

>SMED30030299-orf-1 ID=SMED30030299-orf-1|Name=SMED30030299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MFQTQALASFERFYSVPGQQLIAYSRLKLIQKYPLPFGSHYNYSANILTT
NSADDPYLVMKNYMRRNFTVILDQDTSMFSWTPATTSPAFFNLFLRIRYA
PQSVRYLSSFWYSLKFAWLQYLSIMFIFYLFFDRVRFYVFSKRLVATTII
HPVPSKTTVDFM*
back to top

protein sequence of SMED30030299-orf-2

>SMED30030299-orf-2 ID=SMED30030299-orf-2|Name=SMED30030299-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
EIFNHSEFRIHKTHIFSKATVFNVLILFFTFLLPFLLINASRDFWISEVH
QFQIPNVTFLNQVILEVFFQNSSKSWSTVSSYKTKYINNDNFLNCNMSFV
AVKTFRNSLVLGETIDEGLNLNIFVRTSQNNVIGVHALVVLDYKLILLCF
KHKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006029Neurotrans-gated_channel_TM
IPR019306TMEM231
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0007224smoothened signaling pathway
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005929cilium
GO:0016021integral component of membrane
GO:0035869ciliary transition zone
GO:0036038MKS complex
GO:0042995cell projection
GO:0060170ciliary membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019306Transmembrane protein 231PFAMPF10149TM231coord: 2..148
e-value: 1.4E-24
score: 87.0
IPR019306Transmembrane protein 231PANTHERPTHR14605CHST5 PROTEINcoord: 2..152
NoneNo IPR availableTMHMMTMhelixcoord: 110..132