Kinase, putative

Overview
NameKinase, putative
Smed IDSMED30030297
Length (bp)2150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase, putative (SMED30030297) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase, putative (SMED30030297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase, putative (SMED30030297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase, putative (SMED30030297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030297SMESG000029295.1 SMESG000029289.1 SmedASXL_015221SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30030297SMESG000029295.1 SMESG000029289.1 dd_Smed_v4_6822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030297SMESG000029295.1 SMESG000029289.1 dd_Smed_v4_6822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30030297SMESG000029295.1 dd_Smed_v4_22145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase, putative vs. Ensembl Human
Match: HASPIN (histone H3 associated protein kinase [Source:HGNC Symbol;Acc:HGNC:19682])

HSP 1 Score: 226.098 bits (575), Expect = 7.169e-63
Identity = 122/301 (40.53%), Postives = 174/301 (57.81%), Query Frame = 3
Query: 1017 VNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENF--KIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
             +D+E V  + C ++    F+   P +K +   K+GEG FGEVF  +     ++ IK I + G    NG  Q TF++I+ EI+++KELS L     NR   F+ + +V  V G +P    K WD  N  K S ND P  F   Q +I+++FEF G  LE    K+ S A A SIL Q   SLA AE  + FEHRDLHWGN+L+ K  L      Y L+GK   I   G+  ++IDYT SR+++   +V+ D+S D+D+F G GD QFD+YR M++ N N W  ++P +N+ WL YL +K+L
Sbjct:  457 ASDAEKVYGE-CSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVA-IKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLH--YTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKML 753          
BLAST of Kinase, putative vs. Ensembl Celegans
Match: hasp-1 (HASPin kinase related [Source:UniProtKB/TrEMBL;Acc:G5EE25])

HSP 1 Score: 202.986 bits (515), Expect = 9.708e-55
Identity = 115/315 (36.51%), Postives = 179/315 (56.83%), Query Frame = 3
Query: 1104 KEISKLGEGSFGEVFSIVDSEDKLSVIKFIP-----VNGSLY--YNGGPQTTFDDIISEIVVAKELSDLRIGTT-NRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTS-SQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDL-LVSREIIADEYKLKFDSLVHDIANSQSTAEFIT 2018
            + + KLGEG++GEVFS +  + K   IK +P      N   +  Y+     T D ++ E++V KELS LR     N   NF++M +  +V GK+P      WD  +KLK SEN  P  ++S  Q +IL      G  LE+F +ES  + +SI+ Q  LS+  AE  +EFEHRDLH GN+L+ +  +   EL Y + G+   ++ HG+   +ID+T SRI KG   VY D+  D  IF G  DPQF+VYR+M+++ K+ W  F+ +TN+ W+ Y+ N+L+D  +  + ++ ++ +++   L    A   S  E +T
Sbjct:  618 RRVKKLGEGAYGEVFSTI-WDGKPVAIKIVPFEKDGCNRQYFGEYHSEEMQTSDVVLPEVIVMKELSALRDEDAWNSTPNFIEMISAEVVMGKYPKGLLSAWDSYDKLKESENTRPDVYSSIDQNFILFVSANGGIALEDFVLESENELFSIIHQLVLSMNAAEAALEFEHRDLHLGNVLIDRNGV--KELYYTVHGQKVPLSTHGIKVNIIDFTLSRISKGATTVYWDLENDPAIFEGQDDPQFEVYREMRKNCKSNWKKFSRRTNLMWIVYIANRLIDTKICPKGLLTEKRRMELKVLFDRFAEFGSCGESLT 929          
BLAST of Kinase, putative vs. Ensembl Celegans
Match: hasp-2 (HASPin kinase related [Source:UniProtKB/TrEMBL;Acc:Q9BL96])

HSP 1 Score: 190.274 bits (482), Expect = 3.331e-53
Identity = 115/344 (33.43%), Postives = 196/344 (56.98%), Query Frame = 3
Query: 1011 YNVNDSESVVLKLCGKERYQNFASVFPMKK--RKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPV--NGSLYYNGGPQT-TFDDIISEIVVAKELSDLR-IGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSS-QKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSRE-IIADEYKLKFDSLVHDIANSQSTAEFIT 2018
            +N + S + +L++ G++  + + S+ P      +++ KLGEG++GEVFS V +   ++ IK +P   NG  Y N   +  T   ++SE++V KELS LR   + N   NF++M +  +V G++P    + WD  +KL  SE+  P  ++S  Q +IL      G  L +F +ES  + +SI+ Q  LS+  AE  +EFEHRDL+  N+L+ +  ++  EL+Y + G+   +  HG+   +ID+T SRI K    +Y D+ +D  IF G   PQF+VYR+M+++ +  W  F+ +TN+ W+ Y+ N+L+D  +  E +  D+ + +   L   +A   S  E +T
Sbjct:   74 HNKDPSMAQLLRVVGQKEAKPWGSL-PTSALDARKVKKLGEGAYGEVFSTVWNGRPVA-IKVLPFENNGCFYGNQSVEIPTTHAVLSEVIVMKELSALRDPNSWNSTPNFIEMISAQIVMGEYPKGLLRAWDAYDKLNESEHLRPDVYSSEHQNFILFVSANGGISLADFVLESEDELFSIIHQLVLSMVAAEAALEFEHRDLNLSNVLIDRNGVE--ELSYTVHGQKIPLRTHGIKVNIIDFTLSRISKDSTTIYWDLEEDTTIFEGPDAPQFEVYREMRENCRGNWEKFSRRTNLMWIVYIANRLIDTEICPEGLFTDKRRKELKHLFDRLAEFGSCEESLT 413          
BLAST of Kinase, putative vs. Ensembl Celegans
Match: VY10G11R.1 (pep chromosome:WBcel235:IV:16469580:16470881:-1 gene:WBGene00012159.1 transcript:VY10G11R.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:VY10G11R.1)

HSP 1 Score: 63.929 bits (154), Expect = 1.113e-10
Identity = 57/208 (27.40%), Postives = 93/208 (44.71%), Query Frame = 3
Query: 1119 LGEGSFGEVFSIVDSEDKLSVIKFIPV--NGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIK 1736
            LG G  G VF I   + K   +K +P+  N S +     +   D++I    ++ E+            NFVKM N  +V    PA   K++               +   + K+ +I  E  G PL     +S  Q  S + QT L++  A+  ++F+H D+H  NILV   + +   + Y++DG+  ++   GV  T+ID   SR K
Sbjct:   83 LGSGVMGSVFLIDWQKSKKVALKLVPLTQNSSWHLC---KVEVDNLIKIRQISSEVP-----------NFVKMLNNCIVES-IPAEVCKKF---------------QLLQNTKYSVIILENGGEPLAKKIFKSDEQIISAVAQTMLAMCVAKRRLDFQHVDIHDKNILV--SETESEIMEYVVDGRKVRVRACGVKVTIIDLQLSRFK 258          
BLAST of Kinase, putative vs. Ensembl Celegans
Match: C04G2.10 (pep chromosome:WBcel235:IV:10116255:10118084:1 gene:WBGene00007309.1 transcript:C04G2.10b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C04G2.10)

HSP 1 Score: 63.1586 bits (152), Expect = 1.919e-10
Identity = 55/227 (24.23%), Postives = 107/227 (47.14%), Query Frame = 3
Query: 1074 FASVFPMKKRKEIS-----------KLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYT 1721
            + ++  + KRK+++           KLGEG  G  +  V   + +  +K +P++ +        +   + + ++V  + L  ++  T N    ++   + F+++   PA  Q   DK N+L      +P+    +  ++ +  E     L+N  + +  +  SI+ Q  LSL  A+  ++  H D+H GN+LV KR      L Y LDGK  +I  HG++  +ID++
Sbjct:   44 YGNILDLVKRKKVTNWTQTRLVVEGKLGEGLRGIAYK-VKHRNTMKCLKLLPLSWT--------SRNKEALEDLVALRSLKTIKKETPN----YLTFFDSFVLT-NLPASTQ---DKLNQL------DPQ--CPATHYLGLLVELGSNSLDNTMLTTAVEGLSIVKQLVLSLVIAKRRLDTNHNDVHPGNVLV-KRSASPKTLKYTLDGKVIRIPSHGLVVGIIDFS 244          
BLAST of Kinase, putative vs. Ensembl Celegans
Match: C04G2.10 (pep chromosome:WBcel235:IV:10116768:10118084:1 gene:WBGene00007309.1 transcript:C04G2.10c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C04G2.10)

HSP 1 Score: 62.7734 bits (151), Expect = 2.305e-10
Identity = 55/227 (24.23%), Postives = 107/227 (47.14%), Query Frame = 3
Query: 1074 FASVFPMKKRKEIS-----------KLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYT 1721
            + ++  + KRK+++           KLGEG  G  +  V   + +  +K +P++ +        +   + + ++V  + L  ++  T N    ++   + F+++   PA  Q   DK N+L      +P+    +  ++ +  E     L+N  + +  +  SI+ Q  LSL  A+  ++  H D+H GN+LV KR      L Y LDGK  +I  HG++  +ID++
Sbjct:   40 YGNILDLVKRKKVTNWTQTRLVVEGKLGEGLRGIAYK-VKHRNTMKCLKLLPLSWT--------SRNKEALEDLVALRSLKTIKKETPN----YLTFFDSFVLT-NLPASTQ---DKLNQL------DPQ--CPATHYLGLLVELGSNSLDNTMLTTAVEGLSIVKQLVLSLVIAKRRLDTNHNDVHPGNVLV-KRSASPKTLKYTLDGKVIRIPSHGLVVGIIDFS 240          
BLAST of Kinase, putative vs. Ensembl Fly
Match: Haspin (gene:FBgn0046706 transcript:FBtr0113784)

HSP 1 Score: 221.476 bits (563), Expect = 2.983e-63
Identity = 120/324 (37.04%), Postives = 182/324 (56.17%), Query Frame = 3
Query: 1020 NDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLS------VIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSL 1973
            N  E  VLK C +     F + +   K     K+GEG++GEVF    +++ L       V+K IP+ GS   NG  Q TF  I+ EI++ K++  LR   TN    FV ++ V LV G++P +F K W+K +  K SEND+P+ F  +Q + +++ +FAG  + NFK  +  Q+Y  L Q  L+LA  E   +FEHRDLH GNIL+     +   +       +  +   GV  T+IDYT SR+       ++D+S+D+++F  TGD Q+DVYR M+   KN WS F+PKTNI WL+Y+  K+LD +  + I    +++  D +
Sbjct:  221 NKYEEDVLKYCHQCTPLPFNTAYEQHKLLNTKKIGEGAYGEVFRCSRNQEVLKDHISDIVLKIIPLEGSTVINGEKQKTFSQILPEIIITKKMCSLRTSKTNSTNGFVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLELKFAGSDMANFKFLNSEQSYYALQQIILALAVGEEEYQFEHRDLHLGNILI--EYTNKKHIVCTFKSSNLTLLSKGVNVTIIDYTLSRVTINDCCYFNDLSRDEELFQATGDYQYDVYRMMRNELKNNWSSFSPKTNIIWLSYVIVKVLDSVKYKSINTKVHRMYIDKI 542          
BLAST of Kinase, putative vs. Ensembl Zebrafish
Match: si:dkeyp-26a9.2 (si:dkeyp-26a9.2 [Source:ZFIN;Acc:ZDB-GENE-090313-379])

HSP 1 Score: 246.899 bits (629), Expect = 3.438e-69
Identity = 125/304 (41.12%), Postives = 188/304 (61.84%), Query Frame = 3
Query: 1014 NVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENF--KIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDL 1919
            +++D+E V  + C +    +F+   P  + K ++K+GEG+FGEVFS ++  ++   +K IPV GS   NG  Q TF +I+ EI+++KELS L +   N+   F+ + N+  V G +P    K WDK +  K SEND P  F   Q +++++FEF G  LEN   K+ S AQA S+L Q   SLA AE  + FEHRDLHWGNILV  +++      ++L+G  + I   GV   +IDY+ SR++     V  D+S D+++F+G GD QF++YR M++ NKN WS +NP +N+ WL YL +KLL +
Sbjct:  750 DISDAEKVYQE-CQQSGPLSFSDCIPPARMKHLNKIGEGTFGEVFSTINDSNESVALKIIPVEGSQQVNGEHQKTFGEILHEIIISKELSSLNLKEFNKSDGFIGLNNLHCVRGCYPEALLKAWDKFDHQKGSENDRPDFFDDEQLFLILEFEFGGSDLENMNGKLSSMAQAKSVLHQVTASLAVAEQALCFEHRDLHWGNILV--KNVKHKHNEFILNGTVHCIETRGVHVNIIDYSLSRLEIDGLTVSCDISSDEELFMGQGDYQFEIYRLMKKENKNCWSAYNPHSNVLWLHYLADKLLSM 1050          
BLAST of Kinase, putative vs. Ensembl Mouse
Match: Haspin (histone H3 associated protein kinase [Source:MGI Symbol;Acc:MGI:1194498])

HSP 1 Score: 234.187 bits (596), Expect = 3.232e-66
Identity = 121/291 (41.58%), Postives = 174/291 (59.79%), Query Frame = 3
Query: 1050 CGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFK--IESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLD 1916
            C +E    F+     +K +   K+GEG FGEVF I++ +  ++ +K I + G    NG  Q TF++I+ EI+++KELS L     NR   F+ + +V  V G +P    K WD  N  K S ND P  F   Q +I+++FEF G  LE  K  + S A A SIL Q   SLA AE  + FEHRDLHWGN+L+ K +L   EL Y L+GK   I  HG+   +IDYT SR+++   +V+ D+S ++D+F G GD QF++YR M++ NKN W  ++P  N+ WL YL +K+L+
Sbjct:  423 CNQEGPIPFSDCLSTEKLERCEKIGEGVFGEVFQIINDQAPVA-LKIIAIEGLDLVNGSHQKTFEEILPEIIISKELSLLSSEAYNRTEGFIGLNSVHCVQGLYPPLLLKAWDHYNTTKRSANDRPDFFQEDQLFIILEFEFGGVDLERMKTKLSSVATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTNLK--ELRYTLNGKTSTIPTHGLQVNIIDYTLSRLERDGIVVFCDISAEEDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILN 710          
BLAST of Kinase, putative vs. UniProt/SwissProt
Match: sp|Q9Z0R0|HASP_MOUSE (Serine/threonine-protein kinase haspin OS=Mus musculus OX=10090 GN=Haspin PE=1 SV=3)

HSP 1 Score: 234.187 bits (596), Expect = 2.087e-65
Identity = 121/291 (41.58%), Postives = 174/291 (59.79%), Query Frame = 3
Query: 1050 CGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFK--IESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLD 1916
            C +E    F+     +K +   K+GEG FGEVF I++ +  ++ +K I + G    NG  Q TF++I+ EI+++KELS L     NR   F+ + +V  V G +P    K WD  N  K S ND P  F   Q +I+++FEF G  LE  K  + S A A SIL Q   SLA AE  + FEHRDLHWGN+L+ K +L   EL Y L+GK   I  HG+   +IDYT SR+++   +V+ D+S ++D+F G GD QF++YR M++ NKN W  ++P  N+ WL YL +K+L+
Sbjct:  423 CNQEGPIPFSDCLSTEKLERCEKIGEGVFGEVFQIINDQAPVA-LKIIAIEGLDLVNGSHQKTFEEILPEIIISKELSLLSSEAYNRTEGFIGLNSVHCVQGLYPPLLLKAWDHYNTTKRSANDRPDFFQEDQLFIILEFEFGGVDLERMKTKLSSVATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTNLK--ELRYTLNGKTSTIPTHGLQVNIIDYTLSRLERDGIVVFCDISAEEDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILN 710          
BLAST of Kinase, putative vs. UniProt/SwissProt
Match: sp|P83103|HASP_DROME (Putative serine/threonine-protein kinase haspin homolog OS=Drosophila melanogaster OX=7227 GN=Haspin PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.990e-62
Identity = 120/324 (37.04%), Postives = 182/324 (56.17%), Query Frame = 3
Query: 1020 NDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLS------VIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSL 1973
            N  E  VLK C +     F + +   K     K+GEG++GEVF    +++ L       V+K IP+ GS   NG  Q TF  I+ EI++ K++  LR   TN    FV ++ V LV G++P +F K W+K +  K SEND+P+ F  +Q + +++ +FAG  + NFK  +  Q+Y  L Q  L+LA  E   +FEHRDLH GNIL+     +   +       +  +   GV  T+IDYT SR+       ++D+S+D+++F  TGD Q+DVYR M+   KN WS F+PKTNI WL+Y+  K+LD +  + I    +++  D +
Sbjct:  221 NKYEEDVLKYCHQCTPLPFNTAYEQHKLLNTKKIGEGAYGEVFRCSRNQEVLKDHISDIVLKIIPLEGSTVINGEKQKTFSQILPEIIITKKMCSLRTSKTNSTNGFVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLELKFAGSDMANFKFLNSEQSYYALQQIILALAVGEEEYQFEHRDLHLGNILI--EYTNKKHIVCTFKSSNLTLLSKGVNVTIIDYTLSRVTINDCCYFNDLSRDEELFQATGDYQYDVYRMMRNELKNNWSSFSPKTNIIWLSYVIVKVLDSVKYKSINTKVHRMYIDKI 542          
BLAST of Kinase, putative vs. UniProt/SwissProt
Match: sp|Q8TF76|HASP_HUMAN (Serine/threonine-protein kinase haspin OS=Homo sapiens OX=9606 GN=HASPIN PE=1 SV=3)

HSP 1 Score: 226.098 bits (575), Expect = 3.443e-62
Identity = 122/301 (40.53%), Postives = 174/301 (57.81%), Query Frame = 3
Query: 1017 VNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENF--KIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
             +D+E V  + C ++    F+   P +K +   K+GEG FGEVF  +     ++ IK I + G    NG  Q TF++I+ EI+++KELS L     NR   F+ + +V  V G +P    K WD  N  K S ND P  F   Q +I+++FEF G  LE    K+ S A A SIL Q   SLA AE  + FEHRDLHWGN+L+ K  L      Y L+GK   I   G+  ++IDYT SR+++   +V+ D+S D+D+F G GD QFD+YR M++ N N W  ++P +N+ WL YL +K+L
Sbjct:  457 ASDAEKVYGE-CSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVA-IKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLH--YTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKML 753          
BLAST of Kinase, putative vs. UniProt/SwissProt
Match: sp|Q2KIP2|HASP_BOVIN (Serine/threonine-protein kinase haspin OS=Bos taurus OX=9913 GN=HASPIN PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 9.659e-62
Identity = 116/286 (40.56%), Postives = 169/286 (59.09%), Query Frame = 3
Query: 1074 FASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENF--KIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLV 1925
            F+     +K +   K+GEG FGEVF  V +   ++ +K I + G    NG  Q TF++I+ EI+++KELS L     NR   F+ + +V  V G +P    + WD  +  K S ND P  F   Q +I+++FEF G  LE    K+ S A A SIL Q   SLA AE  + FEHRDLHWGN+L+ K  L   EL Y L+GK   I   G+   +IDYT SR+++   +V+ D+S+D+D+F+G GD QF++YR M++ N N W  ++P  N+ WL YL +K+L+ + 
Sbjct:  458 FSDYLSEEKLECCEKIGEGVFGEVFQTVTNHTPVA-LKIIAIEGQNLVNGAHQKTFEEILPEIIISKELSLLSDEACNRTEGFIGLNSVHCVQGSYPPLLLQAWDHYHSTKGSANDRPDFFREDQLFIVLEFEFGGIDLEQMRKKLSSIATAKSILHQITASLAVAEASLHFEHRDLHWGNVLLKKTSLK--ELHYTLNGKKSSIPTRGLQVNIIDYTLSRLERDGIVVFCDISRDEDLFMGQGDYQFEIYRLMRKENNNCWGEYHPYNNVLWLHYLTDKILNQMT 740          
BLAST of Kinase, putative vs. UniProt/SwissProt
Match: sp|O80528|HASP_ARATH (Serine/threonine-protein kinase haspin homolog OS=Arabidopsis thaliana OX=3702 GN=HASPIN PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.932e-48
Identity = 104/297 (35.02%), Postives = 164/297 (55.22%), Query Frame = 3
Query: 1038 VLKLCGKERYQNFASVFP-MKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTT---NRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGT-GDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            +L  CG+ R  NF   F    + + I K+GEG++GE F    S     V K +P++G    NG  Q   D+++ E++++  L+ LR   T   N C  ++K +++ L  G +     K W++ +    SEND+P  F   Q +++   E  G  LE+F + +F +A S+L+Q    LA AE   EFEHRDLHWGNIL+ + + D   L ++L+GK   I   GV  ++ID+T SRI  G  +++ D++ D  +F G  GD Q + YR+M+   ++ W     +TN+ WL YL + LL
Sbjct:  265 LLSACGQMRPSNFIEAFSKFCEPESIVKIGEGTYGEAFRAGSS-----VCKIVPIDGDFRVNGEVQKRADELLEEVILSWTLNQLRECETTAQNLCPTYIKTQDIKLCQGPYDPILIKAWEEWDAKHGSENDHPD-FPEKQCYVMFVLEHGGKDLESFVLLNFDEARSLLVQATAGLAVAEAAFEFEHRDLHWGNILLSRNNSDT--LPFILEGKQVCIKTFGVQISIIDFTLSRINTGEKILFLDLTSDPYLFKGPKGDKQSETYRKMKAVTEDYWEGSFARTNVLWLIYLVDILL 553          
BLAST of Kinase, putative vs. TrEMBL
Match: A0A074ZZD4 (Protein kinase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02418 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.996e-81
Identity = 143/369 (38.75%), Postives = 221/369 (59.89%), Query Frame = 3
Query:  909 VIKAEDRKKWLIQAKRRSRWIK-KNQGMNDSFWEAYNVNDSESVVLKLCGK-ERYQNFASVFPMKKRKE-ISKLGEGSFGEVFSIV----------DSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELT---------------------YMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            VI ++  KK     KR +R  +  N  +N S+WE Y   D+ + +LKLC + + Y+ FA VF   +RK+ I KLGEG FGEVF              + + L  IK IP+ GS+ +NG  Q TF++++SE++V+KEL+ L +G TNR  +FV+++ + LV G+FP+Y  K WD+ ++ + SEND+P+ F + Q W+L ++ F G  LE+      A    ILLQ   +LA AE  ++FEHRDLHWGN+L+ ++ + +S  T                     + L+ + Y++  +G  + +ID+T SR+++   LVY +++ D  +F   GD QFDVYR M++HNK++W  F+P+TN+FWL YL  KLL
Sbjct:  181 VILSKGGKKSDAFLKRLTRHFRIDNMILNQSYWEVYEAGDARATLLKLCKQTDSYKKFADVFTAHRRKQTIRKLGEGCFGEVFQCTANYVAPVDLHSTTESLVAIKVIPIEGSVRFNGDCQKTFNEVVSEVIVSKELTALSLGLTNRTDSFVQLQKLHLVQGRFPSYLTKAWDQFDRERKSENDHPRIFPADQLWLLAEYAFGGSALEDNMPSCPAARLGILLQVGFALAVAEAELKFEHRDLHWGNVLI-RQTVGESSSTGGHNRCISCARTENGPVEVVKFRLNDRSYEVPSYGFAAVIIDFTLSRLEQDGGLVYVNLAADPALFESQGDYQFDVYRLMRKHNKDQWERFHPRTNVFWLHYLATKLL 548          
BLAST of Kinase, putative vs. TrEMBL
Match: A0A4S2MAE3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001498 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 6.738e-81
Identity = 140/368 (38.04%), Postives = 216/368 (58.70%), Query Frame = 3
Query:  909 VIKAEDRKKWLIQAKRRSRWIK-KNQGMNDSFWEAYNVNDSESVVLKLCGKE-RYQNFASVFPMKKRKE-ISKLGEGSFGEVFSIV----------DSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSE--------------------LTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            V+  +  KK     KR +R  +  N  +N S+WE Y   D+ + +LKLC +   Y+ FA VF   +RK+ I KLGEG FGEVF              + + L  +K IP+ GS+ +NG  Q TF +++SE++V+KEL+ L +G TNR  +FV+++ + LV G+FP+Y  K WD+ ++ + SEND+P+ F + Q W+L ++ F G  LE+      A    ILLQ   +LA AE  ++FEHRDLHWGN+L+ +  ++ S                     + + L+ + Y++  +G  + +ID+T SR+++   LVY +++ D  +F   GD QFDVYR M++HNK++W  F P+TN+FWL YL  KLL
Sbjct:  159 VMPTKGGKKSGAFLKRLTRHFRIDNMILNQSYWEVYEAGDARATLLKLCKQAGSYKKFADVFTAHRRKQTIRKLGEGCFGEVFQCTANHVAPADLHSTTESLVAVKVIPIEGSVRFNGDCQKTFSEVLSEVIVSKELTALSLGLTNRTDSFVQLQKLHLVQGRFPSYLTKAWDQFDRERKSENDHPRIFPADQLWLLAEYAFGGSALEDNMPNCPAARLGILLQVGFALAVAEAELKFEHRDLHWGNVLIRQTLVESSSTDSLNGCIYCARTENNPVDVVKFRLNDRSYEVPTYGFAAVIIDFTLSRLEQDGGLVYVNLAADPALFESQGDYQFDVYRLMRKHNKDQWERFYPRTNVFWLHYLATKLL 526          
BLAST of Kinase, putative vs. TrEMBL
Match: A0A419Q5I6 (Serine/threonine-protein kinase haspin OS=Clonorchis sinensis OX=79923 GN=Gsg2 PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 8.635e-81
Identity = 139/354 (39.27%), Postives = 212/354 (59.89%), Query Frame = 3
Query:  951 KRRSRWIK-KNQGMNDSFWEAYNVNDSESVVLKLCGKE-RYQNFASVFPMKKRKE-ISKLGEGSFGEVFSIV----------DSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSE--------------------LTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            KR +R  +  N  +N S+WE Y   D+ + +LKLC +   Y+ FA VF   +RK+ I KLGEG FGEVF              + + L  IK IP+ GS+ +NG  Q TF +++SE++V+KEL+ L +G TNR  +FV+++ + LV G+FP+Y  K WD+ ++ + SEND+P+ F + Q W+L ++ F G  LE+      A   SILLQ   +LA AE  ++FEHRDLHWGN+L+ +  ++ S                     + + L+ + Y++  +G  + +ID+T SR+++   LVY +++ D  +F   GD QFDVYR M++HNK++W  F P+TN+FWL YL  KLL
Sbjct:  200 KRLTRHFRIDNMILNQSYWEIYEAGDARATLLKLCKQTGSYKKFADVFTAHRRKQTIRKLGEGCFGEVFQCTANHVAPADLHSTTESLVAIKVIPIEGSVRFNGDCQKTFSEVLSEVIVSKELTALSLGLTNRTDSFVQLQKLHLVQGRFPSYLTKAWDQFDRERKSENDHPRIFPADQLWLLAEYAFGGSALEDNMPSCPAARLSILLQVGFALAVAEAELKFEHRDLHWGNVLIRQTLVESSSTVGHNGCIYCTRTENGPVDVVKFRLNDRSYEVPTYGFTAVIIDFTLSRLEQDGGLVYVNLAADPALFESRGDYQFDVYRLMRKHNKDQWERFYPRTNVFWLHYLATKLL 553          
BLAST of Kinase, putative vs. TrEMBL
Match: A0A4S2MAE7 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001498 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.998e-80
Identity = 140/368 (38.04%), Postives = 216/368 (58.70%), Query Frame = 3
Query:  909 VIKAEDRKKWLIQAKRRSRWIK-KNQGMNDSFWEAYNVNDSESVVLKLCGKE-RYQNFASVFPMKKRKE-ISKLGEGSFGEVFSIV----------DSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSE--------------------LTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            V+  +  KK     KR +R  +  N  +N S+WE Y   D+ + +LKLC +   Y+ FA VF   +RK+ I KLGEG FGEVF              + + L  +K IP+ GS+ +NG  Q TF +++SE++V+KEL+ L +G TNR  +FV+++ + LV G+FP+Y  K WD+ ++ + SEND+P+ F + Q W+L ++ F G  LE+      A    ILLQ   +LA AE  ++FEHRDLHWGN+L+ +  ++ S                     + + L+ + Y++  +G  + +ID+T SR+++   LVY +++ D  +F   GD QFDVYR M++HNK++W  F P+TN+FWL YL  KLL
Sbjct:  220 VMPTKGGKKSGAFLKRLTRHFRIDNMILNQSYWEVYEAGDARATLLKLCKQAGSYKKFADVFTAHRRKQTIRKLGEGCFGEVFQCTANHVAPADLHSTTESLVAVKVIPIEGSVRFNGDCQKTFSEVLSEVIVSKELTALSLGLTNRTDSFVQLQKLHLVQGRFPSYLTKAWDQFDRERKSENDHPRIFPADQLWLLAEYAFGGSALEDNMPNCPAARLGILLQVGFALAVAEAELKFEHRDLHWGNVLIRQTLVESSSTDSLNGCIYCARTENNPVDVVKFRLNDRSYEVPTYGFAAVIIDFTLSRLEQDGGLVYVNLAADPALFESQGDYQFDVYRLMRKHNKDQWERFYPRTNVFWLHYLATKLL 587          
BLAST of Kinase, putative vs. TrEMBL
Match: A0A504YPI0 (Serine/threonine-protein kinase haspin OS=Fasciola gigantica OX=46835 GN=FGIG_07115 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.098e-79
Identity = 140/354 (39.55%), Postives = 208/354 (58.76%), Query Frame = 3
Query:  951 KRRSRWIK-KNQGMNDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIV-------DSEDKLSV----------IKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILV------------LKRDLDD----SELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKL 1910
            KR +R  +  N  +N S+W  +   DS+  +LK+C +   + F+ VF   +R+ + K+GEG FGEVF          D+E K SV          +K IPV GS+ +NG  Q ++++++SE+++AKEL+ L  G  N+   FV+++ V L+ G FP+Y  K W+K    K SEND+P+ F   Q W+ ++  F+G  LE+  I   A   S+L Q  LSLA AE  + FEHRDLHWGN+L+            + R  D     S + + LDG+ +++  HG+ S++ID+T SR+++G  LVY D+S D  +F   GD QFDVYR M++HN+N+W  F PKTN+ WL YL  KL
Sbjct:   94 KRLTRCFRIDNMILNQSYWTLFEAGDSKGTLLKICNQSSMKKFSDVFTPFRRRRLIKIGEGCFGEVFRCTARMQAPHDNERKRSVSSSSNEDLVAVKLIPVGGSVEFNGESQKSYNEVLSEVIIAKELTALSYGLHNQTDGFVQLKQVHLICGAFPSYLTKAWEKFADSKGSENDHPRIFPKDQVWLALETLFSGSALEDTVIPCPAARLSVLRQVALSLAVAECELYFEHRDLHWGNVLIRPINPNMFEQSDVCRFCDSEASLSTVNFRLDGRAFRVPTHGLRSSIIDFTLSRLEQGGGLVYVDLSTDPTLFESKGDYQFDVYRLMREHNRNQWKKFCPKTNVMWLNYLVKKL 447          
BLAST of Kinase, putative vs. Ensembl Cavefish
Match: si:dkeyp-26a9.2 (histone H3 associated protein kinase [Source:NCBI gene;Acc:103026235])

HSP 1 Score: 250.366 bits (638), Expect = 3.193e-70
Identity = 127/312 (40.71%), Postives = 190/312 (60.90%), Query Frame = 3
Query:  990 NDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENF--KIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDL 1919
            N S      ++D+E V  + C ++   +F    P ++ K  +K+GEG+FGEVFS ++S ++   +K IPV GS   NG  Q TFD+I+ EI+++KELS L     N+   F+ + N+  V G +P+   K WDK ++ KTSEND P  F   Q +++++FEF G  LEN   K+ S AQA S+L Q   +LA AE  + FEHRDLHWGNILV  +   +    ++L+G  Y +   GV   +IDY+ SR++     V  D+S D+++F+G GD QF++YR M++ N N W  +NP +N+ WL YL +KLL +
Sbjct:  875 NASIGPDEEISDAEKVYQE-CQQDGPLSFEDCIPPEQMKCCNKIGEGTFGEVFSTINSSNQTVALKIIPVEGSEKVNGEAQKTFDEILHEIIISKELSSLDSKENNKTNGFIGLNNLHCVQGCYPSALLKAWDKFDQDKTSENDRPDFFGKEQLFVILEFEFGGSDLENMNGKLSSMAQAKSLLHQVTAALAVAEQSLCFEHRDLHWGNILV--KTTKEKHTDFILNGSVYSVETRGVHVNIIDYSLSRLEIDGLTVSCDISNDEELFMGQGDYQFEIYRLMKKENNNCWGEYNPHSNVLWLHYLVDKLLTM 1183          
BLAST of Kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000394.1 (pep scaffold:Pmarinus_7.0:GL476890:391392:401812:1 gene:ENSPMAG00000000354.1 transcript:ENSPMAT00000000394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 2.313e-63
Identity = 107/271 (39.48%), Postives = 167/271 (61.62%), Query Frame = 3
Query: 1116 KLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLEN--FKIESFAQAYSILLQTCLSLACAEYYVEFEH---RDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            K+GEG +GEVF +    DK+SV K +P+ GS+  N  PQ +F++I+ EI++ K+LS L  G  ++  NF+K+  +  + G +P    + W++ ++ K S+ND P  FT SQ +I+ +FE  G  LE   FK  S  Q  ++L Q  ++LA AE  + FEH   RDLHWGN+LV  +     +L+Y L G+ + +  HGV + +IDYT SR++    + +++M+ D+ +F G GD Q+D+YR M+  N N W+ + P TN+ WL YL  K+L
Sbjct:   29 KVGEGVYGEVFRMCSGRDKVSVFKVVPIEGSVLVNEEPQKSFEEILPEIMICKQLSSLHEGEHHQSENFIKLNGLRCLQGSYPDRLLEAWNEFHENKLSDNDCPNFFTDSQLFIVFEFEDGGTSLETYQFKFSSMLQMVAVLYQVLVALAVAEEAICFEHSSARDLHWGNVLV--KQTKKKKLSYRLFGQTFSMPTHGVQAKIIDYTLSRMEHDGMIKFTNMALDEMLFQGQGDYQYDIYRMMRNENNNNWAAYAPHTNVLWLHYLAGKML 297          
BLAST of Kinase, putative vs. Ensembl Yeast
Match: ALK2 (Protein kinase; along with its paralog, ALK1, required for proper spindle positioning and nuclear segregation following mitotic arrest, proper organization of cell polarity factors in mitosis, proper localization of formins and polarity factors, and survival in cells that activate spindle assembly checkpoint; phosphorylated in response to DNA damage; ALK2 has a paralog, ALK1, that arose from the whole genome duplication; similar to mammalian haspins [Source:SGD;Acc:S000000105])

HSP 1 Score: 51.6026 bits (122), Expect = 3.738e-7
Identity = 40/153 (26.14%), Postives = 66/153 (43.14%), Query Frame = 3
Query: 1467 FEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQ--HNKNEWSHFNPKTNIFWLTYLGNKLLDL 1919
            F++ G PL       ++QA SI  Q    L  AE   + EHR+L   +IL+  +   +  L  M   +   I+++    T +D+ +                    F G G  QF++Y  M+        W+ F P+TN+ WL +L + LL +
Sbjct:  489 FKYQGTPLSRCSNIDYSQALSIFWQCSSILYVAESKFQLEHRNLTLDHILIDSK--GNVTLIDMKCCRFLNIDNNKASYTRLDHHY-------------------FFQGRGTLQFEIYELMRSMLPQPISWATFEPRTNLLWLYHLSSSLLKM 620          
BLAST of Kinase, putative vs. Ensembl Nematostella
Match: EDO31137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYS8])

HSP 1 Score: 92.4337 bits (228), Expect = 8.634e-23
Identity = 36/87 (41.38%), Postives = 62/87 (71.26%), Query Frame = 3
Query: 1638 DSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYL 1898
            + +L YMLDG+ + +   G+  ++ID+T SR++K    V+ D+S+D+ +F G GD QFD+YR+M+ HN+++W+ + P +N+ WL YL
Sbjct:    1 EKQLVYMLDGERWTVESRGLCVSLIDFTLSRLRKEGVTVFCDLSEDESMFTGQGDYQFDIYRKMRVHNRDDWAAYKPYSNVLWLHYL 87          
BLAST of Kinase, putative vs. Ensembl Medaka
Match: si:dkeyp-26a9.2 (histone H3 associated protein kinase [Source:NCBI gene;Acc:101174563])

HSP 1 Score: 239.195 bits (609), Expect = 1.924e-66
Identity = 119/307 (38.76%), Postives = 188/307 (61.24%), Query Frame = 3
Query: 1005 EAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLE--NFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDL 1919
            E  +++D+E V  + CG+E    +       + K   K+GEG+FGEVFS  ++  +   +K IP+ GS   NG  Q TF +I+ E++++KELS L+    N+   F+ + ++  V G +P+ F K WD  ++ K SEND P  F+  Q +I+++FEF G  LE  N  + S   A SIL Q   +LA AE  + FEHRDLHWGN+LV  +     + +++L+G+ + +  +GVL  +IDY+ SR++     V  D+S D+++F+G GD QF++YR M+Q N N+WS ++P +N+ WL YL +KLL +
Sbjct:  813 EEPDLSDAEKVYAE-CGQEHPLPWEECILPLRSKGCVKIGEGTFGEVFSTTNAAGETVALKIIPIEGSKKVNGEDQKTFGEILHEVIISKELSSLKEKQHNQTNGFIGLNDLHCVQGCYPSDFLKAWDAYDRRKGSENDRPDFFSKEQLFIILEFEFGGVDLENSNGTLASLGVAKSILHQVTAALAVAEQELHFEHRDLHWGNVLV--KTTRKRKGSFLLNGETHHVETNGVLVRIIDYSLSRLEIDELTVSCDISNDEELFMGQGDYQFEIYRLMRQENGNDWSSYHPHSNVLWLHYLCSKLLSM 1116          
BLAST of Kinase, putative vs. Ensembl Medaka
Match: si:dkeyp-26a9.2 (histone H3 associated protein kinase [Source:NCBI gene;Acc:101174563])

HSP 1 Score: 238.81 bits (608), Expect = 2.471e-66
Identity = 119/308 (38.64%), Postives = 192/308 (62.34%), Query Frame = 3
Query: 1005 EAYNVNDSESVVLKLCGKERYQNFA-SVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLE--NFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDL 1919
            E  +++D+E V  + CG+E    +   + P++ +  + K+GEG+FGEVFS  ++  +   +K IP+ GS   NG  Q TF +I+ E++++KELS L+    N+   F+ + ++  V G +P+ F K WD  ++ K SEND P  F+  Q +I+++FEF G  LE  N  + S   A SIL Q   +LA AE  + FEHRDLHWGN+LV  +     + +++L+G+ + +  +GVL  +IDY+ SR++     V  D+S D+++F+G GD QF++YR M+Q N N+WS ++P +N+ WL YL +KLL +
Sbjct:  864 EEPDLSDAEKVYAE-CGQEHPLPWEECILPLRSKGCV-KIGEGTFGEVFSTTNAAGETVALKIIPIEGSKKVNGEDQKTFGEILHEVIISKELSSLKEKQHNQTNGFIGLNDLHCVQGCYPSDFLKAWDAYDRRKGSENDRPDFFSKEQLFIILEFEFGGVDLENSNGTLASLGVAKSILHQVTAALAVAEQELHFEHRDLHWGNVLV--KTTRKRKGSFLLNGETHHVETNGVLVRIIDYSLSRLEIDELTVSCDISNDEELFMGQGDYQFEIYRLMRQENGNDWSSYHPHSNVLWLHYLCSKLLSM 1167          
BLAST of Kinase, putative vs. Planmine SMEST
Match: SMESG000029295.1 (SMESG000029295.1)

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 613/651 (94.16%), Postives = 614/651 (94.32%), Query Frame = 3
Query:   81 MPCKRVPKPNSEPKIPNFNDIMNFPLTISVEDKFGNYQKMYMDGKLNILPYDNKSNDEFEGILIQPSMPNSIKPKLSNDKLIIKENTSNPLNFNKENIKVGSSTELEINDNNLLKFNIEIASKASNEIKEIRRKSILKSPCKNFNVEKDKPNRRSHSKVMFSSPLVRQTPNSKSDMRKNLLIEKLKRCQETPILPIKTNRNNSLDDPSFHFTDNTSDQSLIAVPIISNKKNVFEESPMLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 2033
            MPCKRVPKPNSEPKIPNFNDIMNFPLTISVEDKFGNYQKMYMDGKLNILPYDNKSNDEFE ILIQPSMPNSIKPKLSNDKLI KENTSN LNFNKENIKVGSSTELEINDNNLLKFNIEIASKASNEIKEIRRKSILKSPCKNFNVEKDKPNRRSHSKVMFSSPLVRQTPNSKSDMRKNLLIEKLKRCQETPILPIKTNRNNSLDDPSFHFTDNTSDQSLIAVPIISNKKNVF+                                  ANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC
Sbjct:    1 MPCKRVPKPNSEPKIPNFNDIMNFPLTISVEDKFGNYQKMYMDGKLNILPYDNKSNDEFEEILIQPSMPNSIKPKLSNDKLIDKENTSNSLNFNKENIKVGSSTELEINDNNLLKFNIEIASKASNEIKEIRRKSILKSPCKNFNVEKDKPNRRSHSKVMFSSPLVRQTPNSKSDMRKNLLIEKLKRCQETPILPIKTNRNNSLDDPSFHFTDNTSDQSLIAVPIISNKKNVFK----------------------------------ANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 617          
BLAST of Kinase, putative vs. Planmine SMEST
Match: SMESG000029289.1 (SMESG000029289.1)

HSP 1 Score: 380.948 bits (977), Expect = 7.467e-129
Identity = 178/180 (98.89%), Postives = 180/180 (100.00%), Query Frame = 3
Query: 1494 NFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 2033
            +F+IESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC
Sbjct:   29 DFEIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 208          

HSP 2 Score: 63.5438 bits (153), Expect = 3.438e-11
Identity = 32/42 (76.19%), Postives = 38/42 (90.48%), Query Frame = 3
Query:  792 MLSKSIQITEVLFNEDNINADSLIDVNNDFEA-NFQESFHVI 914
            MLSKSIQITEVLFNEDNINADSLIDVNNDFE  +F +++ ++
Sbjct:    1 MLSKSIQITEVLFNEDNINADSLIDVNNDFEIESFAQAYSIL 42          
BLAST of Kinase, putative vs. Planmine SMEST
Match: SMESG000029289.1 (SMESG000029289.1)

HSP 1 Score: 380.178 bits (975), Expect = 4.666e-128
Identity = 178/181 (98.34%), Postives = 180/181 (99.45%), Query Frame = 3
Query: 1491 ENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 2033
            ++F IESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC
Sbjct:   68 DSFWIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 248          

HSP 2 Score: 150.214 bits (378), Expect = 7.581e-41
Identity = 75/88 (85.23%), Postives = 81/88 (92.05%), Query Frame = 3
Query:  792 MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFW-EAYNVNDSESVVLKLC 1052
            MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFW E++    + S++L+ C
Sbjct:    1 MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFWIESF--AQAYSILLQTC 86          
BLAST of Kinase, putative vs. Planmine SMEST
Match: SMESG000029289.1 (SMESG000029289.1)

HSP 1 Score: 366.311 bits (939), Expect = 1.107e-122
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 3
Query: 1521 AYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 2033
            AYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC
Sbjct:   72 AYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLCC 242          

HSP 2 Score: 150.599 bits (379), Expect = 4.368e-41
Identity = 76/87 (87.36%), Postives = 79/87 (90.80%), Query Frame = 3
Query:  792 MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFWEAYNVNDSESVVLKLC 1052
            MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFW AY      S++L+ C
Sbjct:    1 MLSKSIQITEVLFNEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKNQGMNDSFW-AY------SILLQTC 80          
BLAST of Kinase, putative vs. Planmine SMEST
Match: SMESG000001493.1 (SMESG000001493.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.583e-65
Identity = 121/308 (39.29%), Postives = 181/308 (58.77%), Query Frame = 3
Query:  993 DSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEGSFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKELSDLR-IGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPKKFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVEFEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSRIKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNIFWLTYLGNKLL 1913
            DS   +    D E  +L LC + + +++ S F     K  +K+GEG +GEVF +     + +V+K  PVNG L  NG  Q TF+D+  E+ V+K+L++L       R  NFV+++   +V GK P     +W +    + ++N+     T  QKW+ +++EFAG PL N+K   + +  SI+ Q  +SLA AE  V+FEHRDLHW NILV  +     +L Y ++G +Y  N  G+  TVID+T SR+    N VY DMS   +IF G GD QF++YR M+  N+N W  FNP++N++W+ YL +KLL
Sbjct:  281 DSLSASLVQADPEQKILDLCDQSQIRSWCSFFDDVSNKTTNKVGEGVYGEVFKLY----RGNVLKVFPVNGDLLVNGEDQMTFEDVFPEVFVSKKLTELNGKNKLYRTSNFVQLKKASMVRGKLPQILIDQWKQFKSDRGTDNECLDFLTDKQKWMALEYEFAGEPLSNYKFNGYHEVRSIIEQITISLAVAEAAVQFEHRDLHWLNILV--KPTKQIKLRYRINGTNYIGNCFGLFVTVIDFTVSRMCVDSNTVYMDMSDCPEIFEGEGDYQFEIYRMMKNDNRNNWREFNPRSNLYWIHYLIDKLL 582          
The following BLAST results are available for this feature:
BLAST of Kinase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HASPIN7.169e-6340.53histone H3 associated protein kinase [Source:HGNC ... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hasp-19.708e-5536.51HASPin kinase related [Source:UniProtKB/TrEMBL;Ac... [more]
hasp-23.331e-5333.43HASPin kinase related [Source:UniProtKB/TrEMBL;Ac... [more]
VY10G11R.11.113e-1027.40pep chromosome:WBcel235:IV:16469580:16470881:-1 ge... [more]
C04G2.101.919e-1024.23pep chromosome:WBcel235:IV:10116255:10118084:1 gen... [more]
C04G2.102.305e-1024.23pep chromosome:WBcel235:IV:10116768:10118084:1 gen... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Haspin2.983e-6337.04gene:FBgn0046706 transcript:FBtr0113784[more]
back to top
BLAST of Kinase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-26a9.23.438e-6941.12si:dkeyp-26a9.2 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Haspin3.232e-6641.58histone H3 associated protein kinase [Source:MGI S... [more]
back to top
BLAST of Kinase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z0R0|HASP_MOUSE2.087e-6541.58Serine/threonine-protein kinase haspin OS=Mus musc... [more]
sp|P83103|HASP_DROME2.990e-6237.04Putative serine/threonine-protein kinase haspin ho... [more]
sp|Q8TF76|HASP_HUMAN3.443e-6240.53Serine/threonine-protein kinase haspin OS=Homo sap... [more]
sp|Q2KIP2|HASP_BOVIN9.659e-6240.56Serine/threonine-protein kinase haspin OS=Bos taur... [more]
sp|O80528|HASP_ARATH1.932e-4835.02Serine/threonine-protein kinase haspin homolog OS=... [more]
back to top
BLAST of Kinase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZZD42.996e-8138.75Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2MAE36.738e-8138.04Protein kinase domain-containing protein OS=Opisth... [more]
A0A419Q5I68.635e-8139.27Serine/threonine-protein kinase haspin OS=Clonorch... [more]
A0A4S2MAE72.998e-8038.04Protein kinase domain-containing protein OS=Opisth... [more]
A0A504YPI01.098e-7939.55Serine/threonine-protein kinase haspin OS=Fasciola... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-26a9.23.193e-7040.71histone H3 associated protein kinase [Source:NCBI ... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000394.12.313e-6339.48pep scaffold:Pmarinus_7.0:GL476890:391392:401812:1... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ALK23.738e-726.14Protein kinase; along with its paralog, ALK1, requ... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO311378.634e-2341.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkeyp-26a9.21.924e-6638.76histone H3 associated protein kinase [Source:NCBI ... [more]
si:dkeyp-26a9.22.471e-6638.64histone H3 associated protein kinase [Source:NCBI ... [more]
back to top
BLAST of Kinase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029295.10.000e+094.16SMESG000029295.1[more]
SMESG000029289.17.467e-12998.89SMESG000029289.1[more]
SMESG000029289.14.666e-12898.34SMESG000029289.1[more]
SMESG000029289.11.107e-122100.00SMESG000029289.1[more]
SMESG000001493.11.583e-6539.29SMESG000001493.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030297 ID=SMED30030297|Name=Kinase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2150bp
GTTTTAATATTAAAAAGTGAAAATTTAATTATTTAATTTTGAAACTTTAT
TTTTATGATATATCATTAAATTTTATTTTAATGCCTTGTAAACGTGTGCC
TAAACCTAATTCTGAGCCTAAAATACCCAATTTTAATGATATTATGAACT
TTCCATTGACAATTTCAGTTGAAGATAAATTTGGAAACTATCAAAAAATG
TACATGGATGGAAAATTGAATATTTTGCCTTATGATAATAAAAGCAACGA
TGAATTTGAAGGAATTCTTATTCAACCGTCTATGCCTAACTCAATAAAGC
CTAAGTTATCTAATGACAAATTAATTATTAAAGAAAATACAAGTAATCCA
CTTAATTTTAATAAAGAAAATATAAAAGTTGGTTCATCAACAGAATTAGA
AATCAATGATAATAATTTATTAAAATTCAATATTGAAATTGCTTCAAAAG
CATCAAATGAAATAAAAGAAATCAGAAGAAAAAGTATATTGAAATCTCCC
TGCAAAAATTTCAATGTCGAAAAAGATAAACCAAACCGAAGATCCCATTC
GAAAGTCATGTTTTCATCTCCACTCGTTAGACAAACTCCAAACAGCAAAT
CCGATATGAGAAAAAATCTCTTAATAGAAAAATTAAAACGATGCCAGGAA
ACTCCTATCCTACCGATCAAGACGAATAGGAATAATTCGTTGGATGATCC
GTCGTTTCATTTTACCGACAATACTTCAGATCAATCATTAATTGCAGTTC
CAATTATTTCAAATAAGAAAAACGTTTTCGAGGAATCTCCAATGTTATCG
AAAAGTATCCAGATAACTGAAGTCTTATTCAACGAAGACAATATCAATGC
AGACTCATTAATTGATGTCAATAATGATTTTGAGGCTAATTTCCAAGAAT
CATTCCATGTGATTAAAGCAGAAGATAGAAAGAAATGGTTAATTCAAGCT
AAAAGACGATCTAGATGGATTAAAAAGAATCAAGGAATGAATGATTCATT
TTGGGAAGCATATAATGTTAATGATTCTGAGTCAGTGGTTTTGAAGTTAT
GTGGGAAGGAAAGGTATCAGAATTTCGCCAGTGTATTTCCTATGAAAAAA
AGAAAAGAGATTTCTAAACTCGGAGAAGGTTCTTTCGGTGAAGTGTTTTC
AATAGTTGACAGCGAAGATAAACTATCAGTAATTAAATTTATCCCAGTAA
ACGGGTCTCTGTATTACAATGGTGGACCACAGACAACATTCGATGACATC
ATTTCAGAAATTGTTGTTGCCAAAGAGCTTAGTGACTTGCGGATTGGAAC
AACTAATAGATGTCGAAATTTTGTAAAAATGGAAAATGTGTTTTTGGTTA
GTGGAAAATTCCCCGCTTATTTCCAAAAGGAATGGGATAAAAGCAACAAA
TTGAAAACTTCTGAAAATGATAATCCAAAGAAATTTACCAGTAGTCAGAA
ATGGATATTAATTCAATTTGAATTTGCTGGTTGCCCGTTAGAGAACTTTA
AGATCGAATCATTTGCCCAGGCTTACTCAATTTTACTCCAGACTTGTTTG
TCTTTAGCTTGTGCGGAATATTATGTAGAATTTGAGCATCGTGATCTTCA
TTGGGGTAATATCCTTGTCTTGAAAAGGGATCTCGATGATTCCGAACTGA
CTTATATGTTGGATGGGAAAGATTATCAAATCAACCATCATGGAGTTCTA
TCAACAGTCATTGATTATACATTTTCAAGGATCAAAAAGGGAATTAATTT
GGTATATTCCGATATGTCAAAGGATCAGGATATTTTTCTAGGCACCGGAG
ATCCCCAGTTTGATGTGTATCGTCAAATGCAACAGCACAACAAGAATGAG
TGGAGTCATTTCAATCCGAAAACGAATATTTTCTGGTTGACATATTTAGG
GAATAAACTTCTGGATTTGCTGGTTTCCAGGGAGATTATTGCCGATGAAT
ATAAATTGAAATTCGACTCACTGGTTCATGATATTGCCAACAGTCAGTCA
ACCGCAGAATTTATCACCAGTCACCTGTGTTGCTGATATTATGCCTCAGG
TCATTTATACGGCTGTAAATAGGCTGGGGGGATAATTATATTCTTCGGTC
GACGCAATGTAAATAATTCACACTGATTGATTTTGGATATGTATTTGCTC
back to top

protein sequence of SMED30030297-orf-1

>SMED30030297-orf-1 ID=SMED30030297-orf-1|Name=SMED30030297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MPCKRVPKPNSEPKIPNFNDIMNFPLTISVEDKFGNYQKMYMDGKLNILP
YDNKSNDEFEGILIQPSMPNSIKPKLSNDKLIIKENTSNPLNFNKENIKV
GSSTELEINDNNLLKFNIEIASKASNEIKEIRRKSILKSPCKNFNVEKDK
PNRRSHSKVMFSSPLVRQTPNSKSDMRKNLLIEKLKRCQETPILPIKTNR
NNSLDDPSFHFTDNTSDQSLIAVPIISNKKNVFEESPMLSKSIQITEVLF
NEDNINADSLIDVNNDFEANFQESFHVIKAEDRKKWLIQAKRRSRWIKKN
QGMNDSFWEAYNVNDSESVVLKLCGKERYQNFASVFPMKKRKEISKLGEG
SFGEVFSIVDSEDKLSVIKFIPVNGSLYYNGGPQTTFDDIISEIVVAKEL
SDLRIGTTNRCRNFVKMENVFLVSGKFPAYFQKEWDKSNKLKTSENDNPK
KFTSSQKWILIQFEFAGCPLENFKIESFAQAYSILLQTCLSLACAEYYVE
FEHRDLHWGNILVLKRDLDDSELTYMLDGKDYQINHHGVLSTVIDYTFSR
IKKGINLVYSDMSKDQDIFLGTGDPQFDVYRQMQQHNKNEWSHFNPKTNI
FWLTYLGNKLLDLLVSREIIADEYKLKFDSLVHDIANSQSTAEFITSHLC
C*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR024604GSG2_C
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01331DUF3635_2coord: 566..651
e-value: 5.3E-21
score: 85.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 326..465
e-value: 8.7E-37
score: 128.2
NoneNo IPR availablePFAMPF12330Haspin_kinasecoord: 338..635
e-value: 2.8E-53
score: 181.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 466..650
e-value: 4.3E-56
score: 191.3
NoneNo IPR availablePANTHERPTHR24419INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASEcoord: 113..621
NoneNo IPR availablePANTHERPTHR24419:SF18SERINE/THREONINE-PROTEIN KINASE HASPINcoord: 113..621
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 347..369
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 344..519