Peroxiredoxin-1

Overview
NamePeroxiredoxin-1
Smed IDSMED30030295
Length (bp)731
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peroxiredoxin-1 (SMED30030295) t-SNE clustered cells

Violin plots show distribution of expression levels for Peroxiredoxin-1 (SMED30030295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peroxiredoxin-1 (SMED30030295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peroxiredoxin-1 (SMED30030295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30030295SMESG000024235.1 SmedASXL_002411SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30030295SMESG000024235.1 SmedASXL_002411SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030295SMESG000024235.1 SmedASXL_002411SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30030295SMESG000024235.1 dd_Smed_v4_3517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030295SMESG000024235.1 dd_Smed_v4_3517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030295SMESG000024235.1 Contig51097newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030295SMESG000024235.1 Contig51097uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030295SMESG000024235.1 dd_Smed_v6_3517_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30030295SMESG000024235.1 dd_Smed_v4_3517_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030295SMESG000024235.1 SMED_04206_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030295SMESG000024235.1 SMED_04206_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030295SMESG000024235.1 SMED_24793_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030295SMESG000024235.1 SMED_24793_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030295SMESG000024235.1 SMED_04206_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030295SMESG000024235.1 SMED_04206_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Match: PRDX2 (peroxiredoxin 2 [Source:HGNC Symbol;Acc:HGNC:9353])

HSP 1 Score: 258.455 bits (659), Expect = 3.016e-87
Identity = 115/187 (61.50%), Postives = 146/187 (78.07%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDFK+TAV++G F E  LS +KGK++VLFFYPLDFTFVCPTEI+AFS+R E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D +  +SE YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:   12 APDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Match: PRDX1 (peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352])

HSP 1 Score: 252.677 bits (644), Expect = 6.326e-85
Identity = 112/184 (60.87%), Postives = 145/184 (78.80%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            AP+FK+TAVM +G+F + SLS +KGK++V FFYPLDFTFVCPTEI+AFSDR EEFK  NC+V+G S DS + HLAW    +  GGLG +N PL+SD   +I++ YGV+K + G++FRGLFI+D+  ++RQIT+ND+P+GRSVDE LRLV A QF D  GEVCPA W+ G  TIKP+V+ SK+YF
Sbjct:   12 APNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Match: PRDX1 (peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352])

HSP 1 Score: 252.677 bits (644), Expect = 6.326e-85
Identity = 112/184 (60.87%), Postives = 145/184 (78.80%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            AP+FK+TAVM +G+F + SLS +KGK++V FFYPLDFTFVCPTEI+AFSDR EEFK  NC+V+G S DS + HLAW    +  GGLG +N PL+SD   +I++ YGV+K + G++FRGLFI+D+  ++RQIT+ND+P+GRSVDE LRLV A QF D  GEVCPA W+ G  TIKP+V+ SK+YF
Sbjct:   12 APNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Match: PRDX3 (peroxiredoxin 3 [Source:HGNC Symbol;Acc:HGNC:9354])

HSP 1 Score: 241.121 bits (614), Expect = 1.305e-79
Identity = 112/190 (58.95%), Postives = 138/190 (72.63%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            ++ AP FK TAV+NGEF + SL  FKGK+LVLFFYPLDFTFVCPTEIVAFSD+  EF   NCEVV  S DS +SHLAW    R +GGLG +N  LLSD +  IS  YGV+   +G+A RGLFI+D N VI+ +++ND+P+GRSV+E LRLV A Q+ +  GEVCPANW     TIKP+   SK+YF+  N
Sbjct:   66 TQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVN 255          
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Match: PRDX4 (peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169])

HSP 1 Score: 239.195 bits (609), Expect = 1.451e-78
Identity = 109/199 (54.77%), Postives = 143/199 (71.86%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            +++ S+   S+ AP ++ TAV++GEF E  L+ ++GK+LV FFYPLDFTFVCPTEI+AF DR+EEF+S N EVV CS DS+++HLAW    R  GGLG I  PLLSD +H IS+ YGV   ++G   RGLFI+D+  ++RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G +TI P+      YF   N
Sbjct:   73 SLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 271          
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 254.988 bits (650), Expect = 2.545e-86
Identity = 118/192 (61.46%), Postives = 147/192 (76.56%), Query Frame = 1
Query:  106 SQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            S+    + AP FK+ AV++GEFV+ SLS +KGK++VLFFYPLDFTFVCPTEI+AFSDR EEFK+ N  V+  STDS +SHLAW    R  GGLG +N P+L+D +H IS  YGV+K + G+AFRGLFI+D +  +RQITIND+P+GRSVDE LRLV A QF +  GEVCPA W  G  TIKP VK+S++YFK
Sbjct:    8 SKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 199          
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 254.988 bits (650), Expect = 2.897e-86
Identity = 118/192 (61.46%), Postives = 147/192 (76.56%), Query Frame = 1
Query:  106 SQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            S+    + AP FK+ AV++GEFV+ SLS +KGK++VLFFYPLDFTFVCPTEI+AFSDR EEFK+ N  V+  STDS +SHLAW    R  GGLG +N P+L+D +H IS  YGV+K + G+AFRGLFI+D +  +RQITIND+P+GRSVDE LRLV A QF +  GEVCPA W  G  TIKP VK+S++YFK
Sbjct:    6 SKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 197          
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 254.603 bits (649), Expect = 3.117e-86
Identity = 118/192 (61.46%), Postives = 147/192 (76.56%), Query Frame = 1
Query:  106 SQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            S+    + AP FK+ AV++GEFV+ SLS +KGK++VLFFYPLDFTFVCPTEI+AFSDR EEFK+ N  V+  STDS +SHLAW    R  GGLG +N P+L+D +H IS  YGV+K + G+AFRGLFI+D +  +RQITIND+P+GRSVDE LRLV A QF +  GEVCPA W  G  TIKP VK+S++YFK
Sbjct:    2 SKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 193          
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 254.603 bits (649), Expect = 3.117e-86
Identity = 118/192 (61.46%), Postives = 147/192 (76.56%), Query Frame = 1
Query:  106 SQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            S+    + AP FK+ AV++GEFV+ SLS +KGK++VLFFYPLDFTFVCPTEI+AFSDR EEFK+ N  V+  STDS +SHLAW    R  GGLG +N P+L+D +H IS  YGV+K + G+AFRGLFI+D +  +RQITIND+P+GRSVDE LRLV A QF +  GEVCPA W  G  TIKP VK+S++YFK
Sbjct:    2 SKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 193          
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Match: prdx-3 (Probable peroxiredoxin prdx-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21824])

HSP 1 Score: 225.713 bits (574), Expect = 2.150e-74
Identity = 102/193 (52.85%), Postives = 136/193 (70.47%), Query Frame = 1
Query:  112 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            L P    P FK TAV++G+F   S   +KGK+LV+FFYPLDFTFVCPTEI+A+ DR  EF+S   EVV CS DS +SHLAW    R DGGLG ++ PLL+D +  I++++GV+   +G+++RGLF++D +  +R  T ND+P+GRSVDE LR++ A QF D  GEVCPA+W +   TIKP V  SK+YF   N
Sbjct:   33 LGPKNTVPAFKGTAVVDGDFKVISDQDYKGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVN 225          
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0339699)

HSP 1 Score: 244.202 bits (622), Expect = 4.668e-82
Identity = 108/184 (58.70%), Postives = 140/184 (76.09%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            AP F  TAV+NG F +  LS +KGK+LVLFFYPLDFTFVCPTEI+AFS+   EF+  NCEV+GCSTDS+++HLAW    R  GGLG+++ PLL+DKS  ++  YGV+   TG+ FRGLFI+D+   +RQIT+ND+P+GRSV+E LRLV A Q+ D  GEVCPANW+ G KT+  +   SK+YF+
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191          
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0345161)

HSP 1 Score: 244.202 bits (622), Expect = 4.668e-82
Identity = 108/184 (58.70%), Postives = 140/184 (76.09%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            AP F  TAV+NG F +  LS +KGK+LVLFFYPLDFTFVCPTEI+AFS+   EF+  NCEV+GCSTDS+++HLAW    R  GGLG+++ PLL+DKS  ++  YGV+   TG+ FRGLFI+D+   +RQIT+ND+P+GRSV+E LRLV A Q+ D  GEVCPANW+ G KT+  +   SK+YF+
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191          
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0339700)

HSP 1 Score: 244.202 bits (622), Expect = 4.668e-82
Identity = 108/184 (58.70%), Postives = 140/184 (76.09%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            AP F  TAV+NG F +  LS +KGK+LVLFFYPLDFTFVCPTEI+AFS+   EF+  NCEV+GCSTDS+++HLAW    R  GGLG+++ PLL+DKS  ++  YGV+   TG+ FRGLFI+D+   +RQIT+ND+P+GRSV+E LRLV A Q+ D  GEVCPANW+ G KT+  +   SK+YF+
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191          
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0073764)

HSP 1 Score: 244.202 bits (622), Expect = 4.668e-82
Identity = 108/184 (58.70%), Postives = 140/184 (76.09%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            AP F  TAV+NG F +  LS +KGK+LVLFFYPLDFTFVCPTEI+AFS+   EF+  NCEV+GCSTDS+++HLAW    R  GGLG+++ PLL+DKS  ++  YGV+   TG+ FRGLFI+D+   +RQIT+ND+P+GRSV+E LRLV A Q+ D  GEVCPANW+ G KT+  +   SK+YF+
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191          
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0073763)

HSP 1 Score: 244.202 bits (622), Expect = 4.668e-82
Identity = 108/184 (58.70%), Postives = 140/184 (76.09%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            AP F  TAV+NG F +  LS +KGK+LVLFFYPLDFTFVCPTEI+AFS+   EF+  NCEV+GCSTDS+++HLAW    R  GGLG+++ PLL+DKS  ++  YGV+   TG+ FRGLFI+D+   +RQIT+ND+P+GRSV+E LRLV A Q+ D  GEVCPANW+ G KT+  +   SK+YF+
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191          
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 250.751 bits (639), Expect = 2.096e-84
Identity = 114/188 (60.64%), Postives = 144/188 (76.60%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDF + AVM +G+F +  LS +KGK++VLFFYPLDFTFVCPTEI+AFSD  EEF+  NCE++G S DS + HLAWTK  R  GGLG +N PL++D   SIS+ YGV+K + G+A+RGLFI+D+  ++RQITIND+P+GRS+DE LRLV A QF D  GEVCPA W+ G  TIKP+V  SKD+F   N
Sbjct:   12 APDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFFSKQN 199          
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 250.751 bits (639), Expect = 2.096e-84
Identity = 114/188 (60.64%), Postives = 144/188 (76.60%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDF + AVM +G+F +  LS +KGK++VLFFYPLDFTFVCPTEI+AFSD  EEF+  NCE++G S DS + HLAWTK  R  GGLG +N PL++D   SIS+ YGV+K + G+A+RGLFI+D+  ++RQITIND+P+GRS+DE LRLV A QF D  GEVCPA W+ G  TIKP+V  SKD+F   N
Sbjct:   12 APDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFFSKQN 199          
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 250.751 bits (639), Expect = 2.096e-84
Identity = 114/188 (60.64%), Postives = 144/188 (76.60%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDF + AVM +G+F +  LS +KGK++VLFFYPLDFTFVCPTEI+AFSD  EEF+  NCE++G S DS + HLAWTK  R  GGLG +N PL++D   SIS+ YGV+K + G+A+RGLFI+D+  ++RQITIND+P+GRS+DE LRLV A QF D  GEVCPA W+ G  TIKP+V  SKD+F   N
Sbjct:   12 APDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFFSKQN 199          
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Match: prdx2 (peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2])

HSP 1 Score: 242.276 bits (617), Expect = 3.935e-81
Identity = 105/185 (56.76%), Postives = 142/185 (76.76%), Query Frame = 1
Query:  124 EKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            + AP FK+TAV++G+F +  LS ++GK++VLFFYPLDFTFVCPTEI+AFS+R  EF+    E++  STDS +SHLAW    R  GGLG++N PL++D + SIS  YGV+K + G+A+RGLF++D+  ++RQITIND+P+GRSVDE LRLV A Q  D  GEVCPA W+ G  TI P+V+ SK++F
Sbjct:   10 QPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVELIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFF 194          
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Match: prdx3 (peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-18])

HSP 1 Score: 244.973 bits (624), Expect = 6.297e-81
Identity = 111/190 (58.42%), Postives = 136/190 (71.58%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            ++ AP FK TAV+NGEF E SL  FKGK+LVLFFYPLDFTFVCPTEIVAFSD+  EF   NC VVG S DS ++HLAWT   R  GGLG I  PLL+D +  +S  YGV+    G+A RGLFI+D N ++R +++ND+P+GRSV+E LRLV A QF +  GEVCPA+W     TIKP    SK+YF+  N
Sbjct:   92 TQAAPHFKGTAVINGEFKEISLGDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVLLEGPGIALRGLFIIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPASWTPKSPTIKPTPDGSKEYFEKVN 281          
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Match: sox4 (SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727])

HSP 1 Score: 256.914 bits (655), Expect = 1.216e-85
Identity = 116/208 (55.77%), Postives = 155/208 (74.52%), Query Frame = 1
Query:   55 IDIVLIMTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            + ++ IM+  +G  +   +    + AP FK+TAV+NGEF +  LS + GK++VLFFYPLDFTFVCPTEI+AFSD   +F   NC+++  S DS+++HLAWT + R +GGLG IN PL+SD +HSI++ YGV+K   GVA+RGLFI+D    +RQITIND+P+GRSV+E LRLV A Q+ D  GEVCPA W+ G  TIKPNVKDSK++F
Sbjct:   58 VSVIHIMSCPVGPGVRAVKTHIGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 265          
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Match: sox4 (SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727])

HSP 1 Score: 253.447 bits (646), Expect = 3.411e-85
Identity = 115/202 (56.93%), Postives = 151/202 (74.75%), Query Frame = 1
Query:   73 MTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            M+  +G  +   +    + AP FK+TAV+NGEF +  LS + GK++VLFFYPLDFTFVCPTEI+AFSD   +F   NC+++  S DS+++HLAWT + R +GGLG IN PL+SD +HSI++ YGV+K   GVA+RGLFI+D    +RQITIND+P+GRSV+E LRLV A Q+ D  GEVCPA W+ G  TIKPNVKDSK++F
Sbjct:    1 MSCPVGPGVRAVKTHIGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 202          
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Match: mfap3 (microfibril associated protein 3 [Source:Xenbase;Acc:XB-GENE-5784230])

HSP 1 Score: 251.136 bits (640), Expect = 1.867e-84
Identity = 114/184 (61.96%), Postives = 142/184 (77.17%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            APDF + AVM +G+F +  +S +KGK++V FFYPLDFTFVCPTEI+AFSDR+EEFK  NCEV+G S DS + HLAW    R +GGLG +N PL+SD  H+I++ YGV +   GV+FRGLFI+D   ++RQITIND+P+GRSVDE LRLV A QF D  GEVCPA W+ G  TIKP+VK SK+YF
Sbjct:   12 APDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIGASGDSHFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:NCBI gene;Acc:496551])

HSP 1 Score: 251.136 bits (640), Expect = 1.867e-84
Identity = 114/184 (61.96%), Postives = 142/184 (77.17%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            APDF + AVM +G+F +  +S +KGK++V FFYPLDFTFVCPTEI+AFSDR+EEFK  NCEV+G S DS + HLAW    R +GGLG +N PL+SD  H+I++ YGV +   GV+FRGLFI+D   ++RQITIND+P+GRSVDE LRLV A QF D  GEVCPA W+ G  TIKP+VK SK+YF
Sbjct:   12 APDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIGASGDSHFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Match: sacm1l (SAC1 like phosphatidylinositide phosphatase [Source:Xenbase;Acc:XB-GENE-920710])

HSP 1 Score: 241.121 bits (614), Expect = 2.430e-79
Identity = 110/186 (59.14%), Postives = 136/186 (73.12%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            S+ AP ++ TAV+NGEF E  L+ +KGK+LV FFYPLDFTFVCPTEI+AF DRIEEF+S N EVV CS DS+++HLAW    R  GGLG +  PLLSD +H IS+ YGV   + G   RGLFI+D+  V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G +TI P+      YF
Sbjct:   82 SKPAPYWEGTAVINGEFKELKLTDYKGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDTHGEVCPAGWKPGSETIIPDPAGKLKYF 267          
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 256.144 bits (653), Expect = 1.514e-86
Identity = 115/196 (58.67%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  103 NSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N+Q+   + APDF +TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:    5 NAQI--GKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 256.144 bits (653), Expect = 1.514e-86
Identity = 115/196 (58.67%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  103 NSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N+Q+   + APDF +TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:    5 NAQI--GKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 256.144 bits (653), Expect = 1.514e-86
Identity = 115/196 (58.67%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  103 NSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N+Q+   + APDF +TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:    5 NAQI--GKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 256.144 bits (653), Expect = 1.514e-86
Identity = 115/196 (58.67%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  103 NSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N+Q+   + APDF +TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:    5 NAQI--GKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Match: Prdx1 (peroxiredoxin 1 [Source:MGI Symbol;Acc:MGI:99523])

HSP 1 Score: 251.906 bits (642), Expect = 9.644e-85
Identity = 111/184 (60.33%), Postives = 146/184 (79.35%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            AP+FK+TAVM +G+F + SLS++KGK++V FFYPLDFTFVCPTEI+AFSDR +EFK  NC+V+G S DS + HLAW    +  GGLG +N PL+SD   +I++ YGV+K + G++FRGLFI+D+  ++RQITIND+P+GRSVDE++RLV A QF D  GEVCPA W+ G  TIKP+V  SK+YF
Sbjct:   12 APNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYF 195          
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Match: sp|Q17172|TDX2_BRUMA (Peroxiredoxin 2 OS=Brugia malayi OX=6279 GN=tsa-2 PE=2 SV=2)

HSP 1 Score: 259.996 bits (663), Expect = 4.355e-87
Identity = 118/196 (60.20%), Postives = 148/196 (75.51%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
             +  S+    + AP+FK+TAV+NG+F E SL QFKGK++VL FYPLDFTFVCPTEI+AFSDRI EFK  +  V+ CSTDS +SHLAW    R  GGLG +N P+L+  +H IS AYGV+K + G+A+RGLFI+D   ++ QITIND+P+GRSVDE LRL+ A QF D  GEVCPANW  G +TIKP VK+SK YF+
Sbjct:    2 TLAGSKAFIGQPAPNFKTTAVVNGDFKEISLGQFKGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKQLDVAVMACSTDSHFSHLAWVNTDRKMGGLGQMNIPILAYTNHVISRAYGVLKEDDGIAYRGLFIIDPKGILGQITINDLPVGRSVDETLRLIQAFQFVDKHGEVCPANWHPGSETIKPGVKESKAYFE 197          
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Match: sp|Q2PFZ3|PRDX2_MACFA (Peroxiredoxin-2 OS=Macaca fascicularis OX=9541 GN=PRDX2 PE=2 SV=3)

HSP 1 Score: 258.455 bits (659), Expect = 1.448e-86
Identity = 115/187 (61.50%), Postives = 146/187 (78.07%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDFK+TAV++G F E  LS +KGK++VLFFYPLDFTFVCPTEI+AFS+R E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D +  +SE YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:   12 APDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Match: sp|P32119|PRDX2_HUMAN (Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5)

HSP 1 Score: 258.455 bits (659), Expect = 1.448e-86
Identity = 115/187 (61.50%), Postives = 146/187 (78.07%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDFK+TAV++G F E  LS +KGK++VLFFYPLDFTFVCPTEI+AFS+R E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D +  +SE YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:   12 APDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Match: sp|Q61171|PRDX2_MOUSE (Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 256.144 bits (653), Expect = 1.059e-85
Identity = 115/196 (58.67%), Postives = 150/196 (76.53%), Query Frame = 1
Query:  103 NSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N+Q+   + APDF +TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:    5 NAQI--GKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Match: sp|P35704|PRDX2_RAT (Peroxiredoxin-2 OS=Rattus norvegicus OX=10116 GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 254.988 bits (650), Expect = 3.763e-85
Identity = 113/187 (60.43%), Postives = 144/187 (77.01%), Query Frame = 1
Query:  130 APDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDF  TAV++G F E  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  E+F+   CEV+G S DS+++HLAW    R +GGLG +N PLL+D + S+S+ YGV+K + G+A+RGLFI+D   V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TIKPNV DSK+YF   N
Sbjct:   12 APDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198          
BLAST of Peroxiredoxin-1 vs. TrEMBL
Match: M9NTZ9 (Peroxiredoxin-1 OS=Dugesia japonica OX=6161 GN=PRX-1 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.073e-120
Identity = 167/207 (80.68%), Postives = 184/207 (88.89%), Query Frame = 1
Query:   73 MTYGLGDNMNNS-QLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            MT+G+GDN NNS  LLPSEKAPDFKS AV+NG FV CSLSQ+KGKFLVLFFYPLDFTFVCPTEI+AFSDRI EF  RNCE++GCSTDSEY HLAWTKL+R +GGLG I FPLLSDK+HSI EAYGVIKGN+GV+FRGLFI+D+ SVIR ITINDMPIGRSVDEVLRLVDAI FYD  GEVCPANW+KGDKTIKP+V  SKDYF  +N
Sbjct:    1 MTFGVGDNSNNSNHLLPSEKAPDFKSVAVLNGNFVNCSLSQYKGKFLVLFFYPLDFTFVCPTEIIAFSDRINEFHKRNCEIIGCSTDSEYCHLAWTKLNRKEGGLGLIEFPLLSDKAHSIGEAYGVIKGNSGVSFRGLFIIDDKSVIRHITINDMPIGRSVDEVLRLVDAILFYDANGEVCPANWKKGDKTIKPDVIGSKDYFNSSN 207          
BLAST of Peroxiredoxin-1 vs. TrEMBL
Match: A0A0V0J4N3 (Thioredoxin domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR150264 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.452e-95
Identity = 131/189 (69.31%), Postives = 156/189 (82.54%), Query Frame = 1
Query:  112 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            L P   APDFK TAV+NGEF E SL  +KGK+++LFFYPLDFTFVCPTEI+AFSD+ E+FKS+NCE++ CSTDSEYSHLAW K SR+DGGL  +N P+LSDKS SIS++YGV+   +GVAFRGLFI+D N  IRQIT+ND+P+GRSV+E LRL++A QF D  GEVCPANWR G KTIKP VK SK YF
Sbjct:    2 LQPGMPAPDFKGTAVVNGEFKEISLKDYKGKYVILFFYPLDFTFVCPTEILAFSDKAEKFKSKNCELIACSTDSEYSHLAWIKTSRSDGGLEGLNIPVLSDKSMSISKSYGVLNETSGVAFRGLFIIDGNGTIRQITVNDLPVGRSVEETLRLLEAFQFTDKYGEVCPANWRPGKKTIKPTVKGSKTYF 190          
BLAST of Peroxiredoxin-1 vs. TrEMBL
Match: A0A183SHQ8 (Thioredoxin domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3756 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 8.215e-95
Identity = 130/190 (68.42%), Postives = 155/190 (81.58%), Query Frame = 1
Query:  109 QLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
             L P   APDFK TAV+NGEF E SL  +KGK+++LFFYPLDFTFVCPTEI+AFSD+ E+FKS+NCE++ CSTDSEYSHLAW K SR+DGGL  +N P+LSDKS SIS++YGV+   +GVAFRGLFI+D    IRQIT+ND+P+GRSV+E LRL++A QF D  GEVCPANWR G KTIKP VK SK YF
Sbjct:   19 MLQPGMPAPDFKGTAVVNGEFKEISLKDYKGKYVILFFYPLDFTFVCPTEILAFSDKAEKFKSKNCELIACSTDSEYSHLAWIKTSRSDGGLEGLNIPVLSDKSMSISKSYGVLNETSGVAFRGLFIIDGKGTIRQITVNDLPVGRSVEETLRLLEAFQFTDKYGEVCPANWRPGKKTIKPTVKGSKTYF 208          
BLAST of Peroxiredoxin-1 vs. TrEMBL
Match: A0A182EQ75 (Thioredoxin domain-containing protein OS=Onchocerca ochengi OX=42157 GN=NOO_LOCUS10285 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 4.879e-90
Identity = 121/195 (62.05%), Postives = 157/195 (80.51%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
             +  S+    + AP+FK+TAV+NG+F E SL+QFKGK++VLFFYPLDFTFVCPTEI+AFSDRI EFK  +  V+ CSTDS +SHLAW    R  GGLG +N P+L+D +H+IS+AYGV+K + G+A+RGLFI+D+  ++RQIT+ND+P+GRSVDE LRL+ A QF DN GEVCPANW+ G +TIKP VK+SK+YF
Sbjct:    4 TLAGSKAFIGQPAPNFKTTAVVNGDFKEISLNQFKGKYVVLFFYPLDFTFVCPTEIIAFSDRISEFKKLDVAVMACSTDSHFSHLAWVNTDRKMGGLGQMNIPILADTNHAISKAYGVLKEDEGIAYRGLFIIDSKGILRQITVNDLPVGRSVDETLRLIQAFQFVDNHGEVCPANWQPGSETIKPEVKESKEYF 198          
BLAST of Peroxiredoxin-1 vs. TrEMBL
Match: O76452 (Peroxidoxin-2 OS=Onchocerca ochengi OX=42157 GN=PXN-2 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 5.370e-90
Identity = 121/195 (62.05%), Postives = 157/195 (80.51%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
             +  S+    + AP+FK+TAV+NG+F E SL+QFKGK++VLFFYPLDFTFVCPTEI+AFSDRI EFK  +  V+ CSTDS +SHLAW    R  GGLG +N P+L+D +H+IS+AYGV+K + G+A+RGLFI+D+  ++RQIT+ND+P+GRSVDE LRL+ A QF DN GEVCPANW+ G +TIKP VK+SK+YF
Sbjct:    2 TLAGSKAFIGQPAPNFKTTAVVNGDFKEISLNQFKGKYVVLFFYPLDFTFVCPTEIIAFSDRISEFKKLDVAVMACSTDSHFSHLAWVNTDRKMGGLGQMNIPILADTNHAISKAYGVLKEDEGIAYRGLFIIDSKGILRQITVNDLPVGRSVDETLRLIQAFQFVDNHGEVCPANWQPGSETIKPEVKESKEYF 196          
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000019562.2 (peroxiredoxin-1 [Source:NCBI gene;Acc:103031813])

HSP 1 Score: 246.128 bits (627), Expect = 1.022e-82
Identity = 109/185 (58.92%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  124 EKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            + AP FK+TAV+NGEF +  LS ++GK++VLFFYPLDFTFVCPTEI+AFS+  ++F    C+V+  STDS +SHLAW    R  GGLG +N PL++D + SIS  YGV+K + G+AFRGLF++D+  ++RQITIND+P+GRSVDE LRLV A Q+ D  GEVCPANW  G  TI P V++SK YF
Sbjct:   10 QPAPQFKATAVVNGEFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSESADKFSDIKCQVIAASTDSHFSHLAWINTPRKQGGLGPMNIPLVADLTQSISRDYGVLKEDEGIAFRGLFLIDDKGILRQITINDLPVGRSVDETLRLVKAFQYTDKHGEVCPANWEPGKDTIIPGVQESKKYF 194          
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000019565.2 (peroxiredoxin-1 [Source:NCBI gene;Acc:103031813])

HSP 1 Score: 244.973 bits (624), Expect = 3.560e-82
Identity = 109/185 (58.92%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  124 EKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            + AP FK+TAV+NGEF +  LS ++GK++VLFFYPLDFTFVCPTEI+AFS+  ++F    C+V+  STDS +SHLAW    R  GGLG +N PL++D + SIS  YGV+K + G+AFRGLF++D+  ++RQITIND+P+GRSVDE LRLV A Q+ D  GEVCPANW  G  TI P V++SK YF
Sbjct:   14 QPAPQFKATAVVNGEFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSESADKFSDIKCQVIAASTDSHFSHLAWINTPRKQGGLGPMNIPLVADLTQSISRDYGVLKEDEGIAFRGLFLIDDKGILRQITINDLPVGRSVDETLRLVKAFQYTDKHGEVCPANWEPGKDTIIPGVQESKKYF 198          
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:103023705])

HSP 1 Score: 243.432 bits (620), Expect = 1.334e-81
Identity = 110/188 (58.51%), Postives = 141/188 (75.00%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            APDF + AVM +G+F +  LS ++GK++VLFFYPLDFTFVCPTEI+AFSD  EEF+  +CEV+G S DS + HLAW    R  GGLG +N PL++D   +IS  YGV+K + G+AFRGLFI+D+   +RQITIND+P+GRS+DE LRLV A Q+ D  GEVCPA W+ G  TIKP+V+ SKD+F   N
Sbjct:   12 APDFTAKAVMPDGQFKDLKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKIDCEVIGASVDSHFCHLAWINTPRKQGGLGHMNVPLVADTLRTISRDYGVLKEDEGIAFRGLFIIDDKGTLRQITINDLPVGRSIDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIKPDVQKSKDFFSKQN 199          
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Match: prdx3 (peroxiredoxin 3 [Source:NCBI gene;Acc:103033576])

HSP 1 Score: 238.81 bits (608), Expect = 4.806e-79
Identity = 108/190 (56.84%), Postives = 137/190 (72.11%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            ++ AP FK TAV  GEF + SL  +KGK+LVLFFYPLDFTFVCPTEI++FSD+  EF   NC VVG S DS ++HLAWT   R  GGLG IN PLL+D +  +S  YGV+    G+A RGLFI+D N VI+ +++ND+P+GRSV+E LRLV A QF ++ GEVCPA+W     TIKP  + SK+YF+  N
Sbjct:   61 TQHAPHFKGTAVHKGEFKDISLDDYKGKYLVLFFYPLDFTFVCPTEIISFSDKASEFHDINCAVVGVSVDSHFTHLAWTNTPRKSGGLGKINIPLLADLNKQVSRDYGVLLEGPGIALRGLFIIDPNGVIKHMSVNDLPVGRSVEETLRLVKAFQFVESHGEVCPASWTPKSPTIKPTPQGSKEYFEKVN 250          
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Match: prdx4 (peroxiredoxin 4 [Source:NCBI gene;Acc:103026884])

HSP 1 Score: 234.958 bits (598), Expect = 2.208e-77
Identity = 109/199 (54.77%), Postives = 139/199 (69.85%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            +++ S+   S+ AP ++ TAV+NGEF E  LS +KGK+LV FFYPLDFTFVCPTEI+AFSDR+ EF + N +VV CS DS+++HLAW    R  GGLG +  PLLSD +H IS+ YGV   + G   RGLFI+D+   +RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TI P+      YF   N
Sbjct:   65 SLHLSKAKISKPAPKWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFHAINADVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGTLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPSGKLKYFDKLN 263          
BLAST of Peroxiredoxin-1 vs. Ensembl Sea Lamprey
Match: prdx2 (peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2])

HSP 1 Score: 242.276 bits (617), Expect = 8.602e-82
Identity = 105/186 (56.45%), Postives = 143/186 (76.88%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
             + APDF   AV+NG F +  LS +KGK++VLFFYPLDFTFVCPTEI+AF+DR+ EF   +C V+  STDS++SHLAW    R  GGLG +  PLL+D++ ++++ YGV+K + G+A+RGLFI+D   ++RQITIND+P+GR VDE+LRLV A +F D+ GEVCPA W+ G  TIKP+V+ SK++F
Sbjct:    9 GKPAPDFSGVAVVNGAFKDIKLSNYKGKYVVLFFYPLDFTFVCPTEIIAFNDRLPEFTKLDCAVIAASTDSQFSHLAWVNTPRKQGGLGHMEIPLLADRTCNVAKNYGVLKEDEGIAYRGLFIIDGKGILRQITINDLPVGRDVDEILRLVQAFKFTDDHGEVCPAGWKPGKDTIKPDVQKSKEFF 194          
BLAST of Peroxiredoxin-1 vs. Ensembl Sea Lamprey
Match: prdx3 (peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-18])

HSP 1 Score: 241.506 bits (615), Expect = 2.636e-81
Identity = 112/190 (58.95%), Postives = 140/190 (73.68%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            ++ AP FK+TAV +G+F E SL  FKG++LVLFFYPLDFTFVCPTEI+AFS++  EF   NC+VVG S DS +SHLAW    R  GGLG +N PLLSD S +IS+ YGV+    GVA RGLF++D N V+R  ++ND+P+GRSV+E LRLV A QF +  GEVCPANW     TIKPN +DS +YF+  N
Sbjct:   21 TKPAPHFKATAVDDGKFRELSLDDFKGQYLVLFFYPLDFTFVCPTEIIAFSEKANEFHQINCQVVGVSVDSHFSHLAWINTPRKAGGLGHMNIPLLSDFSKNISKDYGVLLEEAGVALRGLFLIDPNGVVRHASVNDLPVGRSVEETLRLVKAFQFVEEHGEVCPANWTPEAPTIKPNPQDSLEYFEKVN 210          
BLAST of Peroxiredoxin-1 vs. Ensembl Yeast
Match: TSA1 (Thioredoxin peroxidase; acts as both ribosome-associated and free cytoplasmic antioxidant; self-associates to form high-molecular weight chaperone complex under oxidative stress; chaperone activity essential for growth in zinc deficiency; required for telomere length maintenance; binds and modulates Cdc19p activity; protein abundance increases, forms cytoplasmic foci during DNA replication stress; TSA1 has a paralog, TSA2, that arose from the whole genome duplication [Source:SGD;Acc:S000004490])

HSP 1 Score: 234.187 bits (596), Expect = 8.102e-79
Identity = 110/190 (57.89%), Postives = 141/190 (74.21%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
             ++AP FK TAV++G F E SL ++KGK++VL F PL FTFVCPTEI+AFS+  ++F+ +  +V+  STDSEYS LAWT + R +GGLG IN PLL+D +HS+S  YGV+    GVA RGLFI+D   VIR ITIND+P+GR+VDE LRLV+A Q+ D  G V P NW  G  TIKP V+DSK+YF+ AN
Sbjct:    6 QKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAAN 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Yeast
Match: TSA2 (Stress inducible cytoplasmic thioredoxin peroxidase; cooperates with Tsa1p in the removal of reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; deletion enhances the mutator phenotype of tsa1 mutants; protein abundance increases in response to DNA replication stress; TSA2 has a paralog, TSA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002861])

HSP 1 Score: 230.335 bits (586), Expect = 2.637e-77
Identity = 109/190 (57.37%), Postives = 140/190 (73.68%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
             ++AP FK TAV++G F E SL ++KGK++VL F PL F+FVCPTEIVAFSD  ++F+ +  +V+  STDSEYS LAWT L R DGGLG +  PLL+DK+HS+S  YGV+    G+A RGLFI+D   +IR ITIND+ +GR+V+E LRLV+  Q+ D  G V P NW  G  TIKP+VKDSK+YFK AN
Sbjct:    6 QKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNAN 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Yeast
Match: PRX1 (Mitochondrial peroxiredoxin with thioredoxin peroxidase activity; has a role in reduction of hydroperoxides; reactivation requires Trr2p and glutathione; induced during respiratory growth and oxidative stress; phosphorylated; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000160])

HSP 1 Score: 95.1301 bits (235), Expect = 4.491e-24
Identity = 52/155 (33.55%), Postives = 79/155 (50.97%), Query Frame = 1
Query:  211 VLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKG------NTGV--AFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKP 651
            VLF +P DFT VC TE+ AF+    EF  RN +++G S +   SH  W +  +    +  + FP++ D   +++  Y ++        N G     R +F++D    IR I      +GR+  EVLR++DA+Q  D  G V P NW+  D  I P
Sbjct:   79 VLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIP 233          
BLAST of Peroxiredoxin-1 vs. Ensembl Nematostella
Match: EDO48197 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK73])

HSP 1 Score: 250.366 bits (638), Expect = 1.035e-84
Identity = 115/184 (62.50%), Postives = 141/184 (76.63%), Query Frame = 1
Query:  130 APDFKSTAV-MNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            AP F  TAV  +GEF++  LS +KGK++VLFFYPLDFTFVCPTEI+AFSDR++EFK+ NCEV+ CS DSEYSHLAWT + R  GG+G IN P+LSD +  IS+ YGV+  + GVA RGLFI+D+  ++RQITIND+P+GRSVDE LRL+ A QF D  GEVCPA WR G  TI P  + S  YF
Sbjct:   10 APAFSGTAVNKHGEFIDLKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLPVGRSVDETLRLIQAFQFTDKHGEVCPAGWRPGADTIIPEPQKSSSYF 193          
BLAST of Peroxiredoxin-1 vs. Ensembl Nematostella
Match: EDO38694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC77])

HSP 1 Score: 244.588 bits (623), Expect = 1.078e-81
Identity = 113/187 (60.43%), Postives = 141/187 (75.40%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            S+ AP ++ TAV+NGEF E  LS F+GK+LV FFYPLDFTFVCPTEI+AFSDRIEEF++ N EVVGCS DS ++HLAW    R +GGLG + +PLLSD +H +S+ YGV+  N G   RGLFI+D+  V+RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TI P+    K YF+
Sbjct:   57 SKPAPFWEGTAVVNGEFKELKLSDFEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAWINSPRKEGGLGNLKYPLLSDINHQVSKDYGVLLENEGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYFE 243          
BLAST of Peroxiredoxin-1 vs. Ensembl Nematostella
Match: EDO28895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T568])

HSP 1 Score: 87.0409 bits (214), Expect = 2.769e-21
Identity = 45/105 (42.86%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  367 RNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            R +GGLG + +PLLSD +H +S+ YGV+  N G               ++ T+    +GRSVDE LRLV A Q+ D  GEVCPA W+ G  TI P+    K YF+
Sbjct:   79 RKEGGLGNLKYPLLSDINHQVSKDYGVLLENEGHTLS----------YQECTLK--LVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYFE 171          
BLAST of Peroxiredoxin-1 vs. Ensembl Nematostella
Match: EDO47205 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT9])

HSP 1 Score: 77.411 bits (189), Expect = 2.469e-17
Identity = 46/173 (26.59%), Postives = 85/173 (49.13%), Query Frame = 1
Query:  193 FKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTK------LSRNDGGLGAINFPLLSDKSHSISEAYGVI----KGNTGVAF--RGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWR-KGDKTIKPNVKDSKD 672
             K  + +LF +P D+T VC TE+   +    EFK R  ++ G S D   SH  W K      L +N       N+P+++D+   ++   G++    K + G+    R +FI+  +  ++   +     GR+ DE+LR++D++Q         P +W+  GD  + P++K  ++
Sbjct:   26 IKDSWAILFSHPADYTPVCTTELGRVAQLEPEFKKRGVKMAGLSCDDAESHRGWVKDITKYNLEQNKSS-AKFNYPIIADERRELAVKLGMVDPDEKDSKGLPLTCRAVFIIGPDKKLKLSILYPATTGRNFDEILRVIDSLQLTATKKVATPVDWKLGGDCMVIPSIKPEEE 197          
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Match: prdx2 (peroxiredoxin 2 [Source:NCBI gene;Acc:101170008])

HSP 1 Score: 252.292 bits (643), Expect = 4.961e-85
Identity = 112/194 (57.73%), Postives = 146/194 (75.26%), Query Frame = 1
Query:   97 MNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            M+  +    + APDFK+TAV++G+F +  LS +KGK++V FFYPLDFTFVCPTEI+AFSDR EEF+   CEV+GCS DS +SHLAW    R  GGLG++  PL++D + SIS  YGV+K + G+A+RGLF++D N V+RQITIND+P+GRSVDE LRL+ A Q  D  GEVCPA W+ G  TI P+V+ SK +F
Sbjct:    1 MSAGKAQIGQPAPDFKATAVVDGQFKDLKLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFRKIGCEVIGCSVDSHFSHLAWINTPRKQGGLGSMKIPLVADLTKSISRDYGVLKEDDGIAYRGLFVIDGNGVLRQITINDLPVGRSVDETLRLIQAFQHTDKYGEVCPAGWKPGSDTIVPDVEKSKAFF 194          
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:101175597])

HSP 1 Score: 239.195 bits (609), Expect = 7.456e-80
Identity = 107/184 (58.15%), Postives = 139/184 (75.54%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            APDF + AVM +G+F +  LS ++GK++V FFYPLDFTFVCPTEI+AFSD  ++F+   CEV+  S DS +SH AWT   R  GGLG++  PL+SD   +IS  YGV+K + G+A+RGLFI+D+  V+RQITIND+P+GRSV+E LRLV A QF D  GEVCPA W+ G  TIKP+V+ SKD+F
Sbjct:   12 APDFTAKAVMPDGQFKDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSDAADDFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGSMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGVLRQITINDLPVGRSVEETLRLVQAFQFTDEHGEVCPAGWKPGSDTIKPDVQKSKDFF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:101175597])

HSP 1 Score: 239.195 bits (609), Expect = 7.456e-80
Identity = 107/184 (58.15%), Postives = 139/184 (75.54%), Query Frame = 1
Query:  130 APDFKSTAVM-NGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            APDF + AVM +G+F +  LS ++GK++V FFYPLDFTFVCPTEI+AFSD  ++F+   CEV+  S DS +SH AWT   R  GGLG++  PL+SD   +IS  YGV+K + G+A+RGLFI+D+  V+RQITIND+P+GRSV+E LRLV A QF D  GEVCPA W+ G  TIKP+V+ SKD+F
Sbjct:   12 APDFTAKAVMPDGQFKDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSDAADDFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGSMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGVLRQITINDLPVGRSVEETLRLVQAFQFTDEHGEVCPAGWKPGSDTIKPDVQKSKDFF 195          
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Match: prdx4 (peroxiredoxin-4 [Source:NCBI gene;Acc:101166157])

HSP 1 Score: 239.965 bits (611), Expect = 2.293e-79
Identity = 109/186 (58.60%), Postives = 135/186 (72.58%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYF 678
            S+ AP ++ TAV+NGEF E  LS +KGK+LV FFYPLDFTFVCPTEI+AFSDR+ EF++ N EVV CS DS+++HLAW    R  GGLG +  PLLSD +H IS+ YGV   + G   RGLFI+DN  ++RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TI P+      YF
Sbjct:   68 SKPAPHWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFRAINTEVVACSVDSQFTHLAWINTPRKQGGLGEMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDNKGILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPSGKLKYF 253          
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Match: prdx3 (peroxiredoxin 3 [Source:NCBI gene;Acc:101157243])

HSP 1 Score: 239.195 bits (609), Expect = 3.560e-79
Identity = 110/187 (58.82%), Postives = 136/187 (72.73%), Query Frame = 1
Query:  121 SEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            ++ AP FK+TAV NGEF + SL+ FKGK+LVLFFYPLDFTFVCPTEI++FSD+  EF   NCEVVG S DS ++HLAW    R  GGLG I+ PLLSD +  IS  YGV+    G+A RGLFI+D N V+R +++ND+P+GR VDE LRLV A QF +  GEVCPA+W     TIKP    SK+YF+
Sbjct:   60 TQPAPAFKATAVHNGEFKDLSLADFKGKYLVLFFYPLDFTFVCPTEIISFSDKASEFHDINCEVVGVSVDSHFTHLAWINTPRKAGGLGNIHIPLLSDLNKQISRDYGVLLEAPGIALRGLFIIDPNGVVRHMSVNDLPVGRCVDETLRLVRAFQFVETHGEVCPASWTPDSPTIKPTPHGSKEYFE 246          
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Match: SMESG000024235.1 (SMESG000024235.1)

HSP 1 Score: 426.787 bits (1096), Expect = 5.326e-154
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 1
Query:   73 MTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            MTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN
Sbjct:    1 MTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 206          
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Match: SMESG000024235.1 (SMESG000024235.1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.949e-147
Identity = 198/198 (100.00%), Postives = 198/198 (100.00%), Query Frame = 1
Query:   97 MNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            MNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN
Sbjct:    1 MNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 198          
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Match: SMESG000001807.1 (SMESG000001807.1)

HSP 1 Score: 261.922 bits (668), Expect = 4.011e-89
Identity = 115/190 (60.53%), Postives = 152/190 (80.00%), Query Frame = 1
Query:  112 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            L P   AP F++ AV +GE ++ SLS ++GK++VLFFYP DFTFVCPTEI+AF+DR +EF+  NCEV+ CSTDSE+SH AWT   R  GG+G ++ PL++DK+ SIS++YGV+K N G+AFRGLFI+ N  +IRQITINDMP+GRS+DE LRLV A+Q+ D  GEVCPA W+ G KTIKP+++ ++DYFK
Sbjct:    3 LQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFNDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 192          
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Match: SMESG000001807.1 (SMESG000001807.1)

HSP 1 Score: 261.922 bits (668), Expect = 6.464e-89
Identity = 115/190 (60.53%), Postives = 152/190 (80.00%), Query Frame = 1
Query:  112 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 681
            L P   AP F++ AV +GE ++ SLS ++GK++VLFFYP DFTFVCPTEI+AF+DR +EF+  NCEV+ CSTDSE+SH AWT   R  GG+G ++ PL++DK+ SIS++YGV+K N G+AFRGLFI+ N  +IRQITINDMP+GRS+DE LRLV A+Q+ D  GEVCPA W+ G KTIKP+++ ++DYFK
Sbjct:   10 LQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFNDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 199          
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Match: SMESG000066780.1 (SMESG000066780.1)

HSP 1 Score: 242.662 bits (618), Expect = 9.054e-81
Identity = 115/199 (57.79%), Postives = 140/199 (70.35%), Query Frame = 1
Query:   94 NMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFKGAN 690
            N++ S+   S+ AP F+ TAV+NG F +  L  F GK+LV FFYPLDFTFVCPTEI+AFSDRI+EF   N  VVGCS DS+++HLAW    RN GGLG I +PLLSD SH IS+ YGV     G A RGLFI+D   ++RQIT+ND+P+GRSVDE LRLV A Q+ D  GEVCPA W+ G  TI P+    K+YF   N
Sbjct:   44 NLHISKAQISKLAPHFEGTAVVNGSFQDIKLKDFLGKYLVFFFYPLDFTFVCPTEIIAFSDRIKEFHDINTNVVGCSVDSQFTHLAWLNTPRNQGGLGQILYPLLSDLSHQISKDYGVYLEEAGHALRGLFIIDTKGILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGADTIIPDPIKKKEYFSKQN 242          
The following BLAST results are available for this feature:
BLAST of Peroxiredoxin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRDX23.016e-8761.50peroxiredoxin 2 [Source:HGNC Symbol;Acc:HGNC:9353][more]
PRDX16.326e-8560.87peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352][more]
PRDX16.326e-8560.87peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352][more]
PRDX31.305e-7958.95peroxiredoxin 3 [Source:HGNC Symbol;Acc:HGNC:9354][more]
PRDX41.451e-7854.77peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx-22.545e-8661.46PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-22.897e-8661.46PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-23.117e-8661.46PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-23.117e-8661.46PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-32.150e-7452.85Probable peroxiredoxin prdx-3 [Source:UniProtKB/S... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jafrac14.668e-8258.70gene:FBgn0040309 transcript:FBtr0339699[more]
Jafrac14.668e-8258.70gene:FBgn0040309 transcript:FBtr0345161[more]
Jafrac14.668e-8258.70gene:FBgn0040309 transcript:FBtr0339700[more]
Jafrac14.668e-8258.70gene:FBgn0040309 transcript:FBtr0073764[more]
Jafrac14.668e-8258.70gene:FBgn0040309 transcript:FBtr0073763[more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx12.096e-8460.64peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx12.096e-8460.64peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx12.096e-8460.64peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx23.935e-8156.76peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2... [more]
prdx36.297e-8158.42peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox41.216e-8555.77SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727][more]
sox43.411e-8556.93SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727][more]
mfap31.867e-8461.96microfibril associated protein 3 [Source:Xenbase;A... [more]
prdx11.867e-8461.96peroxiredoxin 1 [Source:NCBI gene;Acc:496551][more]
sacm1l2.430e-7959.14SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prdx21.514e-8658.67peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx21.514e-8658.67peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx21.514e-8658.67peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx21.514e-8658.67peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx19.644e-8560.33peroxiredoxin 1 [Source:MGI Symbol;Acc:MGI:99523][more]
back to top
BLAST of Peroxiredoxin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17172|TDX2_BRUMA4.355e-8760.20Peroxiredoxin 2 OS=Brugia malayi OX=6279 GN=tsa-2 ... [more]
sp|Q2PFZ3|PRDX2_MACFA1.448e-8661.50Peroxiredoxin-2 OS=Macaca fascicularis OX=9541 GN=... [more]
sp|P32119|PRDX2_HUMAN1.448e-8661.50Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 P... [more]
sp|Q61171|PRDX2_MOUSE1.059e-8558.67Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 ... [more]
sp|P35704|PRDX2_RAT3.763e-8560.43Peroxiredoxin-2 OS=Rattus norvegicus OX=10116 GN=P... [more]
back to top
BLAST of Peroxiredoxin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M9NTZ91.073e-12080.68Peroxiredoxin-1 OS=Dugesia japonica OX=6161 GN=PRX... [more]
A0A0V0J4N31.452e-9569.31Thioredoxin domain-containing protein OS=Schistoce... [more]
A0A183SHQ88.215e-9568.42Thioredoxin domain-containing protein OS=Schistoce... [more]
A0A182EQ754.879e-9062.05Thioredoxin domain-containing protein OS=Onchocerc... [more]
O764525.370e-9062.05Peroxidoxin-2 OS=Onchocerca ochengi OX=42157 GN=PX... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019562.21.022e-8258.92peroxiredoxin-1 [Source:NCBI gene;Acc:103031813][more]
ENSAMXT00000019565.23.560e-8258.92peroxiredoxin-1 [Source:NCBI gene;Acc:103031813][more]
prdx11.334e-8158.51peroxiredoxin-1 [Source:NCBI gene;Acc:103023705][more]
prdx34.806e-7956.84peroxiredoxin 3 [Source:NCBI gene;Acc:103033576][more]
prdx42.208e-7754.77peroxiredoxin 4 [Source:NCBI gene;Acc:103026884][more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prdx28.602e-8256.45peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2... [more]
prdx32.636e-8158.95peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TSA18.102e-7957.89Thioredoxin peroxidase; acts as both ribosome-asso... [more]
TSA22.637e-7757.37Stress inducible cytoplasmic thioredoxin peroxidas... [more]
PRX14.491e-2433.55Mitochondrial peroxiredoxin with thioredoxin perox... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO481971.035e-8462.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386941.078e-8160.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288952.769e-2142.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472052.469e-1726.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peroxiredoxin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx24.961e-8557.73peroxiredoxin 2 [Source:NCBI gene;Acc:101170008][more]
prdx17.456e-8058.15peroxiredoxin-1 [Source:NCBI gene;Acc:101175597][more]
prdx17.456e-8058.15peroxiredoxin-1 [Source:NCBI gene;Acc:101175597][more]
prdx42.293e-7958.60peroxiredoxin-4 [Source:NCBI gene;Acc:101166157][more]
prdx33.560e-7958.82peroxiredoxin 3 [Source:NCBI gene;Acc:101157243][more]
back to top
BLAST of Peroxiredoxin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024235.15.326e-154100.00SMESG000024235.1[more]
SMESG000024235.11.949e-147100.00SMESG000024235.1[more]
SMESG000001807.14.011e-8960.53SMESG000001807.1[more]
SMESG000001807.16.464e-8960.53SMESG000001807.1[more]
SMESG000066780.19.054e-8157.79SMESG000066780.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030295 ID=SMED30030295|Name=Peroxiredoxin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=731bp
TCTTGTTTAAATTAATCATAATAATATAAAAGACATATTTAATCTGCTGT
TCAAATTGATATTGTATTAATAATGACTTACGGTTTGGGTGATAATATGA
ATAATTCTCAATTACTTCCCTCAGAGAAGGCTCCAGATTTCAAATCAACT
GCCGTGATGAACGGCGAGTTTGTTGAATGTAGTTTATCTCAATTTAAAGG
AAAGTTTTTGGTCTTATTTTTTTATCCATTGGATTTCACTTTTGTATGTC
CTACCGAAATAGTGGCGTTTAGTGATAGAATTGAAGAGTTTAAAAGTAGG
AATTGTGAAGTTGTTGGTTGTTCCACAGATTCAGAATATTCTCATTTGGC
GTGGACTAAACTCAGTCGCAACGACGGAGGACTTGGTGCTATCAACTTCC
CACTATTGAGTGACAAGTCTCATTCTATTAGCGAAGCTTATGGCGTAATT
AAAGGAAATACTGGAGTGGCTTTTAGAGGATTGTTTATTCTGGATAATAA
TAGCGTTATTCGTCAAATAACAATAAATGACATGCCAATTGGTCGATCTG
TGGATGAAGTTTTAAGACTTGTAGATGCAATACAGTTTTATGATAATGTT
GGAGAAGTGTGTCCGGCTAATTGGAGAAAAGGAGATAAAACTATTAAACC
AAATGTTAAAGATAGTAAAGATTATTTTAAGGGTGCCAATTAAAAATTGA
AATAAAATTTTGTTTGTTGTCTGCAAAAAAA
back to top

protein sequence of SMED30030295-orf-1

>SMED30030295-orf-1 ID=SMED30030295-orf-1|Name=SMED30030295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MTYGLGDNMNNSQLLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFF
YPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRN
DGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQIT
INDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKD
YFKGAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR024706Peroxiredoxin_AhpC-typ
IPR012336Thioredoxin-like_fold
IPR019479Peroxiredoxin_C
IPR000866AhpC/TSA
IPR013766Thioredoxin_domain
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
GO:0098869cellular oxidant detoxification
Vocabulary: molecular function
TermDefinition
GO:0051920peroxiredoxin activity
GO:0016491oxidoreductase activity
GO:0016209antioxidant activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000866Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidantPFAMPF00578AhpC-TSAcoord: 18..148
e-value: 5.7E-36
score: 123.2
IPR019479Peroxiredoxin, C-terminalPFAMPF104171-cysPrx_Ccoord: 169..204
e-value: 1.1E-10
score: 41.1
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 13..205
e-value: 3.1E-84
score: 283.1
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 14..203
IPR024706Peroxiredoxin, AhpC-typePIRSFPIRSF000239AHPCcoord: 9..205
e-value: 1.2E-62
score: 208.2
NoneNo IPR availablePANTHERPTHR10681THIOREDOXIN PEROXIDASEcoord: 9..203
NoneNo IPR availablePANTHERPTHR10681:SF102PEROXIREDOXIN-2coord: 9..203
NoneNo IPR availableCDDcd03015PRX_Typ2cyscoord: 19..187
e-value: 9.32052E-105
score: 297.109
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 14..172
score: 16.903