Cytochrome P450, family 1, subfamily D, polypeptide 1

Overview
NameCytochrome P450, family 1, subfamily D, polypeptide 1
Smed IDSMED30030292
Length (bp)1587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450, family 1, subfamily D, polypeptide 1 (SMED30030292) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450, family 1, subfamily D, polypeptide 1 (SMED30030292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450, family 1, subfamily D, polypeptide 1 (SMED30030292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450, family 1, subfamily D, polypeptide 1 (SMED30030292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030292h1SMcG0001122 Contig45358newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030292h1SMcG0001122 Contig45358uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30030292h1SMcG0001122 dd_Smed_v4_2162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030292h1SMcG0001122 dd_Smed_v4_2162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030292h1SMcG0001122 dd_Smed_v4_2162_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30030292h1SMcG0001122 dd_Smed_v6_2162_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30030292h1SMcG0001122 SMED30030292smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030292h1SMcG0001122 SMED30030292smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30030292h1SMcG0001122 dd_Smed_v6_2162_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30030292h1SMcG0001122 dd_Smed_v4_2162_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Match: CYP1A1 (cytochrome P450 family 1 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2595])

HSP 1 Score: 160.999 bits (406), Expect = 8.946e-43
Identity = 119/451 (26.39%), Postives = 205/451 (45.45%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPS--------LEKNIQKSINFYCDELIRNPDNSGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTD--RSDIMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            L+ PPGPW  P  G+    G N  +   RM +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + T  ++S  +   F  + GP+W    R  + G+    +           LE+++ K        L      +G G F P+        N + +I  GR +    ++ + L +      +++      ++IP  RYLP   +    + + K  + + K V +  K    G  R+  D++IE+     +  +L     V L+D  I  I  D+  A ++ +     W +  L ++P++Q +I+ ++  +  + +   P+   ++ LPY++A   E FR SS V     H   +  +L G++IPKG  + VNQ+ INHD + W NP    PERFL   GA        ++ FGMG R C G +I +   FL L  L
Sbjct:   37 LKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQ----QYGDVLQIRIGSTPVVVLSGLDTIRQAL-VRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTL--QELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEH----CQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSR--RPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAIL 474          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Match: CYP1A1 (cytochrome P450 family 1 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2595])

HSP 1 Score: 160.999 bits (406), Expect = 8.946e-43
Identity = 119/451 (26.39%), Postives = 205/451 (45.45%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPS--------LEKNIQKSINFYCDELIRNPDNSGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTD--RSDIMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            L+ PPGPW  P  G+    G N  +   RM +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + T  ++S  +   F  + GP+W    R  + G+    +           LE+++ K        L      +G G F P+        N + +I  GR +    ++ + L +      +++      ++IP  RYLP   +    + + K  + + K V +  K    G  R+  D++IE+     +  +L     V L+D  I  I  D+  A ++ +     W +  L ++P++Q +I+ ++  +  + +   P+   ++ LPY++A   E FR SS V     H   +  +L G++IPKG  + VNQ+ INHD + W NP    PERFL   GA        ++ FGMG R C G +I +   FL L  L
Sbjct:   37 LKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQ----QYGDVLQIRIGSTPVVVLSGLDTIRQAL-VRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTL--QELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEH----CQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSR--RPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAIL 474          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Match: CYP1A1 (cytochrome P450 family 1 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2595])

HSP 1 Score: 160.999 bits (406), Expect = 8.946e-43
Identity = 119/451 (26.39%), Postives = 205/451 (45.45%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPS--------LEKNIQKSINFYCDELIRNPDNSGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTD--RSDIMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            L+ PPGPW  P  G+    G N  +   RM +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + T  ++S  +   F  + GP+W    R  + G+    +           LE+++ K        L      +G G F P+        N + +I  GR +    ++ + L +      +++      ++IP  RYLP   +    + + K  + + K V +  K    G  R+  D++IE+     +  +L     V L+D  I  I  D+  A ++ +     W +  L ++P++Q +I+ ++  +  + +   P+   ++ LPY++A   E FR SS V     H   +  +L G++IPKG  + VNQ+ INHD + W NP    PERFL   GA        ++ FGMG R C G +I +   FL L  L
Sbjct:   37 LKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQ----QYGDVLQIRIGSTPVVVLSGLDTIRQAL-VRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTL--QELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEH----CQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSR--RPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAIL 474          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Match: CYP1A2 (cytochrome P450 family 1 subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:2596])

HSP 1 Score: 150.599 bits (379), Expect = 5.186e-39
Identity = 113/457 (24.73%), Postives = 208/457 (45.51%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNS----------GKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVT------EKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR---SDIMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            L+ PP PW  P  G+    G N  +   RM +    +YG+++ +  G+TP++ ++      +AL  + G    GR  + T  ++++ +   F  + GP+W    R  +  ++    T S+  +   S + Y +E +     +          G G F P+++      N + ++  G+ F    ++ + L  +  +  +       +++ P  RYLP   ++R    + +    L K V +  +    +N+  +I   L + ++     +      EK VNL +        DI  A ++ +     W +  L   P+IQ +I+ ++  +  +++   P+   + +LPY++A   E FR SS +     H   +  TL G++IPK C + VNQ+ +NHD E WE+P   +PERFL + G   ++     +M FGMG R C G  + K   FL L  L
Sbjct:   39 LKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ----RYGDVLQIRIGSTPVLVLSRLDTIRQAL-VRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLAQNALN----TFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQ-DFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNLVN--------DIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRER--RPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAIL 475          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 147.902 bits (372), Expect = 6.897e-38
Identity = 114/464 (24.57%), Postives = 210/464 (45.26%), Query Frame = 3
Query:  108 LPPGPWALPFWGNY---------------------RGFNGAMIYKR-MVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTP-SLEKNIQKSINFYCDELIRNPDNSGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSE--FVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIE-YLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNY 1418
            +PPGP   P  GN+                      G + ++I  + ++ +    YG++ + F G+  +V ++D+    EAL  +  +  + R  V    IV++E+  +F + YGP+W++  +     +   GL   SLE  I +   +   E+ ++    G+  F PF        N + S+  G+ F   + ++  +     +  +I   S+   VN  P+  YLP    + L +    + + L K + D ++    R NP + I+ YLL   E  K       + ++ ++  I  D+  A  +    + +W +  + L+P +QE++  +I ++    +   P    K ++PY +A   E  R + +V +   H   ++  L GY IPKG LI  N ++++ D   WE PE   P RFLD  G    +   +PFG+G R+C G  + K   FL+  +L  ++
Sbjct:   59 IPPGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREAL-VQQAEVFSDRPRVPLISIVTKEKGVVFAH-YGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKH----GEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQE-SLDRENPQDFIDMYLLHMEEERK--NNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANR--APSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSF 511          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Match: cyp-35C1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:G5ECD0])

HSP 1 Score: 120.939 bits (302), Expect = 3.699e-29
Identity = 122/484 (25.21%), Postives = 218/484 (45.04%), Query Frame = 3
Query:   57 VGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYK-----RMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSL-EKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLS-IVIGRTFTLEDEDYIILQDSRRQVFDI-MDKSEFVNWIPFGRYLPLKCIRRL----FEQSTKLNNLLAKFVS-DARKMGR------YRNNPDNIIE----YLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSE 1439
            V ++S     +F++  RLPPGP++LP  GN     G  +++      M+ +++ +YG++ TL+ G  P V I +Y+L+ E    KN    A +      D V +     F N  G  W+E+ R   L +   G+   L E+ I   ++  C E I      G  V   +E + L+  ++++ +++G  F    +   +   + + +FD  MDK       P    LP+  +++     F    K    +  +VS DA K  R      Y  +P+N+ +    +LL+  +N K     + NL     + +  D+     E    T +        +PQ+ + ++ ++ K+ +           K E PY+ A   E  R +SI+ I  +    +   +GG+ +  GCLIA    A++ + + +ENPE   PERF+ +          +PFG+G R C G S+ +   +L++ NL L Y  + S +
Sbjct:    8 VSIISFLTARQFLKAKRLPPGPFSLPLIGNAHQV-GYQLWRTGGVTNMLNHFRKEYGDIFTLWLGPIPHVNITNYELSHEVFV-KNSTKYADKHVSPMIDYVRKGNGVFFSN--GDKWQELRRFSMLTMRNMGMGRDLMEEKILSELDARCAE-INEKSIDGTTVLQVNEFFDLTVGSIINNMLLGFRFDERTKSRFL---TMKHMFDEGMDK-----MTPLFFTLPVWALQKFLAKDFNSIIKDQFEIIDYVSVDAIKRSRDFMNGDYEIDPNNVEDIVDAFLLKMKQNPKSDVYDENNL-----KMLITDLWITGQETTTTTLVSAFIQFLNNPQVMDTVQKELIKVTNGGSRQL-SLRDKTETPYLNATIAEVQRHASILNINFWRINNEPTVIGGHPVDSGCLIASQLSALHTNEKIFENPEKFNPERFIRNENLM---QQTIPFGIGKRSCLGESLARAELYLIIGNLLLRYNFESSGK 469          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Match: cyp-35A2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O02628])

HSP 1 Score: 117.087 bits (292), Expect = 6.652e-28
Identity = 120/488 (24.59%), Postives = 219/488 (44.88%), Query Frame = 3
Query:   63 LLSVFVILKFIERLRLPPGPWALPFWGN------YRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPS-LEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVL-SIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFE---------QSTKLNNLLAKFVS--DARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHI---RQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELV 1460
            LL   ++ ++ +  RLPPGP +LP  GN      Y    G ++    ++ ++ +YGN+ TL+ G  P V I DY+ + E      GK+     +    D+ ++    +   N G  W+EM R         G+    +E  I + ++  C ++ +   N G  +    E + L+  +++ SI++G+ F  ED  +  L+     + + MD S F  + PF    P+  ++  F+         Q T  N   A+ +   ++ K G+Y  + +N+ +Y    T+   L  +K+    D +I   + +  D+     E    T I     L LHP++  + R +I K+           + +   PY+ AV  E  R +SI+ +  +    +   +GG+ +  G L+     A++ +   ++NP+   PERF+           ++PFG+G R C G S+ K   +L+  NL L YK +   +   TEL+
Sbjct:   10 LLGYLIVRQYQKVSRLPPGPISLPLIGNLPQIIYYLWSTGGIV--STLDLFRKRYGNIFTLWVGPIPHVSIADYETSHEVFVKNAGKYADKFHAPVMRDVRND--IGVLITN-GDHWQEMRRFSLQAFRNMGVGKDIMETRIMEELDARCSDIDKLATN-GVTITHASEFFDLTVGSIINSILVGKRFE-EDTKHEFLK-----IKETMDAS-FETFSPFDMTAPVWFLKTFFKHRYDKIWSAQETAKNFAAAEAIKRVESIKSGKYVIDENNLQDY----TDAFLLKIQKEGESKDFNIETLKTMIIDLWMTGQETTTTTLISGFNQLLLHPEVMIKAREEILKITENGSRHLSLTD-RTSTPYVNAVIGEIQRHASILNVSFWKINKEFTYMGGHPVDAGALVTSQLSALHVNETVFKNPQEFNPERFIRDGKLL---QKVIPFGVGKRNCLGESLAKAELYLIFGNLLLRYKFEQHGKLSTTELM 476          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Match: cyp-35B1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44650])

HSP 1 Score: 114.775 bits (286), Expect = 4.029e-27
Identity = 120/478 (25.10%), Postives = 221/478 (46.23%), Query Frame = 3
Query:   63 LLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMV----EYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSL-EKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVL-SIVIGRTFTLED-EDYIILQDSRRQVFDIMDKSEFVNWIPFGR-YLPLKCIR--RLFEQSTKLNNLLAKFVSDARKMGRYRNN---PDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTP-KFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTE 1454
             L+V +I ++ +  +LPPGP +LP  GN       +  ++ V    + ++ KYG++ T++ G  P V I +Y+ + E    KNG     R        VS     +F  N GP+  EM +   L     G+   L E+ I   +N  C E+  +  N GK +    E + L+  +V+ S+++G+ F  ED +D++ ++    +  D+    + V  + F + + P +  R   +FE++    +  A    +  K G Y  N   P + +E  L + E  +L  +         ++ +  D+  A  +    T +     L  +P+I  + R +I ++   +  S P + + + E  Y+ A   E  R +SI+ +  +    +  T+ G+ +  G +I     A++ + + ++NP+   PERF+++       S I+PFG+G R C G +I K   +L++ NL L Y IK       TE
Sbjct:   10 FLAVLIIRQYQKARKLPPGPVSLPLIGNIHQLVYHIWNEKGVVPAFDLFRKKYGDVFTIWLGPIPHVSICNYETSQEVFV-KNGNKYKDRFLPPVYLHVSNNL-GLFTAN-GPVCAEMRKFTLLAFRNMGVGRDLMEQRILDELNTRCAEIDADAVN-GKTIVHTTEFFDLTVGSVINSLLVGKRFEAEDKDDFLEIKRLMAEAADLFTMFDLVVPVWFLKSFFPSRFERVVAIFEKALNYLSREALARYEKLKTGEYSVNAEDPQDFVEAYLAKMEQERL-RDSDTPYTMECLKFVIGDLWLAGQDTTSTTLVAGFNHLVKNPEIVRKCREEILRIT--ENGSRPLQLKDRAESHYLNATIAEIQRHASILNVNFWRLVHEPTTVQGHPVDSGSVICAQLGALHVNDDLFKNPDKFYPERFIENEQLL---SQIIPFGIGKRSCVGENIAKSELYLMIGNLILRYDIKPHGSEPSTE 477          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Match: cyp-34A10 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O61204])

HSP 1 Score: 114.005 bits (284), Expect = 8.652e-27
Identity = 119/465 (25.59%), Postives = 206/465 (44.30%), Query Frame = 3
Query:  105 RLPPGPWALPFWGNYRGF--NGAMIYKRMVEY--YKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSL-EKNIQKSINFYCDELIRNPDNSGK-----GVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDS---RRQVFDIMD--------KSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRY---RNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIK 1427
            RLP GP  LP  GN+  F   G  +   +  Y  ++  YG + T++ G  P V+I+DY +A E+   K     + R +  T + + E R  I  N  G  W++  R     +   GL  +L E+ I +  N+   +  R    +G      G F FD    L  + +  ++I   F   D+++  ++ S     + F I+D         S  + W     + P   I   +E S +  NL  +   +A K G +       D +  Y+L+  ++         NL +  I  +F D+  A  E    T  W    L  HP + +++R ++ KL    +        + + PY+ AV  E  R +SI+ I  F    +   + G  +  GC++      ++ D E ++NP   +PERFL+++   T    ++PFG+G R CPG S+ +   +L+L N+ L+ +I+
Sbjct:   24 RLPKGPTPLPLIGNFHQFIYYGIKLGSAVAVYHEFEKTYGKVFTIWMGPLPSVYISDYDVAHES-HIKRANIFSTRFAHGTTNYIREGRGIIAAN--GDFWQDHRRFALTTLRNFGLGRNLMEEKIMEEYNYRISDYKRTHLKNGAIEIHAGTF-FD---LLVGSIINQLLISERFEQGDQEFEKIKTSLALSLENFGIIDIFFPTAILDSPLMKWRQKKIFEPFDFI---YEVSKR--NLTKRM--EAVKSGDHVIEDGGRDFVDAYILKIQKDENSGAPSTFNL-ETMIIDVF-DLWQAGQETTSTTLTWAFCCLLNHPNVVKKLRAELMKLTGGNRHV--GLNDRADTPYLNAVCNEVQRIASILNINLFRKIEQDTEIAGQPLASGCVVTTQMSMLHTDVEVYKNPTEFRPERFLENN---TLEKKLIPFGIGKRSCPGESLARAELYLILSNVILDVEIE 467          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Match: daf-9 (Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Prot;Acc:H2KYS3])

HSP 1 Score: 114.005 bits (284), Expect = 1.307e-26
Identity = 114/445 (25.62%), Postives = 191/445 (42.92%), Query Frame = 3
Query:  105 RLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYG--PLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPF-DESYWLSDNTVLSIVIGRTFTLEDEDYII-LQDSRRQVFDIMDKSEF-VNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYL-LQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYK 1421
            R PPGP  +  +GN    N     +  +EY +  YG + TL     P + + +YK   EAL  KNG+  +GR S ++  + + +R N  G        WK+M   +   ++K    P  E  +  +    C E         K +    D       N +  I IGR +  +D+++   L+D    V +IM    F VN  P+ RYLP   +R+          L   F +   +    R+  D +   + LQE+        K+    D+ I     D+     E    T  W +  L  +P++Q + +++I  +     +  P     N+ PY++A   E  R ++++     H  ++   +GGY IP    I     A+  D   +E+P+  KPERFLD  G +    +  PFG+G R+C G  I +   +L+  +L  N++
Sbjct:   91 RYPPGPPPMAVFGNSPFVNILTPEQTFLEY-REIYGPIFTLHLSQ-PTIILAEYKTIQEAL-VKNGQQTSGRSSAESFVLFTGDRLNGDGVILAMRQKWKDMRHEISRFMNKWYGAPMDELVLHHT---RCLEQELAKIAETKSLIDLRDPLAGAIANVIQQITIGRNYMYQDQEFQTQLRDINAVVKEIMTAEVFFVNCYPWLRYLPEGILRKWTNYKRSGFRLQQWFRTILEEHHVNRHQGDFMSHMIDLQES--------KQEQFRDLSIILTCGDMWTGGMETTVTTLRWGIIYLLNNPEVQAKCQMEILDVFG---NDIPDMGKMNQTPYVRATLSEIQRLANVLPWAIPHKTIEECNIGGYDIPVNTEIIPALGAVLFDPNVFESPKQFKPERFLDEEGKYRVMEEFRPFGLGPRVCLGERIARTELYLIFASLLQNFR 518          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 131.724 bits (330), Expect = 1.502e-32
Identity = 132/503 (26.24%), Postives = 218/503 (43.34%), Query Frame = 3
Query:    6 FYLFGLKMWQDILTGAGVGLLSVF------------VILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFG--NNYGPLWKEMIRALKLGVSKCGLT--PSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLP-LKCIRRLFEQSTKLNNLLAKF------VSDARKMGRYRNNPDNIIEYLLQETENSKLV-TEKKVNLNDVH---IRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKI 1424
            F L  L++ QD   G    LL VF            ++  + E  +LPPGPW LP  G Y  F G+  + R +E  K +YG+L +   G+   V ++DYK+  E    +      GR      D    +  N +G  N+ G LWK+  R L   + + G+T   + ++ +QK I     E I +   S     P D S  +S    N + S+++   F+++D  +      RR  F I +       I    Y+P ++C   +     K+    A+       V D  K     NN  +++++ L E E +K   T+ ++     H   + Q+  D+  A  E I  T +W    +  +P+   R++ ++ ++  + +   P  E    LP  ++   E  R SSIV +   H   + V L GY IP G  +     +++ D   WE PE  +P RF+D+ G        +PFG+G RMC G  + +   FL   +    + I
Sbjct:   10 FVLRQLQVQQD---GDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIG-YLLFMGSEKHTRFMELAK-QYGSLFSTRLGSQLTVVMSDYKMIRECFRREE---FTGRP-----DTPFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQ--PVDMSPVISVAVSNVICSLMMSTRFSIDDPKF------RRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHR--LPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDI 489          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 131.724 bits (330), Expect = 1.502e-32
Identity = 132/503 (26.24%), Postives = 218/503 (43.34%), Query Frame = 3
Query:    6 FYLFGLKMWQDILTGAGVGLLSVF------------VILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFG--NNYGPLWKEMIRALKLGVSKCGLT--PSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLP-LKCIRRLFEQSTKLNNLLAKF------VSDARKMGRYRNNPDNIIEYLLQETENSKLV-TEKKVNLNDVH---IRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKI 1424
            F L  L++ QD   G    LL VF            ++  + E  +LPPGPW LP  G Y  F G+  + R +E  K +YG+L +   G+   V ++DYK+  E    +      GR      D    +  N +G  N+ G LWK+  R L   + + G+T   + ++ +QK I     E I +   S     P D S  +S    N + S+++   F+++D  +      RR  F I +       I    Y+P ++C   +     K+    A+       V D  K     NN  +++++ L E E +K   T+ ++     H   + Q+  D+  A  E I  T +W    +  +P+   R++ ++ ++  + +   P  E    LP  ++   E  R SSIV +   H   + V L GY IP G  +     +++ D   WE PE  +P RF+D+ G        +PFG+G RMC G  + +   FL   +    + I
Sbjct:   10 FVLRQLQVQQD---GDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIG-YLLFMGSEKHTRFMELAK-QYGSLFSTRLGSQLTVVMSDYKMIRECFRREE---FTGRP-----DTPFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQ--PVDMSPVISVAVSNVICSLMMSTRFSIDDPKF------RRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHR--LPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDI 489          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Match: phm (gene:FBgn0004959 transcript:FBtr0074603)

HSP 1 Score: 118.627 bits (296), Expect = 4.396e-28
Identity = 125/555 (22.52%), Postives = 213/555 (38.38%), Query Frame = 3
Query:   72 VFVILKFIERL------RLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGN-----NYGPLWKEMIRALKLGVSKCGLT---PSLEKNIQKSINFYCDELIRNPDNSGKG-----VFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLP--LKCIRRLFEQSTKLNNLLAKFV-----------------SDARKMGRYRN--------------------------------NPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 1526
            V VIL   ER         PPGPW LPF G Y  F  A    + ++    +YG +  L  G  P V ++D  L  +            R+ V T        H I G          +W+   R     +   G+T     L   +++ I    DE +R  D   K      V P    +    N +  +V G T+  +D D++ LQ  + +   ++  S  VN++P+ R+LP  ++ IR L E   K + +  + V                  + +++ R                                    P+ I+E+ L   +     T+ ++  +D  +R +  D+  A  +    T  W++  L    + Q R+   +  L       +P  E    L Y++A   E  R  S+V +   H   ++  +G Y I  G +I  +++AI+ D   +  PE  +PERFL + GA+      +PF  G RMCPG  + +    L    +   + ++  S  E    VD    + +   P  ++L  +K+
Sbjct:   30 VLVILYLCERQCNDLMGAPPPGPWGLPFLG-YLPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFF----------RRDVMTGRAPLYLTHGIMGGFGIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRLFDTEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGVVNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRD-----TDSQLYCDD-QLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPL-----GPSPTLEELEPLAYLRACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFLTADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTE----VDMAGESGITLTPTPHMLRFTKL 558          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Match: phm (gene:FBgn0004959 transcript:FBtr0342846)

HSP 1 Score: 118.627 bits (296), Expect = 4.396e-28
Identity = 125/555 (22.52%), Postives = 213/555 (38.38%), Query Frame = 3
Query:   72 VFVILKFIERL------RLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGN-----NYGPLWKEMIRALKLGVSKCGLT---PSLEKNIQKSINFYCDELIRNPDNSGKG-----VFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLP--LKCIRRLFEQSTKLNNLLAKFV-----------------SDARKMGRYRN--------------------------------NPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 1526
            V VIL   ER         PPGPW LPF G Y  F  A    + ++    +YG +  L  G  P V ++D  L  +            R+ V T        H I G          +W+   R     +   G+T     L   +++ I    DE +R  D   K      V P    +    N +  +V G T+  +D D++ LQ  + +   ++  S  VN++P+ R+LP  ++ IR L E   K + +  + V                  + +++ R                                    P+ I+E+ L   +     T+ ++  +D  +R +  D+  A  +    T  W++  L    + Q R+   +  L       +P  E    L Y++A   E  R  S+V +   H   ++  +G Y I  G +I  +++AI+ D   +  PE  +PERFL + GA+      +PF  G RMCPG  + +    L    +   + ++  S  E    VD    + +   P  ++L  +K+
Sbjct:   30 VLVILYLCERQCNDLMGAPPPGPWGLPFLG-YLPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFF----------RRDVMTGRAPLYLTHGIMGGFGIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRLFDTEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGVVNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRD-----TDSQLYCDD-QLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPL-----GPSPTLEELEPLAYLRACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFLTADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTE----VDMAGESGITLTPTPHMLRFTKL 558          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 108.612 bits (270), Expect = 6.365e-25
Identity = 112/497 (22.54%), Postives = 204/497 (41.05%), Query Frame = 3
Query:  108 LPPGPWALPFWGNYRGF---NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLT---PSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDN-TVLSIVIGRTFTLEDEDYIILQD--SRRQVFDIM--------------DKSEFVNWIPFGRYL--PLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDI-MPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNIS 1520
             PPGP  +P +G+Y      N   ++K  +   +    +++ L  G  P+  ++      E L N+              D   + R   F +  GPLWKE  R +   +   G       LE  IQ+ +N   D LIRN        +P +     S    VL  ++   F+     YI+  +  SR ++  ++              D  + ++ IP+ R++        +L E +  +    A FV       +Y ++ +  +E    +   +++        N   +     D  F ++  IG+     +  L L+P +  R++ +I ++    +   P  E +  LP+ +A   E  R  ++V     H AL+   L GY IPK  ++  + YA + DA  W +PE  +PERFLD+ G    + D+ +PFG G R+C G +  +   FL+   +C ++       +   +L  +    ++   P D+ L + 
Sbjct:   29 FPPGPPKIPLFGSYLFMLIINFKYLHKAALTLSRWYKSDIIGLHVGPFPVAVVHSADGVREILNNQVFDGRPQLFVAAMRDPGQDVRGIFFQD--GPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLD-LIRNGPK-----YPHEHEMVKSGGYRVLLPLLFNPFSANAHFYIVYNECLSREEMGKLVKLCQMGIQFQRNADDYGKMLSIIPWIRHIWPEWSGYNKLNESNLFVRQFFADFVD------KYLDSYEEGVERNFMDVYIAEMRRGPGYGFNRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGR--LPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLGPNDRLPDLSQNLNGLII--SPPDFWLQLQ 507          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Match: cyp2x8 (cytochrome P450, family 2, subfamily X, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-040704-28])

HSP 1 Score: 161.77 bits (408), Expect = 2.502e-43
Identity = 126/464 (27.16%), Postives = 210/464 (45.26%), Query Frame = 3
Query:   57 VGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDK--SEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSE 1439
            + +L VF++++       PPGP  LP +GN   FN A   K   E +  KYGN+ +L+ G+ P VF+N + +  EAL NK  +  +GR        ++E +  +  + YGPLWK+  R   + +   GL   S+E+ I   I+     L +N    GK V P    + ++ N +  ++ GR F    E          ++  I++   +   + +PF R LPL   ++ F+    L  +  K + D  K  R    P + I+  L E +  K    +    ++  +     D+ FA  +    T +     L  HP++Q + + +I  +   K   +  +E ++ +PY  AV +E  R ++ V +  FHC  +   L GY IPKG LI  N   +  +  +W+ P    P  FL+  G F      +PF  G R+C G  + +   FL+   L   YK  W  +
Sbjct:   10 ICILLVFLLIRIQRPKNFPPGPSPLPIFGNLLHFNLANPLKDF-ERFAEKYGNIFSLYTGSRPAVFLNSFAVIKEALVNK-AQDFSGRPQDFMISHLTECKGVVLAD-YGPLWKDHRRFALMTLRNFGLGKQSMEERILGEISHVVCYLDKN---IGKTVDPQVMFHNVASNVISLVLFGRRFDYNSETLQCYIQLITEISKILNGPWNMIYDTLPFLRILPLP-FKKGFDHVKVLKGMNLKLI-DEHKSTRVPGKPRDFIDCYLDELDKRK---NEVSTFSEDQLLMYILDLYFAGTDTTSNTLLTAFLYLMNHPEVQVKCQQEIDDVLEGKDQVS--YEDRDNMPYTLAVIHEVQRVANTVPLSVFHCTTRDTELMGYSIPKGTLIIPNLTIVLKEEGQWKFPHEFNPANFLNEQGQFEKPEAFIPFSTGPRVCLGEGLARMELFLVFVTLLRRYKFVWPRD 460          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Match: cyp2x8 (cytochrome P450, family 2, subfamily X, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-040704-28])

HSP 1 Score: 160.614 bits (405), Expect = 5.257e-43
Identity = 125/464 (26.94%), Postives = 209/464 (45.04%), Query Frame = 3
Query:   57 VGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDK--SEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSE 1439
            + +L VF++++       PPGP  LP +GN   FN A   K   E +  KYGN+ +L+ G+ P VF+N + +  EAL  K  +  +GR        ++E +  +  + YGPLWK+  R   + +   GL   S+E+ I   I+     L +N    GK V P    + ++ N +  ++ GR F    E          ++  I++   +   + +PF R LPL   ++ F+    L  +  K + D  K  R    P + I+  L E +  K    +    ++  +     D+ FA  +    T +     L  HP++Q + + +I  +   K   +  +E ++ +PY  AV +E  R ++ V +  FHC  +   L GY IPKG LI  N   +  +  +W+ P    P  FL+  G F      +PF  G R+C G  + +   FL+   L   YK  W  +
Sbjct:   10 ICILLVFLLIRIQRPKNFPPGPSPLPIFGNLLHFNLANPLKEF-ERFAEKYGNIFSLYTGSRPAVFLNSFAVIKEALVTK-AQDFSGRPQDFMISHLTECKGVVLAD-YGPLWKDHRRFALMTLRNFGLGKQSMEERILGEISHVVGYLDKN---IGKTVDPQVMFHNVASNVISLVLFGRRFDYNSETLQCYIQLITEISKILNGPWNMIYDTLPFLRILPLP-FKKGFDHVKVLKGMNLKLI-DEHKSTRVPGKPRDFIDCYLDELDKRK---NEVSTFSEDQLLMYILDLYFAGTDTTSNTLLTAFLYLMNHPEVQVKCQQEIDDVLEGKDQVS--YEDRDNMPYTLAVIHEVQRVANTVPLSVFHCTTRDTELMGYSIPKGTLIIPNLTIVLKEEGQWKFPHEFNPANFLNEQGQFEKPEAFIPFSTGPRVCLGEGLARMELFLVFVTLLRRYKFVWPRD 460          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Match: cyp17a2 (cytochrome P450, family 17, subfamily A, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-100822-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.199e-42
Identity = 111/422 (26.30%), Postives = 194/422 (45.97%), Query Frame = 3
Query:  204 KYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTEL 1457
            +YG L  L+ G    + +++  L  E L  + G+  AGR  + T D++++   +I   +Y PLWK   R +    +  G  +  L+  +Q++ +  C+EL      S       D S  L     N +  +V   ++   D +   +      +   + +   V+  P+ R  P K ++RL E  +  + LL K + + +K       P ++++ LL   +      +   ++ + H+     +   A  E    T +W +A L  HPQ+QER++ ++ +      D  P    +  LP + AV  E  R   +  IL  H A++  +LGG+ +PKG  + VN +AI+HD + W+ PE   PERFL+ SG    +S  +PFG G R+C G S+ +   FL +  L   +     SE    +L
Sbjct:   66 QYGPLFGLYAGPHLTLVVSEIGLVREVLLQR-GREFAGRPKMVTTDLLTQGGKDIAFADYSPLWKNHRRLVHSSFTLFGEGSNKLQTIVQEAADSLCEELQACRGQSS------DLSVVLMRAVTNVICRLVFSSSYQPSDPELQTVIQYNDGIVQTIARGGLVDIFPWLRIFPNKDLKRLKECVSIRDQLLYKKLLEHKK-SLTPGEPRDLLDALLIGQQRGSGGAD---DITEDHVLMTAAEAFGAGVETTSTTLLWTIAFLLHHPQLQERVQAELDECVGV--DRPPCLSDRPHLPLLDAVLCEVMRIRPVSPILIPHVAMQDTSLGGHSVPKGTRVLVNMWAIHHDPKHWDQPEQFNPERFLEPSGKKKTQSSFLPFGAGPRVCVGESLARIELFLFVSRLLQRFSFSCPSEASLPDL 474          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Match: cyp1b1 (cytochrome P450, family 1, subfamily B, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030902-1])

HSP 1 Score: 156.377 bits (394), Expect = 3.175e-41
Identity = 133/475 (28.00%), Postives = 213/475 (44.84%), Query Frame = 3
Query:   63 LLSVFVILKFIERLR-LPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLE--KNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKF----VSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTD--RSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSS 1436
            LLS+ V L  + R R L PGP++ P  GN    G      + RM +    KYG++  +  G+  +V +N    AI+    K     AGR    +   VS  +   FGN Y P WK + R +     +   T +++  +  +K I     ELIR   N  +    F    +L     NT+ ++  G  +  +D ++  +     Q    +     V+ +P+ +Y P   IR LF+Q  +LN     F    VS+ RK       R+  D  I  L     +  L     V+L+   +     DI  AS + +     W + LL  +P+IQ+R++ D+ ++  + +   P    +  LPY+ A  YE  RF+S   +   H   K  ++ GY IPK  +I VNQ+++NHD  +W+ PE   P+RFLD  G+      ++++ F +G R C G  ++K   FL    L      K  S
Sbjct:   20 LLSLMVCLMLMFRRRQLVPGPFSWPVIGNAAQLGNTPHFYFSRMAQ----KYGDVFQIKLGSRNVVVLNGD--AIKEALVKKATDFAGRPDFASFRFVSNGKSMAFGN-YTPWWK-LHRKVAQSTVRNFSTANIQTKQTFEKHIVSEIGELIRLFLNKSREQQFFQPHRYLVVSVANTMSAVCFGNRYAYDDAEFQQVVGRNDQFTKTVGAGSMVDVMPWMQYFP-NPIRTLFDQFKELNKEFCAFIELKVSEHRKTISPSHVRDMTDAFIVAL-----DKGLSGGSGVSLDKEFVPPTISDIFGASQDTLSTALQWIILLLVRYPEIQKRLQEDVDRVVDRSR--LPTIADQPHLPYLMAFIYEVMRFTSFTPLTIPHSTTKDTSINGYPIPKDTVIFVNQWSLNHDPTKWDQPEVFNPQRFLDEDGSLNKDLTTNVLIFSLGKRRCIGEDVSKIQLFLFTSVLVHQCSFKAES 478          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Match: cyp1b1 (cytochrome P450, family 1, subfamily B, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030902-1])

HSP 1 Score: 156.377 bits (394), Expect = 3.175e-41
Identity = 133/475 (28.00%), Postives = 213/475 (44.84%), Query Frame = 3
Query:   63 LLSVFVILKFIERLR-LPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLE--KNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKF----VSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTD--RSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSS 1436
            LLS+ V L  + R R L PGP++ P  GN    G      + RM +    KYG++  +  G+  +V +N    AI+    K     AGR    +   VS  +   FGN Y P WK + R +     +   T +++  +  +K I     ELIR   N  +    F    +L     NT+ ++  G  +  +D ++  +     Q    +     V+ +P+ +Y P   IR LF+Q  +LN     F    VS+ RK       R+  D  I  L     +  L     V+L+   +     DI  AS + +     W + LL  +P+IQ+R++ D+ ++  + +   P    +  LPY+ A  YE  RF+S   +   H   K  ++ GY IPK  +I VNQ+++NHD  +W+ PE   P+RFLD  G+      ++++ F +G R C G  ++K   FL    L      K  S
Sbjct:   20 LLSLMVCLMLMFRRRQLVPGPFSWPVIGNAAQLGNTPHFYFSRMAQ----KYGDVFQIKLGSRNVVVLNGD--AIKEALVKKATDFAGRPDFASFRFVSNGKSMAFGN-YTPWWK-LHRKVAQSTVRNFSTANIQTKQTFEKHIVSEIGELIRLFLNKSREQQFFQPHRYLVVSVANTMSAVCFGNRYAYDDAEFQQVVGRNDQFTKTVGAGSMVDVMPWMQYFP-NPIRTLFDQFKELNKEFCAFIELKVSEHRKTISPSHVRDMTDAFIVAL-----DKGLSGGSGVSLDKEFVPPTISDIFGASQDTLSTALQWIILLLVRYPEIQKRLQEDVDRVVDRSR--LPTIADQPHLPYLMAFIYEVMRFTSFTPLTIPHSTTKDTSINGYPIPKDTVIFVNQWSLNHDPTKWDQPEVFNPQRFLDEDGSLNKDLTTNVLIFSLGKRRCIGEDVSKIQLFLFTSVLVHQCSFKAES 478          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Match: foxh1.2 (forkhead box H1, gene 2 [Source:Xenbase;Acc:XB-GENE-478064])

HSP 1 Score: 166.007 bits (419), Expect = 1.138e-44
Identity = 136/512 (26.56%), Postives = 234/512 (45.70%), Query Frame = 3
Query:   36 DILTGAGVGLL--SVFVILKFIERLR------LPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTP-SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDK--SEFVNWIPFGRYLPLKCIRRL---FEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFK---DILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLL 1511
            +IL    V L+  + F++L  I+ +R      LPPGP  LPF GN+    G  ++K ++E+ K KYG + T+  G  P+V +  + +  EAL N NG     R  +   + +S   H +  +N G  WK++ R   + +   G+   S+E+ IQ+  +F  +E         KG  P D +++ S    N + S+V G  F  ED +++ L     QVF        +  N  P       K + +L        K  N L +F+     M +   +P +  +++  +    K+  EK V   + H++       D+  A  E +  T  + + +L  HP I+ERI+ +I  +  + +   P  E ++ +PY  AV +E  RF  I+ +   H   + +   GY IPKG  +     ++ HD ++++ P+   P  F+D +G F      MPF  G R+C G  + +   FL +  +  NY ++   + E  +L   PE +     P+ Y L
Sbjct:    2 EILGATAVLLVICAFFLLLNTIQVIRRQGKGKLPPGPTPLPFLGNFLQLRGEEVFKSLLEFGK-KYGPVYTIHLGMEPVVVLCSFDIVKEAL-NDNGDEFGARGHMPLLEKISHGGHGVVASN-GERWKQLRRFSLMTLRNFGMGKRSIEERIQEEAHFLTNEF-----KYTKGQ-PVDPTFYFSKAVSNVICSVVFGDRFEYEDTEFLRLLGLLNQVFRGFSSVWGQLYNIFP-------KVMGKLPGPHNMIFKSVNSLQEFIMQRINMHQETLDPSSPRDFI--DCFLIKMQQEKDVPQTEFHMQGALNTTFDMFGAGTETVSTTLRYGLLILLKHPDIEERIQKEIDSVIGRNR--APCIEDRSRMPYTDAVIHEIQRFVDIIPMGIPHKVTRDIQFQGYFIPKGTTVYPMLSSVLHDPKQFKYPDIFNPGHFIDENGKFCKNDGFMPFSSGKRICVGEGLARMELFLFITTILQNYTLRSPVDTEDLDLT--PELSGFGNIPRPYKL 491          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Match: cyp1a1 (cytochrome P450 family 1 subfamily A member 1 [Source:NCBI gene;Acc:100037911])

HSP 1 Score: 157.147 bits (396), Expect = 2.272e-41
Identity = 119/470 (25.32%), Postives = 219/470 (46.60%), Query Frame = 3
Query:   51 AGVGLLSVFVILKFIERLRLPPG------PWALPFWGNYRGF--NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDN--SGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            A +    VF++++  +R++LPPG      P   P  GN      N  +   +M E     YG++  +  G  P++ ++  +   +AL  +     AGR  + T  +V + +   F ++ G +W+   R    ALK   +    T S    ++++I    + LIR        KG F P+        N +  +  G+ +  +DE+ + + +   +           ++IP  +YLP   ++   E + K    + KF  +  K    +N+  +I + L+Q ++  ++     + L++  I  I  D+  A ++ I     W +  L  HP IQ+RI+ ++ ++  +++   P+   + +LPY +A   E FR SS +     HC  K   L GY IPKG  + +NQ+ +NHD   W++P    PERFL++ G   ++++   +M FG+G R C G +I +   FL L  +
Sbjct:   23 ASIVFAIVFLVIR-SQRVKLPPGTKKLPGPMPYPVIGNLLSLSKNPHLSLTKMSE----TYGDVFQIQIGTKPMLVLSGLETLRQALI-RQSDEFAGRPDLFTFRLVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPTSSNSCLVEENIITEAEYLIRKFKELIDDKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGNPADFIPILQYLPNSSMKAFKEINQKFLAFMQKFTKEHYKTFD-KNHIRDITDSLIQHSQEKRVDENSNIQLSNEKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQQRIQDELDQVIGRER--RPRLSDRAQLPYTEAFILEMFRHSSFMPFTIPHCTTKDTMLNGYFIPKGICVLINQWQVNHDPNLWQDPFKFCPERFLNNDGTMVNKTEMEKVMIFGLGKRRCVGEAIGRMEVFLFLTTM 483          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Match: cyp2a6.9 (cytochrome P450 family 2 subfamily A member 6 gene 9 [provisional] [Source:NCBI gene;Acc:496407])

HSP 1 Score: 155.606 bits (392), Expect = 4.931e-41
Identity = 129/489 (26.38%), Postives = 220/489 (44.99%), Query Frame = 3
Query:   87 KFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR-----ALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKS--EFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDIL---FASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLN 1514
            K   +  LPPGP  +P +GN        + K ++E  K KYG++ TL++G +P+V +  Y+   EAL ++  +  +GR ++ + D   +    +F N  G  WK + R         G+ K G+    E+ I++   F   E+    +       PFD +  L     N + S+V G  F   ++D+  L    + VF     S  + +N +P          + +     KL + + + V +  K     N+P ++I+  L      K+  E K   +  H++ +   IL   FA  E +  T      +L +HP+I+ +++ +I ++  + +  +P  E +N++PY  AV +E  R S ++ +   H   K     GY IPKG  I     A+  D E+++ P    P  FLD  G F      MPF  G R+C G  + +   FL L N+  N+K+   SE+  TE    P+      +P  Y L+
Sbjct:   26 KMYRKRNLPPGPTPIPLFGNVMQIKRGEMVKSLIELGK-KYGDIYTLYFGPSPVVILCSYRAIKEALIDQ-AEEFSGRGAIPSFDQYFQGYGVVFTN--GEEWKNLRRFSLSTLRNFGMGKRGI----EERIKEEAQFLVAEIKSYKEK------PFDPTNILVQCVSNVICSVVFGNRFEYANKDFQNLLSLFQSVFQETSSSWGQLLNMLPAVMNHVPGPHKNIIRDMNKLEDFVLQRVKENEKTVD-PNSPRDLIDSFL-----IKMQQENKNPTSPFHMKNLIATILSIFFAGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNR--SPTIEDRNKMPYTDAVIHEIQRLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAVLRDPEQFDTPSKFNPNHFLDDKGCFKSNDGFMPFSTGKRICLGEGLARMELFLFLTNILQNFKLH--SESGLTEDNIAPKMKGFANYPTSYQLS 490          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Match: nccrp1 (non-specific cytotoxic cell receptor protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1013762])

HSP 1 Score: 153.295 bits (386), Expect = 4.092e-40
Identity = 127/483 (26.29%), Postives = 225/483 (46.58%), Query Frame = 3
Query:   87 KFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTP-SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKS--EFVNWIP-FGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDIL---FASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDY 1505
            K   +  LPPGP  +P +GN        + K ++E  K KYG + TL++G +P++ + DY+   EAL N   +  +GR  + + D   +     F N  G  WK++ R     +   G+    +E+ IQ+   F   E+      S KG  PFD +  L     N + S+V G+ +   ++D+  L    + VF+    +  + +  +P    ++P    + +  +  K+N+ + + V +  K     N+P + I+  L + +      EK   +   H + +   I+   FA  E +  T      +L +HP+I+E++  +I ++  +  D +P  E ++++PY  AV +E  RFS ++ +   H  +K     GY IPKG  +     A   D +++  P    P+ FLD +G F   +  +PF  G R+C G  + +   FL L N+  N+K+   SEN+F E    P+      +P  Y
Sbjct:   26 KMYRKRNLPPGPTPIPLFGNVLQIKRGEMVKSLLELGK-KYGPVYTLYFGPSPVIILCDYQSIKEAL-NDQAEEFSGRGKIPSWDQFFQGYGESFSN--GDEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFLVAEI-----KSYKGK-PFDPTKILVQCVSNVICSVVFGQRYEYSNKDFHKLLYMFQAVFEDTSSTLGQLMTLLPNIMNHIP-GPHKTVVNKLNKVNDFILQRVKENEKTLD-PNSPRHFIDSFLIQMQK-----EKDNPVTKFHWKNLLCTIMNLFFAGTETVSTTLRHGFLMLLIHPEIEEKLHEEIDRVVGQ--DRSPTIEDRSKMPYTDAVIHEIQRFSDVLPMSLPHLVMKDTQFRGYTIPKGTDVYPLICAALRDPKQFATPNKFNPQHFLDDNGLFKSSNAFLPFSTGKRICLGEGLARMELFLFLTNILQNFKLH--SENQFAEDDIAPKMNGFANYPLSY 487          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Match: cyp1d1 (cytochrome P450 family 1 subfamily D polypeptide 1 [Source:NCBI gene;Acc:100145341])

HSP 1 Score: 152.14 bits (383), Expect = 1.185e-39
Identity = 119/480 (24.79%), Postives = 213/480 (44.38%), Query Frame = 3
Query:   39 ILTGAGVGLLSVFVILKFIERLRLP-PGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFY-CDE---LIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR--SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEF 1448
            +L  A +  L+V +++  + + R   PGPWA+P  GN+    G  I+  + +  + +YG++  +  G  PIV ++  +     L  K G++ A R +  +  + S      F   YG  WK   + +K  +       +   N    +  Y C E   L++   +       FD S  +     N V ++  G+ +   D++++ L D    +          ++IP  R++P   ++ L +     ++ +AK V D        NN  +I + L+Q  +  K   +K   L+D  I     DI  A ++ I    +W +  L  +P+ Q++I  +I +     +   P+F  + +L Y +A   E  R SS V     HC      L GY +PKG  +  N Y +NHD   W++ +   PERFLD +G         ++ FGMGVR C G  + +   F+++  +    K+  S+++E 
Sbjct:   15 MLLKASISFLTVLLVMSILWKKRNSLPGPWAVPIVGNFFQL-GDQIHITLTDM-RNRYGDVFQIKLGLMPIVVVSGLETVKRVLL-KEGENFADRPNFYSFSLFSNGSSMTFSEKYGESWKIHKKIMKNALRNLSNESTNSSNCSCRLEEYVCAEASDLVQELTDLSAEKVAFDPSSLIVITVANVVCALSFGKRYDHHDKEFLTLIDFNNDLRKAAGGGLLADFIPILRFIPSSSVKALKKFVQSFHSFIAKCVKDHFATFE-ENNIRDITDALIQLCKERK-SEDKNQLLSDDQIISTVNDIFGAGFDTITSALLWAIFYLLRYPEFQDKIHKEIEEKIGCNR--APRFNDRKDLHYTEAFINEVLRHSSFVPFGLPHCTTMDTKLNGYFLPKGTCVFTNLYQVNHDNTVWKDADMFMPERFLDQNGQIIKSLTEKVLVFGMGVRKCLGEDVARNEMFVIMTIMMQRLKLVKSTKHEL 487          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Match: Cyp1a1 (cytochrome P450, family 1, subfamily a, polypeptide 1 [Source:MGI Symbol;Acc:MGI:88588])

HSP 1 Score: 175.252 bits (443), Expect = 4.940e-48
Identity = 123/466 (26.39%), Postives = 218/466 (46.78%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALK--------LGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR--SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWS 1433
            L+ PPGPW LPF G+    G N  +   R+ +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + +  +++  +   F  + GP+W    R    ALK           S C     LE+++ K  N+   +L +     G     FD   +L     N + +I  G+ +  +D++ + + +   +  ++       ++IP  RYLP   +    + + K  + + K + +  +    G  R+  D++IE+     ++ KL     V L+D  +  I  D+  A ++ +     W +  L  +P++Q +I+ ++  +  +  D  P+   + +LPY++A   E FR SS V     H   +  +L G++IPKGC + VNQ+ +NHD E W +P   +PERFL  SG    R    +  FG+G R C G +I +   FL L  L    + K S
Sbjct:   41 LKTPPGPWGLPFIGHMLTVGKNPHLSLTRLSQ----QYGDVLQIRIGSTPVVVLSGLNTIKQAL-VRQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASSC----YLEEHVSKEANYLVSKLQKVMAEVGH----FDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYPADFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEH----CQDRKLDENANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGR--DRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNHDRELWGDPNEFRPERFLTPSGTLDKRLSEKVTLFGLGKRKCIGETIGRSEVFLFLAILLQQIEFKVS 487          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Match: Cyp1a1 (cytochrome P450, family 1, subfamily a, polypeptide 1 [Source:MGI Symbol;Acc:MGI:88588])

HSP 1 Score: 175.252 bits (443), Expect = 4.940e-48
Identity = 123/466 (26.39%), Postives = 218/466 (46.78%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALK--------LGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR--SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWS 1433
            L+ PPGPW LPF G+    G N  +   R+ +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + +  +++  +   F  + GP+W    R    ALK           S C     LE+++ K  N+   +L +     G     FD   +L     N + +I  G+ +  +D++ + + +   +  ++       ++IP  RYLP   +    + + K  + + K + +  +    G  R+  D++IE+     ++ KL     V L+D  +  I  D+  A ++ +     W +  L  +P++Q +I+ ++  +  +  D  P+   + +LPY++A   E FR SS V     H   +  +L G++IPKGC + VNQ+ +NHD E W +P   +PERFL  SG    R    +  FG+G R C G +I +   FL L  L    + K S
Sbjct:   41 LKTPPGPWGLPFIGHMLTVGKNPHLSLTRLSQ----QYGDVLQIRIGSTPVVVLSGLNTIKQAL-VRQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASSC----YLEEHVSKEANYLVSKLQKVMAEVGH----FDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYPADFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEH----CQDRKLDENANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGR--DRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNHDRELWGDPNEFRPERFLTPSGTLDKRLSEKVTLFGLGKRKCIGETIGRSEVFLFLAILLQQIEFKVS 487          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Match: Cyp1a2 (cytochrome P450, family 1, subfamily a, polypeptide 2 [Source:MGI Symbol;Acc:MGI:88589])

HSP 1 Score: 157.532 bits (397), Expect = 1.345e-41
Identity = 113/452 (25.00%), Postives = 209/452 (46.24%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPS--------LEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSK----LVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            L+ PPGPW LPF G+    G N  +   R+ +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + +  +++  +   F  + GP+W    R  +  +    +           LE+++ K  N    +L +     G    P  +      N + ++  G+ F  + E+ + + ++ +   + +     V++ P  RYLP   ++R    +      L K V +  +    +N+  +I   L + +EN K    L+ E+K       I  I  DI  A ++ +     W + LL   P +Q +I  ++  +  +  D  P+   + +LPY++A   E +R++S V     H   +  +L G+HIPK   I +NQ+ +NHD ++W++P   +PERFL ++ +  D++    +M FG+G R C G    K   FL L  L
Sbjct:   38 LKNPPGPWGLPFIGHMLTVGKNPHLSLTRLSQ----QYGDVLQIRIGSTPVVVLSGLNTIKQALV-RQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSASSCYLEEHVSKEANHLVSKLQKAMAEVGH-FEPVSQVVESVANVIGAMCFGKNFPRKSEEMLNIVNNSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKTFNDNFVLFLQKTVQEHYQ-DFNKNSIQDITSALFKHSENYKDNGGLIPEEK-------IVNIVNDIFGAGFDTVTTAITWSILLLVTWPNVQRKIHEELDTVVGR--DRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKERCIYINQWQVNHDEKQWKDPFVFRPERFLTNNNSAIDKTQSEKVMLFGLGKRRCIGEIPAKWEVFLFLAIL 473          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Match: Cyp2j8 (cytochrome P450, family 2, subfamily j, polypeptide 8 [Source:MGI Symbol;Acc:MGI:2449817])

HSP 1 Score: 155.606 bits (392), Expect = 4.697e-41
Identity = 123/453 (27.15%), Postives = 209/453 (46.14%), Query Frame = 3
Query:  111 PPGPWALPFWGNYRGFNGAMIYKRM-VEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNN-----YGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFV---NWIP-FGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIK 1427
            PPGPW LPF GN   F+  + +  + ++ +  KYGNL++L +G  P V I+   L  EAL    G++   R        +   R +IF NN      G  WKE  R   + +   GL   SLE+ IQ   +   + +    +  G+   PFD  + +++   N + SI IG  F  ED  +  L     +    ++ S+ +   N  P   +YLP    ++LF    KL  L    V D+ +     + P + I+  L  TE +K   +   + N+ ++     D+ FA  E       W +  + ++P++QE++  +I ++  + +   P  + ++ +PY  AV +E  R  +I+ +         +TL G+H+PKG ++  N  A++ D + W  P+   PE FL+ +G F  R   +PF +G R CPG  + +   F     L   +  K
Sbjct:   44 PPGPWRLPFVGNLFQFDLDVSHLHLGIQPFVKKYGNLISLDFGTIPSVIISGEPLIKEALTCM-GQNFLKRP-------ILAARQHIFKNNGIISSSGQTWKEQRRFTLMILKNFGLGKKSLEQRIQDEAHHLVEAIA---EEKGR---PFDPHFMINNAVSNIICSITIGERFEYEDNQFQELLKLADETL-CLEASKVLMLYNVFPSIFKYLP-GPHQKLFSNWEKLK-LFFSHVMDSHRKDWNPSAPRDFIDAFL--TEMAKYSDKTTTSFNEENLICTTLDLFFAGTETTSTALRWALLYITVNPEVQEKVHSEIDRVIGQGRH--PTIDDRDSMPYTNAVIHEVLRMGNIIPLNVPREVEADITLAGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLE-NGQFKKRESFLPFSVGKRGCPGEQLARSELFTFFTALMQKFTFK 474          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Match: Cyp2j6 (cytochrome P450, family 2, subfamily j, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1270148])

HSP 1 Score: 145.976 bits (367), Expect = 1.280e-37
Identity = 120/446 (26.91%), Postives = 206/446 (46.19%), Query Frame = 3
Query:  111 PPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIM-----DKSEFVNWIPF-GRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNY 1418
            PPGPW LPF GN    +    +  +    K KYGN+ +L  G+   V I    L  EAL       +    SV  E I S +   IF +  G +WKE  R   + +   GL   SLE+ +Q+  + +  E IR  +  GK   PF+  + +++   N + S+  G  F   D  +   Q+  R + ++M       S+  N  P+  +Y+P    +++F    KL   ++  + D RK     + P + I+  L+E        EK  + N+ ++     D+ FA  E    T  W +  + L+P++QE+++ +I ++  +K+ +  +   +  +PY  AV +E  R  +I+ +           L G+H+PKG ++  N  A++ D + W  P+   PE FL+ +G F  R   +PF MG R C G  + +   F+   +L   +
Sbjct:   44 PPGPWGLPFVGNIFQLDFGQPHLSIQPLVK-KYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERI-SNKNGLIFSS--GQIWKEQRRFALMTLRNFGLGKKSLEERMQEEAS-HLVEAIR--EEEGK---PFNPHFSINNAVSNIICSVTFGERFDYHDSRF---QEMLRLLDEVMYLETTMISQLYNIFPWIMKYIP-GSHQKVFRNWEKLKLFVSCMIDDHRK-DWNPDEPRDFIDAFLKEMTK---YPEKTTSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAA--RLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLE-NGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF 468          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Match: sp|P00184|CP1A1_MOUSE (Cytochrome P450 1A1 OS=Mus musculus OX=10090 GN=Cyp1a1 PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 3.455e-47
Identity = 123/466 (26.39%), Postives = 218/466 (46.78%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALK--------LGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKM---GRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR--SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWS 1433
            L+ PPGPW LPF G+    G N  +   R+ +    +YG+++ +  G+TP+V ++      +AL  + G    GR  + +  +++  +   F  + GP+W    R    ALK           S C     LE+++ K  N+   +L +     G     FD   +L     N + +I  G+ +  +D++ + + +   +  ++       ++IP  RYLP   +    + + K  + + K + +  +    G  R+  D++IE+     ++ KL     V L+D  +  I  D+  A ++ +     W +  L  +P++Q +I+ ++  +  +  D  P+   + +LPY++A   E FR SS V     H   +  +L G++IPKGC + VNQ+ +NHD E W +P   +PERFL  SG    R    +  FG+G R C G +I +   FL L  L    + K S
Sbjct:   41 LKTPPGPWGLPFIGHMLTVGKNPHLSLTRLSQ----QYGDVLQIRIGSTPVVVLSGLNTIKQAL-VRQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASSC----YLEEHVSKEANYLVSKLQKVMAEVGH----FDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYPADFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEH----CQDRKLDENANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGR--DRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNHDRELWGDPNEFRPERFLTPSGTLDKRLSEKVTLFGLGKRKCIGETIGRSEVFLFLAILLQQIEFKVS 487          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Match: sp|Q92109|CP1A3_ONCMY (Cytochrome P450 1A3 OS=Oncorhynchus mykiss OX=8022 GN=cyp1a3 PE=2 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 4.005e-47
Identity = 125/470 (26.60%), Postives = 225/470 (47.87%), Query Frame = 3
Query:   51 AGVGLLSVFVILKFI-----ERLRLPPGPWALPFWGNYRGF--NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKE----MIRALKLGVSKCGLTP----SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            A V L  V++I+K++     E L+  PGP  LP  GN      N  +    M E    +YG++  +  G  P+V ++  +   +AL  K G+  AGR  + +   +++ +   F  +   +W+      + AL+   +  G TP    +LE+++ K   +   +L    D SG    PF        N +  +  GR ++ +D++ + L +   +   ++      ++IP  RYLP + ++R  + + + NN + K VS+  +    ++N  +I + L+   E+ KL     + ++D  I  I  D+  A ++ I     W +  L  +P+ QER+  ++ +     +  TP+   K  LP ++A   E FR SS +     HC +K  +L GY IPK   + +NQ+ +NHD E W+ P +  P+RFL + G   ++ +   ++ FGMG R C G +I +   +L L  L
Sbjct:   20 AMVTLCLVYMIMKYMHTEIPEGLKRLPGPKPLPIIGNMLEVHNNPHLSLTAMSE----RYGSVFQIQIGMRPVVVLSGNETVRQAL-IKQGEDFAGRSDLYSFKFINDGKSLAFSTDKAGVWRARRKLAMSALRSFATLEGTTPEYSCALEEHVLKEGEYLVKQLTSVMDVSG-SFDPFRHIVVSVANVICGMCFGRRYSHDDQELLGLVNMSDEFGQVVGSGNPADFIPILRYLPNRTMKRFMDINDRFNNFVQKIVSEHYE-SYDKDNIRDITDSLIDHCEDRKLDENANIQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVAYPETQERLHQELKEKVGMIR--TPRLSDKINLPLLEAFILEIFRHSSFLPFTIPHCTIKDTSLNGYFIPKDTCVFINQWQVNHDPELWKEPSSFNPDRFLSADGTELNKLEGEKVLVFGMGKRRCIGEAIGRNEVYLFLAIL 480          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Match: sp|O42430|CP1A1_LIMLI (Cytochrome P450 1A1 OS=Limanda limanda OX=27771 GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.435e-45
Identity = 127/462 (27.49%), Postives = 211/462 (45.67%), Query Frame = 3
Query:   72 VFVILKFI-----ERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALKLGVSKCGLTPS----LEKNIQKSINFYCDELIRNPDNSGKGVF-PFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            V++ILKF      E LR  PGP  LP  GN     G+  Y  +    K +YGN+  +  G  P+V ++  +   +AL  K G   AGR  + +   ++E +   F  +   +W+   +    AL+   +  G TP     LE+++ K   +   +L  N   +  G F PF        N +  +  GR +  +D++ + L     +   ++      ++IP  +YLP   ++     + +    + K V++       ++N  +I + L+   E+ KL     V ++D  I  I  D+  A ++ +     W +  L  HP+IQER+  +I        D  P    K  LP+++A   E  R SS +     HC  K  +L GY IPK   + +NQ+ INHD E W++P +  P+RFL + G+  ++ D   +M FGMG R C G  I +   +L L  L
Sbjct:   27 VYLILKFFQTEIPEGLRRLPGPKPLPIIGNVLEM-GSRPYLSLTAMSK-RYGNVFQIQIGMRPVVVLSGSETVRQAL-IKQGDDFAGRPDLYSFRFINEGKSLAFSTDKAGIWRARRKLAYSALRSFATLEGTTPEYSCVLEEHVCKEGEYLIKQL--NTAMTADGSFDPFRHIVVSVANVICGMCFGRRYDHDDQELVGLVTLSDEFGRVVGSGNPADFIPILQYLPSATMKNFLRINGRFTEFVQKIVTEHYTTFD-KDNIRDITDSLIDHCEDRKLDENSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGL--DRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIPKDTCVFINQWQINHDPEMWKDPSSFNPDRFLSADGSEVNKLDGEKVMAFGMGKRRCIGEVIARNEVYLFLAIL 480          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Match: sp|Q92110|CP1A1_ONCMY (Cytochrome P450 1A1 OS=Oncorhynchus mykiss OX=8022 GN=cyp1a1 PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 1.534e-45
Identity = 124/470 (26.38%), Postives = 224/470 (47.66%), Query Frame = 3
Query:   51 AGVGLLSVFVILKF-----IERLRLPPGPWALPFWGNYRGF--NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKE----MIRALKLGVSKCGLTP----SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            A V L  V++++K+      E L+  PGP  LP  GN      N  +    M E    +YG++  +  G  P+V ++  +   +AL  K G+  AGR  + +   +++ +   F  +   +W+      + AL+   +  G TP    +LE+++ K   +   +L    D SG    PF        N +  +  GR ++ +D++ + L +   +   ++      ++IP  RYLP + ++R  + + + NN + K VS+  +    ++N  +I + L+   E+ KL     + ++D  I  I  D+  A ++ I     W +  L  +P+IQER+  ++ +     +  TP+   K  LP ++A   E FR SS +     HC +K  +L GY IPK   + +NQ+ +NHD E W+ P +  P+RFL + G   ++ +   ++ FGM  R C G +I +   +L L  L
Sbjct:   20 AIVTLCLVYMLMKYKHTEIPEGLKRLPGPKPLPIIGNVLEVYNNPHLSLTAMSE----RYGSVFQIQIGMRPVVVLSGNETVRQAL-IKQGEDFAGRPDLYSFKFINDGKSLAFSTDKAGVWRARRKLAMSALRSFATLEGTTPEYSCALEEHVCKEGEYLVKQLTSVMDVSG-SFDPFRHIVVSVANVICGMCFGRRYSHDDQELLGLVNMSDEFGQVVGSGNPADFIPILRYLPNRTMKRFMDINDRFNNFVQKIVSEHYE-SYDKDNIRDITDSLIDHCEDRKLDENANIQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVAYPEIQERLHQELKEKVGMIR--TPRLSDKINLPLLEAFILEIFRHSSFLPFTIPHCTIKDTSLNGYFIPKDTCVFINQWQVNHDPELWKEPSSFNPDRFLSADGTELNKLEGEKVLVFGMDKRRCIGEAIGRNEVYLFLAIL 480          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Match: sp|O42231|CP1A1_CHEAU (Cytochrome P450 1A1 OS=Chelon auratus OX=48191 GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.216e-45
Identity = 126/467 (26.98%), Postives = 217/467 (46.47%), Query Frame = 3
Query:   51 AGVGLLSVFVILKFI-----ERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNL 1406
            A V +  V++I+K       E L   PGP  LP  GN     G+  Y  + E  K +YGN+  +  G  P+V ++  +   +AL  K G   AGR  + +   +SE +   F  +   +W+   +    AL+   +  G TP     +++ I+   + LI+  D   K    FD   ++     N +  +  GR +   D + + L +   +   ++      ++IP  +YLP K +++    + +  + + K VS+       ++N  +I + L+   E+ KL     V ++D  +  I  D+  A  + I     W +  L  +P+IQER+  ++ +  +   D TP    +N LP ++A   E FR SS +     HC  K  +L GY+IPK   + +NQ+ INHD E W+ P +  P+RFL + G   ++ D   +M FG+G R C G  I +   ++ L  L
Sbjct:   20 ALVTVCLVYLIIKSFQANIPEGLSRLPGPKPLPIIGNVLEV-GSRPYLSLTEMSK-RYGNVFQIQIGMRPVVVLSGNETVRQAL-IKQGDEFAGRPDLYSFRFISEGKSLAFSTDQAGVWRARRKLAYSALRSFSTLEGTTPEYSCVLEEHISKEAEYLIKQLDTVMKADGSFDPFRYIVVSVANVICGMCFGRRYDHHDRELLSLVNLSDEFGQVVGSGNPADFIPILQYLPNKTMKKFVNINDRFISFVQKIVSEHYATFN-KDNIRDITDSLIDHCEDRKLDENANVQMSDEKVVGIVNDLFGAGLDTISTALSWSVMYLVAYPEIQERLYQELKE--NVGLDRTPVLSDRNNLPLLEAFILEIFRHSSFLPFTIPHCTTKDTSLNGYYIPKDTCVFINQWQINHDPELWKEPSSFNPDRFLSADGTEVNKVDGEKVMVFGLGKRRCIGEVIARNEVYMFLAIL 480          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Match: C3YPU1 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_121141 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.584e-53
Identity = 129/466 (27.68%), Postives = 221/466 (47.42%), Query Frame = 3
Query:   27 MWQDILTGAGVGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVN-LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR-SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNY 1418
            MW   +T   V L+    +  +++R R+PPGP+  P  GN   F+G M Y    +  K KYG++ +L  G T +V +N      EA   K G   AGR  + + DI SE   +I   +Y P WK   +     +    L  +L+  + +S+     E  +     G+ V   D  Y L  N + S   G  +T++DE++  L    +   +I+ +    +  P  R+LP   +  + + + +   ++ + + + R+     N  D I +++++  ++++    + +N L D H+RQ   DI     +    T  W +  L +HP+IQE++  ++  +  +  D  P+   +   PY +A   E  R  SI  +   H      TL GY IPKG  +  N +A++ D + W +P+  +PERFLD +G    + + +MPF  G R CPG ++ K   FLLL  L  N+
Sbjct:    1 MWLMTITVGLVTLVLATWLRDYVKRWRMPPGPFFWPIIGNIYFFSGRM-YTTCTDLAK-KYGDVFSLKMGMTDVVVLNSLDTVKEAF-VKKGVDFAGRPKILSMDIFSEGGKDIAFTDYSPTWKLHRKLFHGAIRGYALGENLQTRVHESLEDTIAEFTKM---EGQAVNIEDYIYQLVYNVICSAAFGVRYTMDDEEFNTLMKINKDTEEIVGQGLLADVYPSLRFLPSPTLTNIRKMTKQYVGIMQRHLEEHRETFDPSNLRD-ITDHMIKAQKDAEEEGIQDINSLTDTHLRQTISDIFGGGTDTTIFTLRWAILYLAVHPEIQEKVAAELDSVVGR--DRLPELSDREATPYTEATILEVMRMGSIAPLSLPHATTVDTTLRGYQIPKGTWVVPNLWALHRDPDTWGDPDVFRPERFLDENGKPVPKPAALMPFSAGRRACPGEAVGKADTFLLLGGLVQNF 457          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Match: C3YIB9 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_211258 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.711e-52
Identity = 134/466 (28.76%), Postives = 227/466 (48.71%), Query Frame = 3
Query:   48 GAGVGLLSVFVILK-FIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLP-----LKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVN-LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR-SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYK 1421
             AG+  L +   L+ +++R R+PPGP+  P  GN    NG M Y   ++  + KYG++ +L  G T +V +N      EA   K G   AGR  + + +I++E   +I   +Y P WK + R L  GV+  G   +L+  + +S+    D +       G+ V      Y L  N + S   G  + ++DED+I L    + + + + +    +  P  R+LP     L   R++ EQS     +L + + + R+     N  D I +++++  ++++    + +N L D H+RQ   D+     +    T  W    L  HP+IQE++  ++  +  +  D  P+   +  +PY +A  +E  R  SI  +   H      TL GY IPKG  I  N +A++HD + W +P+  +PERFLD  G    + + +MPF  G R CPG ++ K   +LLL  L  N++
Sbjct:    4 AAGIVTLLLLTWLRDYMKRWRMPPGPFFWPIIGNIY-CNGRM-YITFIDLAQ-KYGDVFSLKMGMTDVVVLNSLDAVKEAF-VKKGVDFAGRPKILSNEILTEGGKDIAFTDYSPTWK-LHRKLFHGVTHWG--QNLQTKVHESLE---DTIAEFSKMEGQAVDLEGYIYKLVYNVICSTAFGVRYNMDDEDFITLMKISKDMTETLGQGLLADVYPSLRFLPSPGESLTAFRKMTEQSL---TILQRHLEEHRETFDPSNLRD-ITDHMIKAQKDAEEEGIQDINSLTDTHLRQTMNDVFAGGTDTTIWTLRWANLYLAAHPEIQEKVAAELDSVVGR--DRLPEMSDREAMPYTEATIHEIMRMGSIAPLSLPHATTVDTTLSGYQIPKGTWIMPNLWALHHDPDTWGDPDVFRPERFLDEDGKPIPKPAALMPFSAGRRACPGDAVAKAVTYLLLGGLVQNFR 453          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Match: C3XUV5 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_125371 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.419e-50
Identity = 134/494 (27.13%), Postives = 226/494 (45.75%), Query Frame = 3
Query:   27 MWQDILTGAGVGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDAR-KMGRYR-----NNPDNIIEYLLQETENSKLVTEKKVN-LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRS-DIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVL 1484
            MW   L+ + + ++ V  ++ +I+R R+PPGP+  P  GN   F+G   +   ++  K KYG++ +L  G T +V +N      EAL  K+    AGR  +Q+ +I+SE R ++   +Y P WK+  + +K  + +C     LE     ++    DEL+     +       +   +   N V  I  G  F LE+ED+  L  +     D    S   +  P  R+LP +         T L  L   FV   + ++ R+R     +NP ++ +++++  + ++      +  L D H+RQI  D+     E       W +     HP+IQE++  ++  +  +  D  P    +   PY +A   E  R      +       +  +L GYHIPKG ++  N +A++HD + W +P T +PERFLD SG    +    MPF +G R CPG  +     +LLL  L  N+   +    E  +  D P   V+
Sbjct:    1 MWLITLSVSLLVVMFVNWLMDYIKRWRMPPGPFPWPIIGNLSMFSGKS-HLTFIDLAK-KYGDVFSLKRGMTDVVVLNSVDAVREALVEKSVA-FAGRPHLQSTEIMSEGRRDMAYTDYSPAWKQHRKLIKSALRECASDKKLETQAHAALRDIIDELVSVESQAVDLHMHINNLVY---NVVCPIAFGVRFDLENEDFQHLAGTEE---DTYSNSPVGDIYPSLRFLPNRA-------KTNLQKLTGPFVEYFKHQVDRHRQEFNPDNPRDVTDHMIKAQKEAEEDGAHDITALTDTHLRQIVVDVFSGGTETTTHALRWAIQFFAAHPEIQEKVAAELDSVVGR--DRLPGLGDRQNTPYTEATVNEVLRMGIPDPLSLPRATTQDTSLRGYHIPKGTMVLPNLWALHHDPDIWGDPHTFRPERFLDESGKLMPKPFAWMPFCVGRRACPGEKMGMADTYLLLGGLVQNFHFSFPG-GERPDDADAPYKVVV 475          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Match: A5A7R5 (Cytochrome P450 17alpha-hydroxylase/17, 20-lyase OS=Branchiostoma belcheri OX=7741 GN=CYP17 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 4.134e-49
Identity = 124/474 (26.16%), Postives = 214/474 (45.15%), Query Frame = 3
Query:   90 FIERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVN-LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD-IMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDY 1505
            ++ R R+PPGP+  P +GN   F G   Y   ++  K KYG++ +L  G T +V +N      EA   K G   AGR +  + DI +E   +I   +Y P WK   +     +       +L+  + +S+     E  +     G+ V   D  Y L  N + S   G  + ++D+D+  L    +   ++  +    +  P  R+LP   I  + +      +++   +   R+     NN  +I +++++  ++++    + +N L D H+RQ   DI     +   +T  W +  L  HP+IQE++  ++  +  +  D  P+   +   PY +A  +E  R  SI      H      TL G+ IP+G  I  N +A++HD + W +P+  +PERFLD +G    +   +MPF  G R CPG ++ K   FLLL  L  N+           +L  D +   +   P  Y
Sbjct:   22 YVRRWRMPPGPFFWPIFGNLSLFAGK-FYLTFIDLAK-KYGDVFSLKQGMTDVVVLNSLDAIREAF-VKKGVEFAGRPTFVSADIFTEGGKDIAFTDYSPTWKLHRKLFHTAIRGYASGENLQNKVHESLEETIAEFSKM---EGQAVDLEDYIYKLVYNVICSAAFGVRYNMDDKDFNTLMKVSKDSAEVFGEGILADVFPSLRFLPTPGITAIQKIVRPFLDIMQHHLDQHRETFD-PNNLRDITDHMIKAQKDAEEEGMQDINSLTDTHLRQTIADIFGGGTDTTILTLRWAVLFLSAHPEIQEKVAAELDSVVGR--DRLPELSDREATPYTEATIHEVMRMGSIAPSSLPHTTTVDTTLRGHRIPQGTWIMPNLWAVHHDPDTWGDPDVFRPERFLDENGKPIPKPPALMPFSAGRRACPGEAVGKADTFLLLGGLVQNFCFSIPEGEGPPDLTPDEKGGGVTSLPSPY 486          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Match: C3ZZH5 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_145601 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.191e-48
Identity = 112/407 (27.52%), Postives = 198/407 (48.65%), Query Frame = 3
Query:  207 YGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVN-LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR-SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYK 1421
            YG++ +L  G T +V +N      EA   K G+  AGR  + + DI SE   +I   +Y P WK   +     +       +L+  + +S+    D +       G+ V   D  Y L  N + S   G  + ++DED+  L    +   +   +    +  P  R+LP   +    + + +L  ++ + +   R+     NN  +I +++++  ++++    + ++ L D H+RQ+  DI FA      +T  W +  L +HP+IQE++  ++  +  +  D  P+   +   PY +A+ +E  R +S+  +   H      TL GY IPKG  I  N +A++HD + W +P+  +PERFLD SG    + + +MPFG+G R CPG ++ K   FLLL  L  N++
Sbjct:   11 YGDVFSLKMGMTDVVVLNSLDAVKEAF-VKKGEDFAGRPKMLSTDISSEGGKDIAFADYSPTWKLHRKLFHSAIRGYASAQNLQSKVHESLE---DTIAVFSKMEGQAVDLEDYIYQLVYNVICSAAFGTRYNMDDEDFNTLMKISKDTTETFGQGLLADVYPLLRFLPSSSVTANRKMTHQLMEIMQRHLEQHRE-SFDPNNLRDITDHMIKAQKDAEEEGIQDIDSLTDTHLRQLIGDIFFAGTISTILTLRWAILYLAVHPEIQEKVAAELDSVVGR--DRLPELSDREATPYTEAIFHEVMRMASMDPVSLPHATTVDTTLRGYQIPKGTWILPNLWALHHDPDTWGDPDVFRPERFLDESGKPIPKPAALMPFGVGRRACPGEALGKADTFLLLGGLVQNFR 410          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Match: ENSAMXT00000050112.1 (cytochrome P450 1A1-like [Source:NCBI gene;Acc:103023184])

HSP 1 Score: 170.629 bits (431), Expect = 2.146e-46
Identity = 126/480 (26.25%), Postives = 225/480 (46.88%), Query Frame = 3
Query:   51 AGVGLLSVFVIL-----KFIERLRLPPGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALKLGVSKCGLTP----SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSS 1436
            A V +  V+++L     K  E L+  PGP +LP  GN    G+N  +    M E    ++G++  +  G+ P+V ++  +   +AL  K G   AGR  + +   +++ +   F  +   +W+   +    AL+   +  G TP    +LE++I K    Y  E +R    +     PF        N +  +  GR ++ + E+ + L +   +   ++      ++IPF R LP K +++  + + + N  + K + +  +    +NN  +I + L+   E+ KL     V ++D  I  I  D+  A ++ I     W +  L  +P+I E++  ++ +     +  TP+   K  LPY+     E FR SS +     HC  K  +L GY IPK   + +NQ+ INHD ++W+ P    P+RFL   G   ++++   +M FG+G R C G  I +   FL L    L  ++K+SS
Sbjct:   20 AMVTICIVYILLQKSRVKIPEGLKQLPGPHSLPIIGNLMELGWNPHLSLTAMSE----RFGHVFKIHIGSRPVVVLSGSETVRQAL-IKQGDEFAGRPDLYSFQYINDGQSLAFSTDQAGVWRHRRKLAQNALRSFATLKGQTPEYSCALEEHISKE-GLYLVERLRKVTKADGCFDPFRHIVVSVANVICGMCFGRRYSHDHEELVSLVNLSDEFGQVVSSGNPADFIPFLRLLPSKTMKKFVDINNRFNKFVQKILREHYETYD-KNNIRDITDSLIDHCEDRKLDENSNVQVSDEKIVGIVNDLFGAGFDTISTALSWSVMYLVAYPKIHEKLYQEMMEKIGTGR--TPQLSDKTNLPYLDCFITEVFRHSSFLPFTIPHCTSKDTSLNGYFIPKDTCVFINQWQINHDPDQWKEPSMFNPDRFLSEDGVEINKTEAEKVMVFGLGKRRCIGEYIGRSEVFLFLT--ILIQRLKFSS 488          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Match: cyp1a (cytochrome P450 1A1-like [Source:NCBI gene;Acc:103038575])

HSP 1 Score: 168.318 bits (425), Expect = 1.435e-45
Identity = 124/481 (25.78%), Postives = 224/481 (46.57%), Query Frame = 3
Query:   51 AGVGLLSVFVILKFIERLRLP------PGPWALPFWGNYR--GFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIR----ALKLGVSKCGLTP----SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSS 1436
            A V + +V+++++ + R R+P      PGP ++P  GN    G N  +    M +    ++GN+  +  G  P+V ++  +   +AL  K G   AGR  + +   ++  +   F  +   +W+   +    AL+   +  G TP    +LE++I K    Y  E +R    +     PF        N +  +  GR ++ + E+ + L +   +   +       ++IPF R+LP K +    + + + N  + + V +  +    +NN  +I + L+   E+ KL     V ++D  I  I  D+  A ++ +     W +  L  +P+IQE++  ++ +      D  P    KN LP +++   E FR SS +     HC  K  +L GY IPK   + +NQ+ INHD ++W+ P    P+RFL   G   ++++   +M FG+G R C G  I +   FL L    L  ++K+SS
Sbjct:   20 AMVAICTVYLLVQ-LSRERIPAGLKLLPGPQSIPIIGNVMELGLNPHLSLTTMSK----RFGNVFKIHIGTRPVVVLSGGETVRQAL-IKQGDDFAGRPDLFSFQYINNGKSLAFSTDQAGVWRHRRKLAQNALRSFSTLEGQTPEYSCALEEHISKE-GLYLVERLRKVTKAEGCFDPFRHIVVSVANVICGMCFGRRYSHDHEELVSLVNLSDEFGQVAGNGNPADFIPFLRFLPSKTMETFVDINRRFNKFVQRIVREHYETYD-KNNIRDITDSLIDHCEDRKLDENSNVQVSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAYPEIQEKLHQELMEKVGN--DRKPCLTDKNNLPLLESFITEMFRHSSFMPFTIPHCTTKDTSLNGYFIPKNTCVFINQWQINHDPDQWKEPSMFNPDRFLSEDGVEINKTEAEKVMVFGLGKRRCIGEYIGRSEVFLFLA--ILIQRLKFSS 488          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007184.2 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103031531])

HSP 1 Score: 165.622 bits (418), Expect = 8.314e-45
Identity = 130/475 (27.37%), Postives = 213/475 (44.84%), Query Frame = 3
Query:   45 TGAGVGLLSVFVILKFIERLRL-------PPGPWALPFWGNYRGF-NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYI----ILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            T  G+ L+   V L  +E LRL       PPGP  L F GN   F    M + R +    PKYG + +L+ G  P + +N  ++A EA   +NG   +GR S+     V++  + I    YG  W++  R     +   GL   S+E+ + +  +F   E+++     GK  +P         N + SIV G  F  +D  +     I+ ++ R  F     ++  N +P  +Y P    ++++     L   +++ V   RK     N  D I  YL+   E +K  + +    ++ ++ +   D+  A  E    T  W +  +  HP +QER   +I ++     D  P  + + +LPY  A  +E  R+++IV +   H   +   L GYHIP G  I  N  AI  D + W+ P+T  PE FLD  G F      +PF +G R+C G ++ +   F+   +L    K  W
Sbjct:   11 TSVGLALVGGLVSLVLLEILRLNSSRSRSPPGPKPLLFVGNMPQFIKDKMGFIRSM----PKYGEISSLYLGRKPTIILNTMQVAKEAFV-QNGTIFSGRPSLPLVRWVNKG-YGIVMATYGNSWRQQRRFALHTLRDFGLGKKSVEERVAEEAHFLIKEMLKQ---EGKAFYPIHPIMNSVSNIICSIVFGDRFEYDDRRFAKLLEIINENIR--FSGSPVAQIFNLVPIIKYFP-GPHQKIWHNLQSLRKFMSEEVEKHRKSLDPENLRDFIDAYLV---EMNKQESNEDSTFHEENMLRSTTDLFIAGTETTANTLRWGLIYMMEHPDVQERCHEEIVRVLGF--DRFPSMDDRAQLPYTHATVHEIQRYANIVPLGVVHQTTQPTKLRGYHIPAGTNIMSNLTAILTDKDHWKYPDTFNPENFLDEKGQFCKNDSFLPFSLGPRVCLGETLARTELFIFFTSLIQQLKFSW 468          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007100.2 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103029307])

HSP 1 Score: 164.851 bits (416), Expect = 1.552e-44
Identity = 125/444 (28.15%), Postives = 197/444 (44.37%), Query Frame = 3
Query:  111 PPGPWALPFWGN-YRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDK--SEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            PPGP +LP+ GN  + F   M   R +E     YG +  LF G  P++ +N  ++  EA  N NG   +GR  V   + V+     I    YG  WK+  R     +   GL   S+E+ + +   +  +E++++    GK  FP         N + SIV G  F  ED+ +  L     +   +      +  N  PF ++ P    +++   +  L   + + V + RK     N  D I  YL++ T+  K + E   +  ++ I     D+  A  +    T  W +  +  HP +QER   +I ++     D +P  + + +LPY  A  +E  R S+I+ I   H   +S  L GYHIP G  I  N  AI  D   W++P+   PE FLD  G F      +PF MG R+C G S+ +   F+   +L    K  W
Sbjct:   40 PPGPKSLPYVGNVMQLFKEPMDLIRSME----NYGEMSCLFLGRKPMIVLNKMEIVKEAFVN-NGSVFSGRPQVPLLEWVTNGL-GIVMAPYGNSWKQQRRFALHTLRDFGLGKKSVEERVAEEARYLVEEMLKH---EGKAFFPIHPIMNSVSNIICSIVFGDRFDYEDKRFAHLLKLLNEYVGLPGSMIGQIFNLAPFIKHFP-GPHQKVLRNANSLKGFIREIVEEHRKTLDPENLRDFIDAYLVEMTKQ-KAMEESTFHEENMIIST--TDLFLAGTDTTATTLRWGLIYMMDHPDVQERCHNEIVRVLGF--DRSPCMDDRAQLPYTHATIHEILRCSNIIPIGPPHETTQSTQLHGYHIPAGTQILANSTAIMTDRNHWKHPDVFNPENFLDEKGQFCKNDFFLPFSMGQRVCLGESLARTELFIFFTSLIQRLKFSW 468          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Match: ENSAMXT00000054074.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103045628])

HSP 1 Score: 164.081 bits (414), Expect = 3.733e-44
Identity = 129/474 (27.22%), Postives = 208/474 (43.88%), Query Frame = 3
Query:   30 WQDILTGAGVGLLSVFVILKF---IERLRLPPGPWALPFWGNYRGFN-GAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNP-DNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDI--MDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            W  +      G+LS+F++  F     R + PPGP  LPF GN       AM + R +     KYG+L  L+  N P++ +N   +  E    +NG   AGR  V   D V+   + I    YG  WK+  R     +   GL    ++N+++ +      LIR    + GK   P  +      N + SIV G  F  +D+ +  L +   +   +     +  V  +PF R+ P    +++++    L   + + V + RK     N  D I  YL+   E SK  + +    N+ ++     D+  A  +    T  W +  +  HP +QER   +I ++     D +P  + + +LPY QA  +E  R + I+  +  H   +   LG YH PKG  I  N      D + W++P+T  PE FLD  G        +P+ +G RMC G ++TK   F+   +L    K  W
Sbjct:   10 WMSVGLALLAGVLSLFLLEIFRLNSSRRQNPPGPKPLPFVGNLPQLKKDAMAFVRSMA----KYGDLSCLYLANKPVIVVNSLPMVKETFV-QNGGAFAGRSPVPILDFVTNG-YGIIMAPYGISWKQQRRFALHTLRNFGLG---KRNVEERVAEEAQYLIRELLTHEGKSFCPIHKIMNAVSNIICSIVFGDRFEYDDKRFSKLLEIINENIQLSGAPATRMVYVVPFIRHFP-GPHQKVWQNVKSLKEFIREAVEEHRKTLHPENPRDFIDAYLV---EMSKQQSNEDSTFNEENMIMSTSDLFLAGTDTTASTLKWGLIYMMDHPDVQERCHEEIVRVLGF--DRSPCMDDRAKLPYTQATIHEIQRCADIIP-MAIHETTQPTQLGEYHFPKGTKIMPNLAIFLADRKHWKHPDTFNPENFLDEKGQSCKSEYFLPYSLGSRMCVGETLTKAELFIFFTSLIHRLKFSW 467          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 1.552e-36
Identity = 132/518 (25.48%), Postives = 214/518 (41.31%), Query Frame = 3
Query:   30 WQDILTGAGVGLLSVFVILKFIER------------LRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLED---EDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRF---PKDYLLNI 1517
            W   L    +  L++F I+  + R            L  PPGP  +PF GN   F    +    ++    +YG + ++  G   +VF++ Y+   E L ++ G   A R +      V+     IF   YG  W +  R     +   GL   S+E+ IQ  + F    LI      G     FD  Y L+    N + S+V G+ +   D   +D++ L ++  Q+   +  +   N  PF    P    + +F+   K    +   +S+ R   R    P  +I+  L + E          + ++  +  +  D+  A  E    T  W +  + +HP+IQ +   +I K+     D  P  E ++ LPY+ AV +E  RFS+IV     H     V    Y IPKG +I VN  ++  D   W+ P    PE FLD  G F      +PF  G R+C G ++ K   FL   +L  +++  W       +LV  P    + +    PK Y L +
Sbjct:   15 WSSFLGHQALISLAIFCIIFLVLRAILQEVKATKRPLDFPPGPKVIPFLGNVSLFKKPDV---ALDEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQ-GHEFADRPNTPFNKKVNGGLGIIFAP-YGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGF----LIEAFKQKGSA---FDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGT-LCNIFPFLMDFP-GPQQIIFKSMAKSKQFIRDIISE-RHATRDPIKPMCLIDAYLSQLEKED---NPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGS--DRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDGKFVKPDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFEFYWP------DLVSAPTLGYILQITKAPKSYKLGL 506          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 130.954 bits (328), Expect = 5.964e-33
Identity = 108/479 (22.55%), Postives = 205/479 (42.80%), Query Frame = 3
Query:  114 PGPWALPFWGNYRGF--NGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKN----IQKSINFYCDELIRNPDNSGK---GVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSD---ARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR---SDIMPFGMGVRMCPGTSITKGYGFLLLCNLC--LNYKIKWSSENEFTELVDDPENAVLFRFPK 1499
            PGP   P  GN      +  +   RM +    +YG++  +  G+ P+V ++  +    AL  KNG   AGR    +  +V       F   Y   WK   R  +  +      P+  +     +++ +    + L+      G    G  P         N + ++V G+ +   D  ++ +     +   +      V++ PF R++P   +R L   S +L   +   + +   + + G  R+  D +I  +  E E++     ++V L+D  +     DI  A ++ I     W +  L +HP +Q +++ +I +  +  +D TP+FE +  L  ++A   E FR S+ V     H   + V L G  IP+   + VN + +NHD   W +PE   P+RFL   G   ++     +  FG+G R C G  + +   F++L  L   L++++   +          P++A++ + P+
Sbjct:   59 PGPVRWPIVGNILQLWPDPHLKLTRMCD----RYGDVFRVHLGSVPVVVLSGLETIKRAL-VKNGDAFAGRPPFYSLSLVGNGDTLTFTRAYDGCWKAHKRLARSALRNFCAAPARREGYACLLEECVCEEAERLLLACKGGGAQPGGFDPVPSITCAVANVMCALVFGKRYPHGDPTFLQIVGFNEEASQLSGAGNLVDFFPFLRHVPNAQLRALKVLSARLLAFMEGHIKEHYSSYQKGHVRDITDALIA-MCAEQEHAL----REVGLSDERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDE--TIGRDRTPRFEDRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSHDGKEVNKEMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLLQGLSFRVPPGTPTPSVA----PQHALVMKPPR 521          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011204.1 (pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 gene:ENSPMAG00000010177.1 transcript:ENSPMAT00000011204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 2.617e-30
Identity = 115/452 (25.44%), Postives = 187/452 (41.37%), Query Frame = 3
Query:  114 PGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNI--FGNNYGPLWKEMIRALKL------GVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSD---NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFV--NWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            PGP  LP  GN   F+    +  M E  K KYG + T+  G+TP+V ++ Y+   E L N+ G   A R       + ++  HNI      YG  WK+  R   L      G  K  +T  +    +  I  +  E              FD  + L+    N + S++ G  +   +E +  L      +  +  +   +  N  PF   LP    +++F   TKL  LL   VS+ R   + ++NP ++I+  L   +  K       +  D  +  +  ++     E    T  W +  + ++P IQ R   +I K+   ++   P  + +  LPY+ AV +E  RF +I+     H   K V    Y  PKG  + VN  +  +D   W+ P    P+ FLD  G        +PF  G  +C G S+ K   FL   +L  +++  W
Sbjct:   36 PGPKPLPLLGNITAFSCKNPHIGMQELAK-KYGEVCTIMLGSTPVVLVSGYQAVKEVLVNR-GHEFADRP---ITPLFTKLTHNIGIALAPYGDTWKQQ-RGFALSTLRNFGFGKATITDKISIEARYLIETFKQETSE-----------FDPKFILNSAVGNIICSLLNGIRYDYNNEQFQKLTHLLEHLVQLQAEPLVILCNVFPFLIKLP-GPWQKVFHIHTKLQCLLKDIVSEHRAT-KDQHNPRDLIDSYLAHIDKEK--DNPNRSFTDQTLILLLIELFIGGMETTSNTLCWGLLFMMMNPDIQARCHEEIDKVVGSQR--PPCMKDRRSLPYLDAVIHEIQRFGNILPFGVLHPTSKDVQFNEYVFPKGTHVMVNLMSAFYDDIHWKTPHKFNPDNFLDKDGQCIKSDAFLPFPAGPCVCFGESLAKMELFLFFTSLLQHFEFYW 464          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 7.059e-27
Identity = 99/413 (23.97%), Postives = 168/413 (40.68%), Query Frame = 3
Query:  204 KYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNI--FGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFV--NWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            KYG + T+  G+TP+V ++ Y+   E L N+ G   A R       I ++   NI      YG  WK+  R     +   G     +  I   I+     LI           P         N +  ++    +  ++E +  L      +  +  +   +  N  PF   LP    +++F   +KL  LL   VS+ R   + ++NP ++I+  L + +  K       +     + QI  ++     E    T  W +  + ++P IQ R   +I ++   ++   P    +  LPY+ AV +E  RF +++ +   H   K V    Y  PKG  + VN  +  HD   W+ P    P+ FLD  G        +PF  G R+C G S+ K   FL   +L  +++  W
Sbjct:   69 KYGEVCTIMLGSTPVVLVSGYEAVKEVLVNR-GHEFADRP---ITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFG---KATIADKISIEAKYLIETFKQETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFPFLLKLP-GPWQKVFHIHSKLQCLLNDIVSEHRAT-KDQHNPRDLIDSYLAQIDKEK--DNPNSSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSER--PPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQCIQSDAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYW 468          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002462.1 (pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 gene:ENSPMAG00000002249.1 transcript:ENSPMAT00000002462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 4.451e-25
Identity = 74/291 (25.43%), Postives = 132/291 (45.36%), Query Frame = 3
Query:  567 NTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMD--KSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQ-ERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKW 1430
            N + SIV G  F  +D+ +  L     + F I    + +   ++P+    P    + +F  + K+N    + + + R+  R    P ++I+  L E E  K   + +    D ++  +  D+  A  E    T  W +  +  +PQIQ ER + +I ++     D +P    +  LPY  AV +E  R +++  +   H     V   GY+IPKG  + +N  ++ HD  +W+ P    P+ FLD++G F      + F  G R+C G ++ +   FL   +L   +K  W
Sbjct:   16 NIICSIVFGNRFDYDDKRFRNLLHLFAENFRIEGGWRGKICIFMPWLEDWP-GPHQLIFRNADKVNLFFQERIREHRQT-REAGQPRDLIDAYLDEME--KESQDPESTFTDGNLLNVVGDLFIAGTETSSTTLRWALLYMMAYPQIQAERCQREIDEVIGG--DRSPNTTDRANLPYTDAVIHEAQRMANVAPLGVLHSTTTDVKFRGYNIPKGTKVLLNLTSVLHDETQWKTPNEFNPDHFLDNTGQFVKPDAFLAFSAGPRVCLGENLARMELFLFFTSLLQRFKFHW 300          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 55.0694 bits (131), Expect = 1.599e-8
Identity = 34/147 (23.13%), Postives = 62/147 (42.18%), Query Frame = 3
Query:  927 LFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTS 1367
            LFAS +       W   ++   P +  +IR +   + +    +    +   ++ Y   V  E  R+   V ++ +           Y  PKG ++    Y   HD E +ENP+   PER+++ S A   + + + FG G  +C G +
Sbjct:  334 LFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT 480          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 52.373 bits (124), Expect = 1.084e-7
Identity = 78/373 (20.91%), Postives = 140/373 (37.53%), Query Frame = 3
Query:  381 YGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDE-SYWLSDNTVLSIVIGRTFTLEDEDYIILQDS----RRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHP-QIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGG-YHIPKGCLIAVNQYAINHDAERW-ENPETIKPERFLDSSGAF-------TDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTE 1454
            YG +W+    A+  G+      P     I K+    C  LI+N    G+   P    S  ++ + +  + +G  F     +     +     ++Q+F       F    PF   LP+   ++ F+       LL K V D   +  Y+          L    N++++  K++  N V        IL A +E   +     + LL  +  + QE++R ++  +   K  +        +LP + A  +E  R    +  +   C  K+  LG    IPKG  +  N +  +HD + W    +  KPER+               +R  +  F  G R C G  +      + L  +   +  +WS + E+ E
Sbjct:  123 YGAVWRNYRNAVTNGLQHFDDAP-----IFKNAKILCT-LIKNRLLEGQTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIF-----HPFFLTFPFLDVLPIPSRKKAFKDVVSFRELLVKRVQD-ELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIV-------IILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLA--------DLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQF--RWSLDPEWEE 466          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Match: EDO48774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI92])

HSP 1 Score: 165.236 bits (417), Expect = 2.698e-45
Identity = 124/457 (27.13%), Postives = 203/457 (44.42%), Query Frame = 3
Query:  114 PGPWALPFWGNYRGFNGA--MIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVS-----KCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAK--------FVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD--IMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWS 1433
            PGP  LP  GN    +    +   R+   Y P Y    TL  G+   V +N Y++A EAL  K G   AGR         S     +   NY P  +   + +   V      K G   +L++ I   +++ CD  +    +  +   P  +  + + N V  I  G  FT+E+E++  L DS +   + +  + F++  P  RY P   ++R+       +++L K           D   + + ++    +IE   Q+T  +   ++  + L D H+     D + A  E   M  +W +     +P +Q R    I K+ S  +  T  +E +  LPY++A   E  R  SI+ +   H A+  + L GYHI KG  + VN +A+ HD + W+ P   +PERFLDS G F+  S     P+GMG+R CPG  + +   FL    L   ++ + S
Sbjct:    1 PGPLPLPLIGNLHLLSSKPHLDLARLGNIYGPIY----TLNMGSQLAVVLNSYEIAKEAL-MKRGNAFAGRPHHFVGSKFSRGGKGVGFQNYTPTLRRQQKTIMKTVKYFETLKTG--ENLQEIITNEVDYLCDLFV---SHGCQDFDPRRDMTFAAGNVVGRITFGERFTVENEEFWQLMDSLKIFVEGLTATSFIDAFPLLRYFPFSLVKRVQTAVKLRDDVLNKRFREHQDRLRGDGMVLAKSKDLTYALIEEANQKTSRTDSQSDTLI-LTDDHVMMTMNDTIMAGSETPTMLLLWNIYFFVKYPDVQARAFKQIDKVISPDQPIT--WEDRKRLPYLEAFIAEVMRIISIMPLAVPHLAMVDMVLAGYHISKGTTVIVNLWAMGHDPKVWDAPMEFRPERFLDSRGGFSTASSEGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRAS 444          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Match: EDO46605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN7])

HSP 1 Score: 161.384 bits (407), Expect = 6.721e-44
Identity = 116/445 (26.07%), Postives = 209/445 (46.97%), Query Frame = 3
Query:  111 PPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLV--TLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDAR---KMGRYRNNPDNIIEYLLQETENSKLVTEKKVNL-NDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKI 1424
            PPGP   PF GN+    G +++K +    K +YG  V      G    V I++ KLA + L  KNG+ +A R S    D +S    ++    Y P WK   R +   +   G     LE  I + ++  CD    +         P   S     N + ++V G+ + L+D ++  +  +   +  +      + ++P+ R+ PL+ ++++ E  T  + L+ + +++ R   K G  R+    + + LL+  E++K      ++L  + H+     D+  A +E       W    +  +P++Q RI  ++  + S  +D  P    +  LPY++A   E  R S +  ++    A K + +GGY IP+   + VN +AI+HD   W +P   +P RFL+ + + +  S ++PFG GVR+C G S+ K   FL +  L   +K+
Sbjct:   29 PPGPPLYPFVGNFPQI-GPVLHKSLTSLGK-QYGRGVFQVQLLGKR-FVIIDNIKLARQVLLKKNGRDVADRTSAYVIDAISRNGCSVIFGKYSPTWKLQRRVVHSALRMYGSGVRILEALILQEVDNLCDIFANSQGAPVDTKLPLTLSVM---NVICALVFGKRYGLDDAEFTDIVATTESMAKLASPENPLIYMPWLRFFPLQVVKKMKETVTARDRLIQRKITEHRETYKEGEIRD----LTDALLKSLEDAKQEDNNAMSLLTEDHLLIAINDVFMAGFETTTTALRWIFLYVAAYPEVQARIHQELDDVISFGRD--PLIADRKSLPYLEATILEVLRISPVFPLIR-RKARKQLNIGGYCIPEETFVYVNLWAIHHDEAEWVDPYKFRPSRFLEGTNSASAYS-MLPFGAGVRVCVGESLAKMELFLFVSRLLHRFKL 459          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Match: EDO40930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T4])

HSP 1 Score: 157.147 bits (396), Expect = 3.966e-42
Identity = 125/490 (25.51%), Postives = 214/490 (43.67%), Query Frame = 3
Query:   87 KFIERLRLPPGPWALPFWGNYRGFNGAM--IYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLT---PSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIIL----QDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVS---DARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDV-HIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDP-------ENAVLFRFP 1496
            ++ E   LPPGP   P  GN     G+   ++ ++ E  K  YG++ TL+      V +   K A E L  +    +AGR    T D V+    NI  +++ P +      LK  +++  +    P +E  +   +    + L R     G    P      ++ N V S+  G  +TL+D ++++L     DS R +  +      ++  PF  +LP++  + L   +  +N    K V    D+      R+  D  I+ L +  +    V E    +N + HI  +  D++    E    T  W +A L ++P++Q R+   +  +  + K++    + ++ LPY++AV  E  R S+ V +   H A    T+ GY IPK   +  N + ++ D   W +P    P RFLD  G F     ++PFG G R+CPG  I K   FL+   L  +         EFT  +D P       + + L++ P
Sbjct:   21 RYTEPSNLPPGPRPYPLIGNTPLLIGSFSSLHVKLTELAK-IYGSVYTLYLNGQRSVIVCSAKAAREGLVERKDA-IAGRPYSFTLDYVTNGSKNITFSDFCPTF-----LLKKRIAQSSMRRYYPQVEDKVNNQLE---EVLARIKALDGTAFDPHHLLSLVTLNLVTSMTFGTNYTLDDPEFLLLVQMIDDSTRSIGSM----STLDMFPFLMHLPIRTSKLLKSITKTVNEYFMKQVQRHIDSNDGKSIRDLTDGYIKGLTEAEKEDASVHE----VNSIEHIAMVMADMIVPGSETSSTTMGWMIAYLAVYPEVQARLHQQLDDVIGRDKNTVITLKDRDRLPYVEAVIAETMRISTAVPLAIPHKATCDTTINGYFIPKDTTVIFNLWGVHLDPTEWADPHVFNPARFLDEDGKFIKSEKLLPFGAGRRVCPGEKIAKMQLFLMTSRLLRHL--------EFTPPLDGPPPSLQGMKGSALYKLP 484          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 154.066 bits (388), Expect = 2.117e-41
Identity = 110/411 (26.76%), Postives = 187/411 (45.50%), Query Frame = 3
Query:  207 YGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPD-NSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSD---ARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDI--MPFGMGVRMCPGTSITKGYGFLLLCNLCLNYK 1421
            YG +  L  G+  IV +N  + A EAL  +     AGR  + T  ++S    +I   ++GPLWK+     K+  S   +  S  K +++ I    DELI+      G+   P D+      N + S V G  + ++D ++  + D   Q       +  V++ P+ R+LP K +R++ E     + +L K   +     + G  R+  D ++       E S  +      + + HI     DI  A  E    + +W +  L  +P++QE++   I ++  +  D  P+   +  LP I+A   E  R SS+V +L  H       L GY +PK  ++  N + ++HD +RW NP+   P RFLD  G F   + +  +PF  G R+C   S+ K   FL +  L   ++
Sbjct:   19 YGEVFRLKVGSHRIVVVNSIEAAREAL-VRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQ---RKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQGFRAASLVDYFPWLRHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYEHGVIRDLTDALLSANKASQEESAYLP-----MTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGR--DRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFLDDKGKFICPATLSYLPFSAGRRVCLAESLGKMQLFLFISRLLHKFR 418          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Match: EDO46506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ60])

HSP 1 Score: 154.451 bits (389), Expect = 3.211e-41
Identity = 116/431 (26.91%), Postives = 195/431 (45.24%), Query Frame = 3
Query:  207 YGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVS-----KCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLV-----TEKKVN---------LNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTP-KFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD--IMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWS 1433
            YG + TL  G+   V +N Y +A EAL  K G   AGR         S +   +   NY P  +   + +   V      K G   SL++ I K +++ C  L+   D S     P  E  + + N V  I  G  +   ++++  L +S     + +  + F++  PF +Y+P   ++R+ E++ KL +     ++D     ++R++  N+    +  T N  L         K N         L   H+     D++ A  E   MT +W +  L  +P +Q R +  +  +    ++  P  +E +  LPY++A   E  R + ++ +   H A+    L GYHIPKG  + VN +A+ HD + W+ P   +PERFLDS G F+  S     P+GMG+R CPG  + +   FL    L   ++ + S
Sbjct:   60 YGPIYTLNMGSQLAVVLNSYDIAKEAL-MKRGNAFAGRPHHFVGSKFSRDGKGVGFQNYTPTLRRQQKTIMKTVKFFDTLKTG--ESLQEIITKEVDYLCKRLLIFGDQSFD---PRHEVTFAAGNVVGRITFGERYKGGNKEFWQLMESLTIFVEGLTATSFIDAFPFLKYVPFSMVKRV-EKAVKLRD---DVLND-----KFRDHLKNLQNSTISTTTNRDLTYALIDEANKTNCFANSQSDALTIDHVIMTMNDMIMAGSETPTMTLLWILYFLVKYPDVQVRAQEQVDDVS---RNVQPLAWEGRKRLPYLEAFIAEVLRITGVMPLAIQHLAMADTALAGYHIPKGTTVIVNLWAMGHDPKVWDAPMEFRPERFLDSRGGFSTASTEGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRAS 472          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Match: ENSORLT00000024770.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101169416])

HSP 1 Score: 162.925 bits (411), Expect = 6.164e-44
Identity = 122/450 (27.11%), Postives = 208/450 (46.22%), Query Frame = 3
Query:  108 LPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPK--YGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTP-SLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDK--SEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETE-NSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSE 1439
             PPGP +LP  GN    N   +   +V++ K K  YGN+ + F G+ P V +N  +   EA+  K        + +   D+   +R  +   +YG +W++  R   + +   GL   S+E+ I + I F   +L    +N GK + P    +  + N +  ++    +  ED     +     ++  I +   +   +  P+ R  PL   +        LN  LAK + +  KM R    P + ++  L E E N K  +E+++      +R  F D+  A  +    T +     L ++P IQE+ + +I ++  +K   +  FE ++++PY+QAV +E  RF++IV +  FHC  K   L GY IPKG LI  N  ++  +  +W+ P    PE FL+  G F      MPF  G RMC G  + +   F+++  L   +K  W  +
Sbjct:   27 FPPGPLSLPVLGNLLHLN---LKNPLVDFEKMKESYGNVYSFFIGSRPAVVVNGLQAMKEAIMIKATDFSGRPQDMFVSDLT--QRKGVILVDYGSVWRDHRRFALMTLRNFGLGKISMEERIHEEIQFTISKL---EENIGKTLSPKFMFHNAASNIICKVLFNTRYDYEDGKISEIVQGFVEMLQIANGPWAMMYDAFPWIRSFPLPFNKAFRNMENFLN--LAKRLVNEHKMSRVAGEPRDFVDSYLDELEKNKKDFSEQQL------LRMTF-DLYIAGTDTTSNTMLAGFLYLMVYPHIQEKCQREIDQMLERKDRVS--FEDRHKMPYMQAVIHEVQRFANIVPLSVFHCTTKDSELSGYTIPKGTLIIQNMVSVLREEGQWKFPHEFNPENFLNDQGEFIKPEAFMPFSAGPRMCLGEGLARMELFIIMVTLLRKFKFTWPED 457          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Match: cyp17a2 (steroid 17-alpha-hydroxylase/17,20 lyase-like [Source:NCBI gene;Acc:101170547])

HSP 1 Score: 155.606 bits (392), Expect = 5.031e-41
Identity = 104/418 (24.88%), Postives = 192/418 (45.93%), Query Frame = 3
Query:  129 LPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGL-TPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENS-KLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITK 1376
            LP  G+     G +    +      +YG+L  LF G    V +N ++ A E L  + G+  AGR S+ T ++++    +I  ++Y PLWK   R +    +  G  T  L+  +  +++  C EL+    N  +G  P         N V ++V   T+   D +   +      + + + +   V+  P+ +  P   +R+L E     + LL + + +  K      +P ++++ LL+  +   K    +   + D H+     +   A  E    T +W +A L  HP++Q+R++ ++ +  +   D       +  LPY+  V  E  R   +  +L  H A+   ++GG+ + +G  + VN ++I+HD + W+ P+  +PERFLD  G     S  MPFG G R+C G S+ +
Sbjct:   56 LPILGSLPWLGGGLPPHLLFTKLAHRYGSLFGLFLGPHYTVVVNSHQHAKEVLLQR-GRDFAGRPSMVTTELLTRGGKDIAFSDYSPLWKLHRRLVHNSFTLFGEGTSRLQDVVFSAVDSLCSELM---SNGSRGFDPSAAVTRAVTNVVCTLVFSSTYRHGDAELQEVISYNNGIVETIARGGLVDIYPWMKVFPNSSLRKLKECIAVRDRLLTRKLEE-HKASLAEGDPSDLLDALLKGKKGGPKSHGLEGEGITDDHVLMTAAEAFGAGVETTSTTLLWILAYLLHHPEVQQRVQKELDE--NVGADRAANLSDRGHLPYLDCVINEGMRIRPVSPVLIPHTAMTDSSIGGHAVRRGTRVLVNMWSIHHDPQNWDKPDLFQPERFLDDQGNRATPSCFMPFGAGPRVCVGESLAR 466          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Match: cyp1a (cytochrome P450 1A [Source:NCBI gene;Acc:100125806])

HSP 1 Score: 155.606 bits (392), Expect = 5.446e-41
Identity = 116/463 (25.05%), Postives = 211/463 (45.57%), Query Frame = 3
Query:   72 VFVILKFIER-----LRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWK-------EMIRALK-LGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRY-RNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLC 1400
            V+++LK   +     LR  PGP  LP  GN     G+  Y  + E  K ++G++  +  G  P+V ++  +   +AL  K G   +GR  + +   +++ +   F  +   +W+         +R+   L  S    +  LE++I K       E+ +     GK    FD   ++     N +  +  GR +   D++ + L +       +       ++IP  RYLP K +++  E + +    + K V++      Y ++N  +I + L+   E+ KL     + ++D  +  I  D+  A ++ I     W +  L  +P I++R+  +I +     ++  P    ++ LP  +A   E FR SS +     HC  +  +L GY+IPK   + +NQ+ INHD + W++P +  P+RFL   G+  +R D   +M FG+G R C G  I +   FL L 
Sbjct:   27 VYLLLKHFNKEIPGGLRQLPGPTPLPIIGNLLEL-GSKPYLSLTEMSK-RFGDVFQIQIGMRPVVVLSGNETVRQAL-IKQGDDFSGRPDLYSFQFINDGKSLAFSTDQAGVWRARRKLAYSALRSFSSLEGSNAEYSCMLEEHICKETEHLVKEIEKVMKTEGK----FDPYRYIVVSVANVICGMCFGRRYDHHDQELVGLVNLSEDFVQVTGSGNPADFIPALRYLPSKAMKKFVEINNRFQCFVQKIVNE--HYATYDKDNIRDITDSLIDHCEDRKLDENSNIQMSDEKVVGIVNDLFGAGFDTISTALSWAVGYLVAYPDIEKRLFEEIKENIGLNRN--PTISDRSNLPLTEAFILEIFRHSSFLPFTIPHCTTRDTSLNGYYIPKDTCVFINQWQINHDPKLWQDPSSFNPDRFLSEDGSEVNRLDGEKVMVFGLGKRRCIGEVIARNEVFLFLA 478          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Match: cyp1a (cytochrome P450 1A [Source:NCBI gene;Acc:100125806])

HSP 1 Score: 154.836 bits (390), Expect = 5.936e-41
Identity = 113/448 (25.22%), Postives = 204/448 (45.54%), Query Frame = 3
Query:  102 LRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWK-------EMIRALK-LGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLS---DNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRY-RNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD---IMPFGMGVRMCPGTSITKGYGFLLLC 1400
            LR  PGP  LP  GN     G+  Y  + E  K ++G++  +  G  P+V ++  +   +AL  K G   +GR  + +   +++ +   F  +   +W+         +R+   L  S    +  LE++I K       E+ +     GK    FD   ++     N +  +  GR +   D++ + L +       +       ++IP  RYLP K +++  E + +    + K V++      Y ++N  +I + L+   E+ KL     + ++D  +  I  D+  A ++ I     W +  L  +P I++R+  +I +     ++  P    ++ LP  +A   E FR SS +     HC  +  +L GY+IPK   + +NQ+ INHD + W++P +  P+RFL   G+  +R D   +M FG+G R C G  I +   FL L 
Sbjct:   14 LRQLPGPTPLPIIGNLLEL-GSKPYLSLTEMSK-RFGDVFQIQIGMRPVVVLSGNETVRQAL-IKQGDDFSGRPDLYSFQFINDGKSLAFSTDQAGVWRARRKLAYSALRSFSSLEGSNAEYSCMLEEHICKETEHLVKEIEKVMKTEGK----FDPYRYIVVSVANVICGMCFGRRYDHHDQELVGLVNLSEDFVQVTGSGNPADFIPALRYLPSKAMKKFVEINNRFQCFVQKIVNE--HYATYDKDNIRDITDSLIDHCEDRKLDENSNIQMSDEKVVGIVNDLFGAGFDTISTALSWAVGYLVAYPDIEKRLFEEIKENIGLNRN--PTISDRSNLPLTEAFILEIFRHSSFLPFTIPHCTTRDTSLNGYYIPKDTCVFINQWQINHDPKLWQDPSSFNPDRFLSEDGSEVNRLDGEKVMVFGLGKRRCIGEVIARNEVFLFLA 450          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Match: cyp1d1 (cytochrome P450 1A1 [Source:NCBI gene;Acc:101158704])

HSP 1 Score: 150.599 bits (379), Expect = 3.628e-39
Identity = 109/432 (25.23%), Postives = 191/432 (44.21%), Query Frame = 3
Query:  198 KPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLW-------KEMIRALKLGVSK-CGLTPSLEKNIQKSINFYCDELIRN-----------PDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRY-RNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDR--SDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIK 1427
            + K+G++  L  G+ P+V ++ Y    +AL  + G+  AGR  + T   V++     F   +GP W       K  +R+      +  G T  LE+++         E+IR             D + KGV P         N V ++  G+ +   D++++ + +   +V  +       ++ P  RY P   ++ L +   ++N  + + + +   M  + +N   +I + L+   E+ +   E  + L+D  I     DI  A ++ I     W +  L   P +Q RI  +I +     +   P F  K+++P+ +A  YE FR ++ V     HC  +  TL GY IPK   + +NQY +NHD + W +PE   P+RFL  SG         ++ FGMG R C G    +   F+ L  L    +I+
Sbjct:   86 RAKHGDVFKLRLGSLPVVVLSGYNTIRQAL-VRQGEDFAGRPELFTFSAVADGTSMTFSEKFGPAWLLHKKLCKNALRSFSQAAPRGSGATCLLEEHVCAEAAEML-EMIREQSAKVELDSEMTDGASKGVDPVKPLVTSVANVVCALCFGKRYDHNDKEFLTIVNINNEVLKLFAAGNLADFFPVFRYFPSLSLKELVQYIRRMNGFMERRIEE--HMHTFDKNYIRDITDALIALCEDREKSKEMSL-LSDTQIIHSVIDIFGAGFDTIIAGLQWSLLYLIKFPDVQRRIHQEIDEHIGSAR--MPNFSDKSKMPFTEAFIYEVFRHAAYVPFTIPHCTTRHTTLNGYFIPKDTCVFINQYQVNHDKDLWGDPEQFCPDRFLGHSGQLNKELTEKVLIFGMGKRRCLGDGFARLEMFVFLATLLHGLRIE 510          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Match: SMESG000012534.1 (SMESG000012534.1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 452/453 (99.78%), Postives = 453/453 (100.00%), Query Frame = 3
Query:  168 MIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 1526
            MIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD+MPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV
Sbjct:    1 MIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDLMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 453          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Match: SMESG000012534.1 (SMESG000012534.1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 447/448 (99.78%), Postives = 448/448 (100.00%), Query Frame = 3
Query:  183 MVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 1526
            MVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSD+MPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV
Sbjct:    1 MVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAFTDRSDLMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV 448          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Match: SMESG000080703.1 (SMESG000080703.1)

HSP 1 Score: 256.914 bits (655), Expect = 2.214e-79
Identity = 150/470 (31.91%), Postives = 250/470 (53.19%), Query Frame = 3
Query:   93 IERLRLPPGPWALPFWGNYRGFNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKK---VNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSG-AFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFR 1490
            I   +LPPGP       ++   N  +IY+++V+ Y PKYG + TL+   TP+VFIND +   E    K  K ++GR +   E I+S  R+NI  ++YGPLWK + R L  G+  C     L + + K  + + + +     +   G+   ++ +W++DN +  ++    F   D DY   Q +   +    ++ +F N  P  +    K + +L +   +L  +L   + + RK G Y+    +I +++L   E   L  + K   + L D+H++    D++FAS EG+G + +W   LL L+P IQE IR +I K      +      WK+++PY  AV  E  R++S     DFH  +  + +G Y IPK  LI +N YAI+HD ++W+NP+ I P+ FL   G +F  R D +P+G+G+R C G + ++   F+L+  +  NYK+ W  +N+  E++DD +NAV  R
Sbjct:    5 ISSYKLPPGPNRNSDEADFI-INEKLIYQKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQGAIEVIPQYAEECDFPNDKP-SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKF-RDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVW-GKNKSQEIIDD-KNAVFIR 467          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Match: SMESG000050434.1 (SMESG000050434.1)

HSP 1 Score: 190.274 bits (482), Expect = 7.191e-54
Identity = 136/492 (27.64%), Postives = 235/492 (47.76%), Query Frame = 3
Query:   66 LSVFVILK--FIERLRLPPGPWALPFWGNYRG-FNGAMIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIF-GNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDE-SYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCI-----RRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNL---NDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWK--NELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSGAF-TDRSDIMPFGMGVRMCPGTSIT-KGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFR 1490
            +  ++I K  F ++  LPPGP A P  G+    ++  + YKR++E +K KYG ++         V+++DYKL  +A        LAGR  + + D +S    NIF   +    W E+ + + + + K      + +    +   +   +    +    G F  ++  YW+  N ++ +        ++ +Y   QD+   +  +M K   V  + F    PL C+      ++ E S  L++ + K + + +  G Y+ NP   I+Y ++  +N K   EK   L    D  I  +  DI FA  +  G+   W + LL  HP +Q+ IR ++ K      ++   F +K  ++L Y+ AV  E  R  S+     FH A+  V +G Y IPK  +IA+N Y  ++D + W+NP    P+RF+++ G F + +   MPFG+G R C     T K   F+    +C ++KI WSS+N+  ++ +D EN   FR
Sbjct:   17 IVAYIIYKWHFPKKHNLPPGPKAWPIIGSIPDPYSSPLSYKRLIEDWKEKYGEIILFKRMGMNFVYVSDYKLGYQAFVKDYSNELAGR-PLNSVDRLSVGNENIFFTRSLDAGWTELRKQIMIMLRKVAEPQKMTEISNNAYELFATHIREKKELVSDGGFYVEQLCYWVGHNILVQVFWEDAVEFDNPNY---QDTISVIGKLMAK---VGNLAFFDITPLNCLPHPGKNKILEYSKYLSDKVQKHIKERKSDGNYKVNPKYFIDYCIEIQDNQKEQKEKYGQLPMLTDWFISNLSLDIYFAGMDAFGIGFSWTIGLLATHPHVQDNIRKELQK---NDIENVESFNYKMMDKLHYLNAVVNEVMRIHSLSSFTSFHRAMSDVKVGEYDIPKDTIIALNIYGAHYDPKYWKNPNEFNPDRFINADGKFQSPKEGFMPFGVGRRTCVAERYTVKESHFIFTGRICQDFKITWSSKNKTDKVEEDLENT-FFR 497          
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Match: SMESG000078401.1 (SMESG000078401.1)

HSP 1 Score: 125.946 bits (315), Expect = 3.620e-31
Identity = 111/383 (28.98%), Postives = 191/383 (49.87%), Query Frame = 3
Query:  393 WKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRN-PDNSGKGVFPFDESYWLSDNTVLS-IVIGRTFTLEDEDYIILQD---SRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLF-----EQSTKL-NNLLAKFVSDARKMGRYRNNPDNIIEYLLQET----ENSKLVTEKKVNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFL----DSSGAFTDRSDIMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVL 1484
            W  + R+L L V K  +  S E+ + + +N  C  L+++  D  GK +    E +  S   +LS I+I   F  E ++Y IL +      Q+ +++ K+  +   P+   LP K +R LF     +++ K+ N+   + + + ++     N  +N+I+  L+E     EN++++      + D  + +   ++   ++E I     W M L+  H +IQERI  +I +L  +  D  P    K  LPY QAV  E FR+SS+V I   H   + + L  Y I K  L+ VN YA++ D + WE P+   PE FL    +    +T R ++MPFG+G   C G   TK   F++L ++  N+KIK+       E+ ++  N++L
Sbjct:   51 WWTIRRSLILKVLKNFI--SKEQKLIEIVNEECLILLKDIKDVCGKEINT-KELFRKSMVNILSKIIINLRFERESKNYKILNEIIEENSQIKNMLIKTMLL--FPWLEKLP-KFVRFLFWCSEYKRNYKIQNSFFKEIIEEHKRKFDSMNKVENLIDAFLKEQNNLGENNRIID----GITDWQLIRNGIELFIVAFEKIRTLLSWSMVLMARHSEIQERIHEEIIQLIGR--DKIPNLVNKRSLPYTQAVIDEIFRYSSLVPITLPHKITEDIELHEYLIQKNSLVFVNFYAVHRDGDVWEKPDDFYPEHFLKLLTNGDIKYTPRDELMPFGIGSMQCLGEKFTKFQLFVILTSIVQNFKIKFRR-----EITEENSNSIL 416          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP1A18.946e-4326.39cytochrome P450 family 1 subfamily A member 1 [Sou... [more]
CYP1A18.946e-4326.39cytochrome P450 family 1 subfamily A member 1 [Sou... [more]
CYP1A18.946e-4326.39cytochrome P450 family 1 subfamily A member 1 [Sou... [more]
CYP1A25.186e-3924.73cytochrome P450 family 1 subfamily A member 2 [Sou... [more]
CYP2U16.897e-3824.57cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-35C13.699e-2925.21CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-35A26.652e-2824.59CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-35B14.029e-2725.10CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-34A108.652e-2725.59CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
daf-91.307e-2625.62Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a11.502e-3226.24gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a11.502e-3226.24gene:FBgn0010383 transcript:FBtr0074609[more]
phm4.396e-2822.52gene:FBgn0004959 transcript:FBtr0074603[more]
phm4.396e-2822.52gene:FBgn0004959 transcript:FBtr0342846[more]
Cyp304a16.365e-2522.54gene:FBgn0038095 transcript:FBtr0082691[more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2x82.502e-4327.16cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x85.257e-4326.94cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp17a27.199e-4226.30cytochrome P450, family 17, subfamily A, polypepti... [more]
cyp1b13.175e-4128.00cytochrome P450, family 1, subfamily B, polypeptid... [more]
cyp1b13.175e-4128.00cytochrome P450, family 1, subfamily B, polypeptid... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxh1.21.138e-4426.56forkhead box H1, gene 2 [Source:Xenbase;Acc:XB-GEN... [more]
cyp1a12.272e-4125.32cytochrome P450 family 1 subfamily A member 1 [Sou... [more]
cyp2a6.94.931e-4126.38cytochrome P450 family 2 subfamily A member 6 gene... [more]
nccrp14.092e-4026.29non-specific cytotoxic cell receptor protein 1 hom... [more]
cyp1d11.185e-3924.79cytochrome P450 family 1 subfamily D polypeptide 1... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp1a14.940e-4826.39cytochrome P450, family 1, subfamily a, polypeptid... [more]
Cyp1a14.940e-4826.39cytochrome P450, family 1, subfamily a, polypeptid... [more]
Cyp1a21.345e-4125.00cytochrome P450, family 1, subfamily a, polypeptid... [more]
Cyp2j84.697e-4127.15cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2j61.280e-3726.91cytochrome P450, family 2, subfamily j, polypeptid... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00184|CP1A1_MOUSE3.455e-4726.39Cytochrome P450 1A1 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|Q92109|CP1A3_ONCMY4.005e-4726.60Cytochrome P450 1A3 OS=Oncorhynchus mykiss OX=8022... [more]
sp|O42430|CP1A1_LIMLI1.435e-4527.49Cytochrome P450 1A1 OS=Limanda limanda OX=27771 GN... [more]
sp|Q92110|CP1A1_ONCMY1.534e-4526.38Cytochrome P450 1A1 OS=Oncorhynchus mykiss OX=8022... [more]
sp|O42231|CP1A1_CHEAU4.216e-4526.98Cytochrome P450 1A1 OS=Chelon auratus OX=48191 GN=... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YPU12.584e-5327.68Uncharacterized protein OS=Branchiostoma floridae ... [more]
C3YIB93.711e-5228.76Uncharacterized protein (Fragment) OS=Branchiostom... [more]
C3XUV51.419e-5027.13Uncharacterized protein OS=Branchiostoma floridae ... [more]
A5A7R54.134e-4926.16Cytochrome P450 17alpha-hydroxylase/17, 20-lyase O... [more]
C3ZZH52.191e-4827.52Uncharacterized protein (Fragment) OS=Branchiostom... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050112.12.146e-4626.25cytochrome P450 1A1-like [Source:NCBI gene;Acc:103... [more]
cyp1a1.435e-4525.78cytochrome P450 1A1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000007184.28.314e-4527.37cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000007100.21.552e-4428.15cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000054074.13.733e-4427.22cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011205.11.552e-3625.48pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
cyp1d15.964e-3322.55cytochrome P450, family 1, subfamily D, polypeptid... [more]
ENSPMAT00000011204.12.617e-3025.44pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 g... [more]
ENSPMAT00000011254.17.059e-2723.97pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
ENSPMAT00000002462.14.451e-2525.43pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 g... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERG51.599e-823.13C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
DIT21.084e-720.91N-formyltyrosine oxidase; sporulation-specific mic... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO487742.698e-4527.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466056.721e-4426.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409303.966e-4225.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481912.117e-4126.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465063.211e-4126.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024770.26.164e-4427.11cytochrome P450 2J6 [Source:NCBI gene;Acc:10116941... [more]
cyp17a25.031e-4124.88steroid 17-alpha-hydroxylase/17,20 lyase-like [Sou... [more]
cyp1a5.446e-4125.05cytochrome P450 1A [Source:NCBI gene;Acc:100125806... [more]
cyp1a5.936e-4125.22cytochrome P450 1A [Source:NCBI gene;Acc:100125806... [more]
cyp1d13.628e-3925.23cytochrome P450 1A1 [Source:NCBI gene;Acc:10115870... [more]
back to top
BLAST of Cytochrome P450, family 1, subfamily D, polypeptide 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012534.10.000e+099.78SMESG000012534.1[more]
SMESG000012534.10.000e+099.78SMESG000012534.1[more]
SMESG000080703.12.214e-7931.91SMESG000080703.1[more]
SMESG000050434.17.191e-5427.64SMESG000050434.1[more]
SMESG000078401.13.620e-3128.98SMESG000078401.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030292 ID=SMED30030292|Name=Cytochrome P450, family 1, subfamily D, polypeptide 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1587bp
GTTAATTTTATCTATTCGGATTAAAAATGTGGCAAGATATATTAACTGGG
GCCGGTGTTGGACTTCTATCTGTTTTTGTAATTTTAAAATTCATCGAAAG
ATTAAGGCTTCCACCTGGCCCATGGGCATTGCCATTTTGGGGAAATTATC
GAGGGTTTAATGGAGCTATGATTTACAAAAGAATGGTTGAATACTACAAA
CCAAAGTACGGGAATTTGGTCACTTTGTTTTGGGGCAATACACCGATCGT
ATTCATAAATGACTACAAATTAGCTATAGAAGCACTCGGAAATAAAAATG
GAAAACATTTGGCTGGTCGTAAAAGTGTACAAACGGAAGATATTGTTTCT
GAAGAAAGACACAATATATTTGGTAACAATTATGGTCCACTGTGGAAAGA
AATGATTCGAGCCCTAAAGTTAGGTGTTTCAAAATGTGGTCTCACTCCTT
CTTTGGAGAAAAACATTCAAAAATCTATAAATTTCTACTGTGATGAACTA
ATAAGAAATCCGGATAATTCGGGTAAAGGCGTTTTTCCATTCGATGAGTC
GTATTGGTTATCGGATAATACAGTATTAAGCATTGTCATTGGACGAACGT
TTACTTTAGAAGATGAAGATTACATAATCTTGCAGGATTCAAGACGACAG
GTTTTCGACATTATGGACAAATCTGAATTTGTCAATTGGATTCCGTTTGG
GAGATATTTGCCATTGAAGTGCATAAGACGGCTATTTGAGCAATCAACAA
AATTGAATAATTTGTTAGCAAAATTTGTCAGTGATGCTCGAAAAATGGGA
AGATATCGAAATAATCCTGATAATATCATTGAATATTTGCTTCAAGAAAC
TGAAAACTCAAAGCTTGTTACAGAAAAAAAAGTGAATCTGAACGATGTGC
ACATCCGGCAAATATTCAAAGATATACTCTTTGCAAGTTATGAAGGAATA
GGGATGACAAATATTTGGTACATGGCATTGCTAGGATTACATCCTCAAAT
TCAAGAAAGAATTAGATTAGATATTACTAAACTCTGTAGTAAAAAGAAAG
ATTCAACACCGAAATTTGAATGGAAAAATGAGCTGCCGTATATTCAGGCG
GTGGAATATGAATTTTTCAGATTTTCATCTATTGTTGGAATACTCGATTT
CCATTGCGCCTTGAAATCGGTTACGTTGGGAGGATATCATATTCCAAAAG
GTTGCTTAATTGCTGTGAATCAGTATGCGATTAATCATGATGCTGAACGT
TGGGAAAATCCTGAAACCATCAAGCCTGAAAGATTTTTGGATAGTAGTGG
AGCTTTTACCGACCGTTCTGATATAATGCCCTTCGGAATGGGAGTCAGAA
TGTGTCCGGGAACTTCAATAACCAAAGGATATGGATTCTTGTTACTCTGT
AACTTATGTTTAAATTATAAGATAAAGTGGTCTTCCGAAAATGAGTTCAC
GGAATTAGTTGATGATCCAGAAAATGCCGTTTTATTCCGATTTCCCAAAG
ATTATTTACTCAATATATCAAAAGTATAAAATTTTCGGAATATTAGGAAA
TTCATTTAATTTTCGCTCAAATTTCAATAATAAATTT
back to top

protein sequence of SMED30030292-orf-1

>SMED30030292-orf-1 ID=SMED30030292-orf-1|Name=SMED30030292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=501bp
MWQDILTGAGVGLLSVFVILKFIERLRLPPGPWALPFWGNYRGFNGAMIY
KRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKS
VQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKS
INFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYI
ILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKF
VSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKKVNLNDVHIRQIFKDI
LFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWK
NELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQY
AINHDAERWENPETIKPERFLDSSGAFTDRSDIMPFGMGVRMCPGTSITK
GYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFRFPKDYLLNISKV
*
back to top
Aliases
The feature 'Cytochrome P450, family 1, subfamily D, polypeptide 1' has the following synonyms
Synonym
slc25a-36
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0050649testosterone 6-beta-hydroxylase activity
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
GO:0070330aromatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000421tail
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
IPR017972Cyt_P450_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043231intracellular membrane-bounded organelle