Actin-1

Overview
NameActin-1
Smed IDSMED30030289
Length (bp)1121
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-1 (SMED30030289) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-1 (SMED30030289) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-1 (SMED30030289) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-1 (SMED30030289) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030289

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030289SMESG000058003.1 SMESG000057992.1 SMESG000057988.1 SMESG000057914.1 SMESG000057913.1 dd_Smed_v4_8957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30030289SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-1 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPE+LFQP+FLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPE+LFQP+FLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPE+LFQP+FLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 352/371 (94.88%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D++++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPE+LFQP+FLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 351/371 (94.61%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D++++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPE++FQP+FLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Fly
Match: Act42A (gene:FBgn0000043 transcript:FBtr0086029)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 356/371 (95.96%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPESLFQP+FLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 357/369 (96.75%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 357/369 (96.75%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 355/369 (96.21%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Xenopus
Match: rspry1 (ring finger and SPRY domain containing 1 [Source:Xenbase;Acc:XB-GENE-1002344])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 343/369 (92.95%), Postives = 359/369 (97.29%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+ +ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IV
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV 372          
BLAST of Actin-1 vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 342/369 (92.68%), Postives = 359/369 (97.29%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +ED +ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IV
Sbjct:   24 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIV 392          
BLAST of Actin-1 vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 342/369 (92.68%), Postives = 359/369 (97.29%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +ED +ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IV
Sbjct:    4 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIV 372          
BLAST of Actin-1 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Mouse
Match: Acta2 (actin, alpha 2, smooth muscle, aorta [Source:MGI Symbol;Acc:MGI:87909])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 343/369 (92.95%), Postives = 360/369 (97.56%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +ED +ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IV
Sbjct:    4 EEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV 372          
BLAST of Actin-1 vs. Ensembl Mouse
Match: Actc1 (actin, alpha, cardiac muscle 1 [Source:MGI Symbol;Acc:MGI:87905])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 343/369 (92.95%), Postives = 359/369 (97.29%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+ +ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IV
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV 372          
BLAST of Actin-1 vs. UniProt/SwissProt
Match: sp|P53471|ACT2_SCHMA (Actin-2 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 359/371 (96.77%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M+DE++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV IQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAG+HETTFNSIMKCDVDIRKDLYANTVLSGG+TMFPGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MADEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGVHETTFNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. UniProt/SwissProt
Match: sp|P92182|ACT1_LUMTE (Actin-1 OS=Lumbricus terrestris OX=6398 GN=ACT1 PE=2 SV=1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 358/371 (96.50%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF+QEM TAASSSSLEKSYELPDGQVITIGNERFRCPES+FQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTV+SGG+TMFPGIADRMQKEITS+APSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFDQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPESMFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVMSGGTTMFPGIADRMQKEITSMAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. UniProt/SwissProt
Match: sp|Q26065|ACT_PLAMG (Actin, adductor muscle OS=Placopecten magellanicus OX=6577 PE=2 SV=1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 358/371 (96.50%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D++++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPESLFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMFPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. UniProt/SwissProt
Match: sp|P68555|ACT_TAESO (Actin OS=Taenia solium OX=6204 GN=ACT1 PE=3 SV=1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 358/371 (96.50%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV IQAVLSLYASGRTTGIVLDSGDGVTH+VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPESLFQP+FLGMESAGIHE+TFN+IMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MGDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVTHSVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHESTFNAIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. UniProt/SwissProt
Match: sp|P68556|ACT1_DIPDE (Actin-1/4 OS=Diphyllobothrium dendriticum OX=28845 GN=ACT1 PE=2 SV=1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 358/371 (96.50%), Postives = 367/371 (98.92%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DE++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV IQAVLSLYASGRTTGIVLDSGDGVTH+VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPESLFQP+FLGMESAGIHE+TFN+IMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MGDEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVTHSVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHESTFNAIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. TrEMBL
Match: A0A5J4NKW1 (Actin beta/gamma 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0004141 PE=3 SV=1)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 361/371 (97.30%), Postives = 370/371 (99.73%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDED++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. TrEMBL
Match: A0A4S2LD35 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008170 PE=3 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 359/371 (96.77%), Postives = 369/371 (99.46%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DED++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. TrEMBL
Match: A0A419PSP4 (Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10905s PE=3 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 359/371 (96.77%), Postives = 369/371 (99.46%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DED++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. TrEMBL
Match: A0A419PSM3 (Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10907s PE=3 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 359/372 (96.51%), Postives = 370/372 (99.46%), Query Frame = 1
Query:    4 EMSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +M DED++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    5 KMGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 376          
BLAST of Actin-1 vs. TrEMBL
Match: A0A074Z5L1 (Actin OS=Opisthorchis viverrini OX=6198 GN=T265_09499 PE=3 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 359/371 (96.77%), Postives = 369/371 (99.46%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M DED++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 357/369 (96.75%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 356/369 (96.48%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 355/367 (96.73%), Postives = 363/367 (98.91%), Query Frame = 1
Query:   19 DISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITSLAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    6 EIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 372          
BLAST of Actin-1 vs. Ensembl Cavefish
Match: acta2 (actin alpha 2, smooth muscle [Source:NCBI gene;Acc:103040556])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 343/369 (92.95%), Postives = 360/369 (97.56%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            DE+ +ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IV
Sbjct:    4 DEESTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV 372          
BLAST of Actin-1 vs. Ensembl Cavefish
Match: zgc:86709 (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103031734])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 342/369 (92.68%), Postives = 359/369 (97.29%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D++ +ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+F+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IV
Sbjct:    4 DDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV 372          
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M++++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 352/371 (94.88%), Postives = 366/371 (98.65%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M++++I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVG P HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 452.595 bits (1163), Expect = 6.320e-160
Identity = 208/376 (55.32%), Postives = 282/376 (75.00%), Query Frame = 1
Query:   19 DISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---------GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D  A+V+DNGSG+CKAGFAG++APR   PS+VGRPR +  M+         G G    Y+G +A  +RG+L+L+YP+E GIVT WDDME++W H +  EL   P++ PVLLTEAPLNP  NRE+  Q++FE F APA+++A+QAVLSLYASG  TG+ +  GDGVTH VP++EGY LP A+LR D+AGRD+TD L +IL ERG++F ++AE EIV DIKE++CYVA D+E+E+       +++  Y+LPDGQVIT+ ++RFR PE LF P  +G+++ GIH+  + S+ + D+D+RK LY+N +LSGGS++FPG+ +R+ +E+  LAP    ++I APPERKYSVWIGGSILASLSTFQQMWI+  EY E GP +V
Sbjct:    6 DNPAVVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKELRRKPEELAVD--YKLPDGQVITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAPVRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVV 379          
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008200.1 (pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 gene:ENSPMAG00000007412.1 transcript:ENSPMAT00000008200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.269 bits (604), Expect = 8.009e-77
Identity = 125/288 (43.40%), Postives = 177/288 (61.46%), Query Frame = 1
Query:   55 MCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYA-SGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-TERGYSF------TTTAEREIVR--DIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIR 879
              K G+AG + P  +FP++VGRP  R    +  +  KD  VGD+A   R +L + YP+E+GIV NWDDM+ +W +TF  ++L V   E  +LLTE P+NP  NREK+ ++MFE +   A+Y+AIQAVL+LYA +G  TG+V+DSGDGVTH  P+YEG++LPH   RLD+AGRD+T YL+K+L     Y F       T+AE E V    ++    +  +     +             +LPDG++I +G ERF  PE+LFQP  + +ES G+ E  FN+I   D+D R
Sbjct:    1 FVKCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDLMVGDDASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPDKLNVNTRECKILLTEPPMNPMKNREKIIEVMFEQYGFSAVYIAIQAVLTLYAQAGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVLWLNHSYFFIPVLFRCTSAEWESVNVSSLRRAKLFTIVRVRSFLP------------QLPDGRIIKVGGERFEAPEALFQPHLIDVESVGVAELLFNTIQAADIDTR 276          
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.876 bits (590), Expect = 5.051e-73
Identity = 147/403 (36.48%), Postives = 211/403 (52.36%), Query Frame = 1
Query:   28 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXX-XXLEKSYELPDG-----QVITIGNERFRCPESLFQPAFLGME-SAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEIT----------------SLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            A  +D  +   K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IKE+  Y+  D  +E S   +  S   K Y   +        I +G ERF  PE  F P F   + +  I E   N I  C +D+R+ LY N VLSGGSTMF     R+Q+++                  + P  + ++++    ++Y+VW GGS+LAS   F Q+  +K++Y+E GP I 
Sbjct:    4 ACTLDKKNRYTKIGYAGNTEPQFIIPSCISIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIEKPNYST-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKKEFTIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSIC 405          
BLAST of Actin-1 vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 324/369 (87.80%), Postives = 355/369 (96.21%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D +++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG+MVGMGQKDSYVGDEAQSKRGILTL+YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPK+NREKMTQIMFETFN PA YV+IQAVLSLY+SGRTTGIVLDSGDGVTH VPIY G++LPHAILR+DLAGRDLTDYLMKIL+ERGYSF+TTAEREIVRDIKEKLCYVALDFEQEM TAA SSS+EKSYELPDGQVITIGNERFR PE+LF P+ LG+ESAGI +TT+NSIMKCDVD+RK+LY N V+SGG+TMFPGIA+RMQKEIT+LAPS+MK+KI+APPERKYSVWIGGSILASL+TFQQMWISKQEYDESGP IV
Sbjct:    2 DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 362.073 bits (928), Expect = 3.009e-124
Identity = 179/378 (47.35%), Postives = 251/378 (66.40%), Query Frame = 1
Query:   25 SALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSL--------APSTM---KIKIVAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGP 1110
            + +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE P+NP  NREKM ++MFE ++   +YVAIQAVL+LYA G ++G+V+DSGDGVTH VP+YE   L H   RLD+AGRD+T +L+ +L+ RGY+F  TA+ E VR IKEKLCYV+ D + +   A  +++L +SYELPDG+ I +G ERF  PE LFQP  + +E  G+ E  FN++   DVDIR  LY   VLSGGS+M+PG+  R++KE+  L         PS +   K++I  PP RK+ V+IGG++LAS ++    MW+SKQE+ ESGP
Sbjct:    5 NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGP 382          
BLAST of Actin-1 vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 359.762 bits (922), Expect = 1.849e-123
Identity = 169/360 (46.94%), Postives = 251/360 (69.72%), Query Frame = 1
Query:   31 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYL-MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXX-XXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 1101
            +V+DNGSG+ KAGF+G++ P+A+   +VG  ++  VM+   Q D+++G+ AQ  RG+L L+YPI+HG+V +WD ME IW +     L++    EHP+L+TEAP+NP  NRE+M Q++FETF+  A+YV+  AVLSLYASGRTTG V+D G+G   TVPIY+G+ALP +++R+D+ G D+T+ L  ++    G S  +++EREIVR +KEK+CY+A + ++E       +  L  +++LPDG+ I +GN+R+R PE LF P  +G+   G+ +    SI K D+D+RK L ++ +LSGG+T   G  DRM  ++ +L   T KIKI+AP ERKY+ WIGGSIL  LSTFQ++W  K ++ E
Sbjct:   15 VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin-1 vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 238.424 bits (607), Expect = 2.767e-75
Identity = 158/445 (35.51%), Postives = 237/445 (53.26%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFP--------------SIVGRP-----------------RHQGVMVGM------GQK-----DSYVGDEA--QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT--TAEREIVRDIKEKLCYVALDFEQEMXX-----XXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFN-SIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLA--------------PSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MS  +  A+V+DNG+G+ K GFAG+D+P  VFP              S VG P                    G   G+      G++     D Y+G+EA   S+    +L YPI HG V NWD ME+ W ++ +  LR  PE+H  LLTE PLNP  NRE++ +I FE+FN   +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +  AI  + +AGRD+T ++  +L ERG + T+  TAE+     IK++ CYV  D  +E +      +  +  + ++ E    +V+ IG ERF  PE  F P     +      T  + +I  C +D+RK LY N VLSGGSTMF     R+Q+++ S+                + + + +++  +++ +VW GGS+LA  + F+    +K++Y+E GP IV
Sbjct:    1 MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIV 440          
BLAST of Actin-1 vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 97.4413 bits (241), Expect = 9.201e-23
Identity = 77/289 (26.64%), Postives = 123/289 (42.56%), Query Frame = 1
Query:   16 EDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-----------TERGYSFTTTA--------------EREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNE-RFRCPESLFQP 801
            +++SA+V+D GS     G++G D P+++ PS+ G+          G K  +        R    LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +AG+ +   + K L            +R   F                   R   ++ KE LC++      E +    SS+ ++S E P  + I   NE R+   E LF P
Sbjct:   12 DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295          

HSP 2 Score: 94.3597 bits (233), Expect = 1.046e-21
Identity = 48/118 (40.68%), Postives = 72/118 (61.02%), Query Frame = 1
Query:  763 NERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 1107
            NE  + P    +P     E  G+ +  ++SIM  DVD+R  L  N VL+GG++  PG++DR+  E+  + PS +K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct:  363 NETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin-1 vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 354/371 (95.42%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M D+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE++FQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 371          
BLAST of Actin-1 vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 353/369 (95.66%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+D++ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE++FQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEITSLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 353/369 (95.66%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +++++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE++FQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEITSLAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 349/371 (94.07%), Postives = 368/371 (99.19%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            M+D+DI+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSS+EKSYELPDGQVITIGNERFRCPE+L QP+FLGMES+GIHETT+NSIMKCDVDIRKDLYANTV+SGG+TM+PG+ADRMQKEI++LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIV 371          
BLAST of Actin-1 vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 351/369 (95.12%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            ++D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL YVALDFEQEM+TAA+SSSLEKSYELPDGQVITIGNERFRCPE++FQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            D+DI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    4 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 372          
BLAST of Actin-1 vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 353/369 (95.66%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAP+TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:   37 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 405          
BLAST of Actin-1 vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 353/369 (95.66%), Postives = 366/369 (99.19%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            ++D+SALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIV 370          
BLAST of Actin-1 vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 353/369 (95.66%), Postives = 365/369 (98.92%), Query Frame = 1
Query:   13 DEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            +E+I+ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEIT+LAP+TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IV
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 370          
BLAST of Actin-1 vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. Planmine SMEST
Match: SMESG000057992.1 (SMESG000057992.1)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. Planmine SMEST
Match: SMESG000057988.1 (SMESG000057988.1)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. Planmine SMEST
Match: SMESG000057914.1 (SMESG000057914.1)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 370/371 (99.73%), Postives = 370/371 (99.73%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
BLAST of Actin-1 vs. Planmine SMEST
Match: SMESG000057913.1 (SMESG000057913.1)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 370/371 (99.73%), Postives = 370/371 (99.73%), Query Frame = 1
Query:    7 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 1119
            MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371          
The following BLAST results are available for this feature:
BLAST of Actin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTB0.000e+096.48actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB0.000e+096.48actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTG10.000e+095.93actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.93actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.93actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-20.000e+095.42Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+095.42Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+095.42Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-40.000e+094.88Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-30.000e+094.61Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
back to top
BLAST of Actin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act42A0.000e+095.96gene:FBgn0000043 transcript:FBtr0086029[more]
Act5C0.000e+095.42gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C0.000e+095.42gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C0.000e+095.42gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C0.000e+095.42gene:FBgn0000042 transcript:FBtr0070823[more]
back to top
BLAST of Actin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+096.75actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb10.000e+096.75actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb20.000e+096.48actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+096.48actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+096.48actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of Actin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actg10.000e+096.48actin gamma 1 [Source:NCBI gene;Acc:394957][more]
actb0.000e+096.21actin, beta [Source:NCBI gene;Acc:407952][more]
rspry10.000e+092.95ring finger and SPRY domain containing 1 [Source:X... [more]
acta20.000e+092.68actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
acta20.000e+092.68actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
back to top
BLAST of Actin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actb0.000e+096.48actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg10.000e+095.93actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg10.000e+095.93actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Acta20.000e+092.95actin, alpha 2, smooth muscle, aorta [Source:MGI S... [more]
Actc10.000e+092.95actin, alpha, cardiac muscle 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Actin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53471|ACT2_SCHMA0.000e+096.77Actin-2 OS=Schistosoma mansoni OX=6183 PE=2 SV=1[more]
sp|P92182|ACT1_LUMTE0.000e+096.50Actin-1 OS=Lumbricus terrestris OX=6398 GN=ACT1 PE... [more]
sp|Q26065|ACT_PLAMG0.000e+096.50Actin, adductor muscle OS=Placopecten magellanicus... [more]
sp|P68555|ACT_TAESO0.000e+096.50Actin OS=Taenia solium OX=6204 GN=ACT1 PE=3 SV=1[more]
sp|P68556|ACT1_DIPDE0.000e+096.50Actin-1/4 OS=Diphyllobothrium dendriticum OX=28845... [more]
back to top
BLAST of Actin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NKW10.000e+097.30Actin beta/gamma 1 OS=Paragonimus westermani OX=34... [more]
A0A4S2LD350.000e+096.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PSP40.000e+096.77Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10... [more]
A0A419PSM30.000e+096.51Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10... [more]
A0A074Z5L10.000e+096.77Actin OS=Opisthorchis viverrini OX=6198 GN=T265_09... [more]
back to top
BLAST of Actin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+096.75actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb20.000e+096.48actin beta [Source:NCBI gene;Acc:103030443][more]
actb10.000e+096.73actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta20.000e+092.95actin alpha 2, smooth muscle [Source:NCBI gene;Acc... [more]
zgc:867090.000e+092.68actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Actin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011113.10.000e+095.42pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.10.000e+094.88pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.16.320e-16055.32pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
ENSPMAT00000008200.18.009e-7743.40pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 ge... [more]
ENSPMAT00000003686.15.051e-7336.48pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
back to top
BLAST of Actin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT10.000e+087.80Actin; structural protein involved in cell polariz... [more]
ARP23.009e-12447.35Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP11.849e-12346.94Actin-related protein of the dynactin complex; req... [more]
ARP32.767e-7535.51Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP49.201e-2326.64Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385200.000e+095.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426460.000e+095.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450130.000e+095.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379760.000e+094.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380060.000e+095.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb0.000e+095.93cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb0.000e+095.93cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000011677.20.000e+095.66actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000021726.20.000e+095.66actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
ENSORLT00000029375.10.000e+095.66actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
back to top
BLAST of Actin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058003.10.000e+0100.00SMESG000058003.1[more]
SMESG000057992.10.000e+0100.00SMESG000057992.1[more]
SMESG000057988.10.000e+0100.00SMESG000057988.1[more]
SMESG000057914.10.000e+099.73SMESG000057914.1[more]
SMESG000057913.10.000e+099.73SMESG000057913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030289 ID=SMED30030289|Name=Actin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1121bp
ATTGAAATGTCCGACGAAGATATTAGTGCTTTAGTTGTTGACAACGGATC
CGGTATGTGCAAAGCCGGTTTCGCTGGAGATGATGCTCCAAGAGCTGTTT
TCCCATCAATTGTCGGTAGACCTCGTCATCAAGGAGTTATGGTCGGCATG
GGACAAAAAGACAGCTATGTTGGAGATGAAGCTCAATCAAAGAGAGGTAT
TTTGACTTTGAAATATCCCATCGAACACGGTATCGTTACCAACTGGGATG
ATATGGAAAAGATCTGGCATCACACTTTCTACAATGAGTTGAGAGTAGCT
CCAGAAGAACATCCAGTTTTGTTGACTGAAGCTCCATTGAATCCAAAAGC
CAACAGAGAGAAAATGACTCAAATCATGTTTGAAACTTTCAATGCACCTG
CAATGTATGTTGCAATTCAAGCTGTGTTGTCTTTGTATGCTTCTGGAAGA
ACAACTGGTATTGTTTTGGATTCTGGAGACGGTGTCACCCACACTGTACC
AATCTATGAGGGTTATGCTTTACCACACGCAATTCTTCGTTTGGATTTAG
CTGGTCGAGATTTGACTGATTATTTGATGAAGATTCTCACTGAAAGAGGT
TACAGTTTCACTACAACTGCTGAAAGAGAAATCGTCAGAGATATCAAAGA
AAAGTTGTGCTATGTTGCTTTGGATTTCGAACAAGAAATGTCCACTGCAG
CATCAAGCAGCAGCTTGGAAAAAAGTTACGAATTACCTGACGGTCAAGTA
ATTACAATCGGAAATGAAAGATTCCGTTGTCCAGAATCATTGTTCCAACC
TGCTTTCTTGGGTATGGAATCAGCTGGTATTCATGAAACTACATTCAACA
GTATCATGAAATGTGATGTGGACATTAGAAAAGATTTGTATGCCAACACA
GTTTTGTCTGGAGGAAGCACAATGTTCCCAGGTATTGCTGATCGTATGCA
AAAGGAGATTACCTCTCTTGCTCCAAGCACAATGAAAATTAAGATTGTTG
CTCCACCTGAAAGGAAATACTCTGTATGGATCGGTGGTTCGATCTTGGCT
TCATTGTCCACTTTCCAACAAATGTGGATCTCAAAACAAGAATATGACGA
ATCCGGACCTGGAATCGTTCA
back to top

protein sequence of SMED30030289-orf-1

>SMED30030289-orf-1 ID=SMED30030289-orf-1|Name=SMED30030289-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
IEMSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA
PEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGR
TTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
YSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQV
ITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANT
VLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILA
SLSTFQQMWISKQEYDESGPGIV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004000Actin
IPR020902Actin/actin-like_CS
IPR004001Actin_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004000Actin familyPRINTSPR00190ACTINcoord: 29..38
score: 96.55
coord: 239..255
score: 91.95
coord: 118..131
score: 97.31
coord: 143..162
score: 96.3
coord: 52..63
score: 92.79
coord: 64..86
score: 94.91
IPR004000Actin familySMARTSM00268actin_3coord: 8..371
e-value: 4.3E-229
score: 777.0
IPR004000Actin familyPFAMPF00022Actincoord: 7..370
e-value: 3.3E-147
score: 490.3
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 6..372
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 183..275
e-value: 9.4E-191
score: 635.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 141..341
e-value: 9.4E-191
score: 635.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 11..372
e-value: 9.4E-191
score: 635.1
NoneNo IPR availablePANTHERPTHR11937:SF243ACTIN, CYTOPLASMIC TYPE 5coord: 6..372
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 11..184
e-value: 1.74635E-20
score: 86.1035
IPR020902Actin/actin-like conserved sitePROSITEPS01132ACTINS_ACT_LIKEcoord: 107..119
IPR004001Actin, conserved sitePROSITEPS00406ACTINS_1coord: 56..66
IPR004001Actin, conserved sitePROSITEPS00432ACTINS_2coord: 359..367
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 150..372
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 7..156