Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30030287
Length (bp)1717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30030287) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30030287) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30030287) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30030287) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030287

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030287SMESG000064848.1 dd_Smed_v4_2045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030287SMESG000064848.1 dd_Smed_v6_2045_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030287SMESG000064848.1 dd_Smed_v4_2045_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030287SMESG000064848.1 dd_Smed_v4_9047_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 390/504 (77.38%), Postives = 448/504 (88.89%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 390/514 (75.88%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CB (protein phosphatase 3 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9315])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 370/488 (75.82%), Postives = 432/488 (88.52%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHATENHGT 509          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CB (protein phosphatase 3 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9315])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 370/498 (74.30%), Postives = 432/498 (86.75%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +          A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHATENHGT 519          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP3CB (protein phosphatase 3 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9315])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 370/498 (74.30%), Postives = 432/498 (86.75%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +          A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFD-GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHATENHGT 518          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 369/487 (75.77%), Postives = 423/487 (86.86%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLH--TALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTN 1568
            TER VK+V FP S R+T ++V+D + GKP  E+L+ HFI EGR+ E+AA+++I E +++ + EK +L+IEAP TVCGD+HGQF+DLMKLFEVGG+PATT+YLFLGDYVDRGYFSIE VLYLWA+KI YPTT FLLRGNHECRHLTEYFTFKQECKIKY+ER+YD CM++FD LPLAALMNQQFLCVHGGLSPEIHT++DIR+IDRF+EPPA+GPMCDLLWSDPLEDFGNER+ E +SHNSVRGCSYF+SYAACCDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLV++LNICSDDEL++E DDTFEGG  +ARKEVIR+KIRAIGKMAR F+VLREESESVL LKGLTP G LP+G L GG   +    A SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT 
Sbjct:   38 TERFVKTVQFPVSERLTVDQVYDRRTGKPRHEVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLREESESVLALKGLTPTGALPMGTLQGGSRGVREVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQTT 524          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 369/494 (74.70%), Postives = 423/494 (85.63%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTAL---------SGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTN 1568
            TER VK+V FP S R+T ++V+D + GKP  E+L+ HFI EGR+ E+AA+++I E +++ + EK +L+IEAP TVCGD+HGQF+DLMKLFEVGG+PATT+YLFLGDYVDRGYFSIE VLYLWA+KI YPTT FLLRGNHECRHLTEYFTFKQECKIKY+ER+YD CM++FD LPLAALMNQQFLCVHGGLSPEIHT++DIR+IDRF+EPPA+GPMCDLLWSDPLEDFGNER+ E +SHNSVRGCSYF+SYAACCDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLV++LNICSDDEL++E DDTFEGG  +ARKEVIR+KIRAIGKMAR F+VLR ESESVLQLKGL   G LP GALS G+  L+ A          SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT 
Sbjct:   38 TERFVKTVQFPVSERLTVDQVYDRRTGKPRHEVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQTT 531          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 369/497 (74.25%), Postives = 423/497 (85.11%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFE---GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTAL---------SGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTN 1568
            TER VK+V FP S R+T ++V+D + GKP  E+L+ HFI EGR+ E+AA+++I E +++ + EK +L+IEAP TVCGD+HGQF+DLMKLFEVGG+PATT+YLFLGDYVDRGYFSIE VLYLWA+KI YPTT FLLRGNHECRHLTEYFTFKQECKIKY+ER+YD CM++FD LPLAALMNQQFLCVHGGLSPEIHT++DIR+IDRF+EPPA+GPMCDLLWSDPLEDFGNER+ E +SHNSVRGCSYF+SYAACCDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLV++LNICSDDEL++E DDTFE   GG  +ARKEVIR+KIRAIGKMAR F+VLR ESESVLQLKGL   G LP GALS G+  L+ A          SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT 
Sbjct:   38 TERFVKTVQFPVSERLTVDQVYDRRTGKPRHEVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGADGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQTT 534          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.1 (Serine/threonine-protein phosphatase 4 catalytic subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XW79])

HSP 1 Score: 229.565 bits (584), Expect = 3.703e-70
Identity = 124/274 (45.26%), Postives = 164/274 (59.85%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNV 1061
            +AE     +  +   IL EE NV  I++P T+CGD+HGQF+DLM+LF+VGG    T YLFLGD+VDRG++S+E  L L A+K  YP    L+RGNHE R +T+ + F  EC  KY    ++  C + FD L LAA+++ +  CVHGGLSP I T+D IR IDR +E P  GPMCDLLWSDP E  GN          S RG  Y F   A   F + N +  I RAH+    GY+ +   +V      +T++SAPNY     N AAIL+ + N+
Sbjct:   45 IAEQDVKTLCAKAREILAEEGNVQVIDSPVTICGDIHGQFYDLMELFKVGGPVPNTNYLFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFYDECLRKYGNASVWKHCTEVFDYLSLAAVIDGKVFCVHGGLSPSISTMDQIRVIDRKQEVPHDGPMCDLLWSDPEE--GNVG-----WGLSPRGAGYLFGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKV------LTVWSAPNYCYRCGNVAAILELDENL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.2 (Serine/threonine-protein phosphatase 4 catalytic subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTT8])

HSP 1 Score: 228.794 bits (582), Expect = 5.270e-70
Identity = 122/269 (45.35%), Postives = 160/269 (59.48%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILK 1046
            + E     I  +   IL EE NV  I+ P T+CGD+HGQF DLM+LF VGG+P  T YLFLGDYVDRGY S+E  + L  +K  YP    L+RGNHE R +T+ + F  EC  KY + +++  C + FD L LAA+++ +  CVHGGLSP I T+D IR +DR  E P  GPMCDLLWSDP E              S RG  Y F   A   F +NN+ L I RAH+    GY+++ + +V      +T++SAPNY     N AAI++
Sbjct:   30 ICETQVKSICAKVREILIEEANVQVIDTPVTICGDIHGQFHDLMELFRVGGSPPNTNYLFLGDYVDRGYNSVETFILLMLLKCRYPDRITLIRGNHESRQITQVYGFYDECVRKYGSGQVWKHCTEIFDYLSLAAVIDGKLFCVHGGLSPSIATLDQIRVLDRKIEVPHEGPMCDLLWSDPEEGCSG-------WGISPRGAGYLFGGDAAELFCENNDFLRICRAHQLVMEGYKLHFRKRV------VTVWSAPNYCYRCGNVAAIME 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0305593)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 385/500 (77.00%), Postives = 435/500 (87.00%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS 1577
            K+       +T ER+V SVPFPPSH++T  EVFD + GKPN E+LKQHFILEGR+ E  ALKII +GA +L++EK ++DIEAP TVCGD+HGQF+DLMKLFEVGG+PA+T+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD     S + + +  Q   N +
Sbjct:   68 KLHGGHTAVNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDQPPTPSEDPNQHSQQGGKNGA 567          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0309793)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 385/500 (77.00%), Postives = 435/500 (87.00%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS 1577
            K+       +T ER+V SVPFPPSH++T  EVFD + GKPN E+LKQHFILEGR+ E  ALKII +GA +L++EK ++DIEAP TVCGD+HGQF+DLMKLFEVGG+PA+T+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD     S + + +  Q   N +
Sbjct:   68 KLHGGHTAVNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDQPPTPSEDPNQHSQQGGKNGA 567          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0074294)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 385/500 (77.00%), Postives = 435/500 (87.00%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS 1577
            K+       +T ER+V SVPFPPSH++T  EVFD + GKPN E+LKQHFILEGR+ E  ALKII +GA +L++EK ++DIEAP TVCGD+HGQF+DLMKLFEVGG+PA+T+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD     S + + +  Q   N +
Sbjct:   68 KLHGGHTAVNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDQPPTPSEDPNQHSQQGGKNGA 567          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0305198)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 379/484 (78.31%), Postives = 428/484 (88.43%), Query Frame = 3
Query:   93 TAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNE 1538
            T     ST ER++ SV FPPS ++T  +VFD++ GKP  ++LKQHFILEGR+ E AAL+II EGA +L+ EK ++DIEAP TVCGD+HGQF+DLMKLFE+GG+PATT+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD   + + E
Sbjct:   79 TKRSTISTKERVIDSVAFPPSRKLTCADVFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDATPSPAEE 562          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0074292)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 379/484 (78.31%), Postives = 428/484 (88.43%), Query Frame = 3
Query:   93 TAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNE 1538
            T     ST ER++ SV FPPS ++T  +VFD++ GKP  ++LKQHFILEGR+ E AAL+II EGA +L+ EK ++DIEAP TVCGD+HGQF+DLMKLFE+GG+PATT+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD   + + E
Sbjct:   79 TKRSTISTKERVIDSVAFPPSRKLTCADVFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDATPSPAEE 562          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ca (protein phosphatase 3, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-091113-24])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 378/504 (75.00%), Postives = 443/504 (87.90%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            K+  A+   ++T+R+VKSVPFP SHR+T  EVFD +GKP +++LK H   EGR+ E  AL+IINEGA+IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YD+CM AFDCLPLAALMNQQFLCVHGGLSPEI T+DDI+K+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S E++SHN+VRGCSYF+SY A CDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ F+  + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G L+GGK++L +A+ G SP H I SFEEAK +D++NER+PPR+D +  N   +S+ +   +  N  D + N
Sbjct:    2 KMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVALRIINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLAGGKQTLQSAIRGFSPQHKISSFEEAKGLDRINERMPPRKDGV--NHVGHSMGKMNMSETNGTDDNSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ca (protein phosphatase 3, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-091113-24])

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 378/520 (72.69%), Postives = 442/520 (85.00%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALS----------------GISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            K+  A+   ++T+R+VKSVPFP SHR+T  EVFD +GKP +++LK H   EGR+ E  AL+IINEGA+IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YD+CM AFDCLPLAALMNQQFLCVHGGLSPEI T+DDI+K+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S E++SHN+VRGCSYF+SY A CDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ F+  + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G L+GGK++L +A                  G SP H I SFEEAK +D++NER+PPR+D +  N   +S+ +   +  N  D + N
Sbjct:    2 KMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVALRIINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLAGGKQTLQSATIEAIEAIEEEEDTEAIRGFSPQHKISSFEEAKGLDRINERMPPRKDGV--NHVGHSMGKMNMSETNGTDDNSN 519          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3cca (protein phosphatase 3, catalytic subunit, gamma isozyme, a [Source:ZFIN;Acc:ZDB-GENE-030829-36])

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 372/472 (78.81%), Postives = 425/472 (90.04%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1514
            +EK STTERI+K+VP PP  R+T  +++   GKPN E+LK H I EGR+ EDAAL+IIN+GANIL++EK +L++EAP TVCGDVHGQFFDLMKLFEVGG+P  TRYLFLGDYVDRGYFSIE VL+LW +KI +P T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM+AFDCLPLAAL+NQQFLCVHGGLSPEI+ +DDIRK+DRF+EPPA+GPMCDL+W+DP ED+G+E++ EH++HNSVRGCSYFFSYAA CDFL NNNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL+SE DD  EGG+ A RKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G LPLG LSGGK++L  A+ G SP   IR+FEEA+ +D++NER+PPR+D
Sbjct:    7 KEKLSTTERIIKTVPLPPHQRLTIKDLY-VDGKPNTELLKNHLIKEGRVEEDAALRIINDGANILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFSIECVLFLWTLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLCEGGAPAVRKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLPLGVLSGGKQTLQNAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 477          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3ccb (protein phosphatase 3, catalytic subunit, gamma isozyme, b [Source:ZFIN;Acc:ZDB-GENE-070112-1102])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 380/518 (73.36%), Postives = 438/518 (84.56%), Query Frame = 3
Query:   57 LIV*FNIISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT---------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            LIV F+   K     +K S TE +  SVP+PP+ R+T  E+++  GKP +E+LK H + EGRL ED AL+IIN+GANIL+ EK +L++EAP TVCGDVHGQFFDLMKLFEVGG+P  TRYLFLGDYVDRGYFSIE VLYLWA+KI +PTT FLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM+AFDCLPLAAL+NQQFLCVHGGLSPE+  +DDIRK+DRF+EPPA+GPMCDLLWSDP ED+G+E++ EH+ HNSVRGCSYF+SY A CDFL NNNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL+SE DDT EGG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G+LPLG LSGG+++L +         A+ G +P H I+SFEEA+ +D++NER+PPRRD    +   NSI      + N  +
Sbjct:    3 LIVPFSAAGK-----KKSSYTEHLSNSVPYPPTTRLTMKELYED-GKPKVELLKSHLVKEGRLEEDVALRIINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRGYFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKTSEHFCHNSVRGCSYFYSYPAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRDTKQPDGTANSINAANSPDKNGTN 514          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 371/510 (72.75%), Postives = 435/510 (85.29%), Query Frame = 3
Query:  114 TTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            T +  +K+VPFP SHR++  EVFD +GKP +++LK H   EGR+ E  AL+I+NEGA IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YDACM AFDCLPLAALMNQQFLCVHGGLSPEIHT+DDI+++DRF+EPPA+GPMCDLLWSDPLEDFGNE+S +++SHN+VRGCSYF+SY A C+FLQ NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ F+  + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G LSGGK++L +                A+ G SP H I SFEEAK +D++NER+PPRRD++  NS   S+ +     +N  D + N
Sbjct:    2 TAKGRLKAVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRVEEPVALRIVNEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQDYFSHNTVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVEEVKDGEAIRGFSPQHKITSFEEAKGLDRINERMPPRRDVV--NSVGLSMGKMNMAESNGTDDNSN 509          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 387/497 (77.87%), Postives = 443/497 (89.13%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            E K ST +R VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLED+GNE+S EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+SE +D  +G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    8 EAKLSTLDRAVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVSE-EDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 388/505 (76.83%), Postives = 443/505 (87.72%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSE---TDDTF-----EGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            E K ST +R VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLED+GNE+S EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+SE    DD       +G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    8 EAKLSTLDRAVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVSEEDACDDQLIYAQKKGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 512          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 387/504 (76.79%), Postives = 443/504 (87.90%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
            E K ST +R VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLED+GNE+S EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+SE +D  +G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N+V
Sbjct:    8 EAKLSTLDRAVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVSE-EDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNAV 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: mrps31 (mitochondrial ribosomal protein S31 [Source:Xenbase;Acc:XB-GENE-988773])

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 380/500 (76.00%), Postives = 442/500 (88.40%), Query Frame = 3
Query:   93 TAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDI 1592
            T + K STTER VKSVPFPP+HR+T  EVFD+ GKP ++ILK H I EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFDCLPLAAL+NQQFLCVHGGLSPEIHT+DDI+++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF+SY A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ G+ AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +A+ G SP H I SFEEAK +D++NER+PPR+D        NS+  + + NN + + ++
Sbjct:    3 TKDGKHSTTERAVKSVPFPPTHRLTSEEVFDTDGKPRVDILKNHLIKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDCLPLAALLNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGTAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPQHKICSFEEAKGLDRINERMPPRKD-TRQQDGINSVNTNAKENNGTGNNNV 501          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 380/485 (78.35%), Postives = 435/485 (89.69%), Query Frame = 3
Query:  135 SVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLED+GNE+S EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+SE +D  +G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:   13 AVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDYGNEKSQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELVSE-EDACDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 496          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 391/504 (77.58%), Postives = 448/504 (88.89%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 391/514 (76.07%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 370/488 (75.82%), Postives = 432/488 (88.52%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHTTENHGT 509          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 370/498 (74.30%), Postives = 432/498 (86.75%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +          A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHTTENHGT 519          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 370/498 (74.30%), Postives = 432/498 (86.75%), Query Frame = 3
Query:  117 TERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
             +R+VK+VPFPP+HR+T  EVFD  G P +++LK H + EGR+ E+ AL+IINEGA IL+ EK ++++EAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLW +KILYP+T FLLRGNHECRHLTEYFTFKQECKIKY+ER+Y+ACM+AFD LPLAAL+NQQFLCVHGGLSPEIHT+DDIR++DRF+EPPA+GPMCDLLWSDP EDFGNE+S EH+SHN+VRGCSYF++Y A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL++E +D F+ GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +          A+ G SP H I SFEEAK +D++NER+PPR+D +  +   NS+     T N+  
Sbjct:   23 ADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFD-GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGF-NSLNTAHTTENHGT 518          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P63329|PP2BA_RAT (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 391/514 (76.07%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P63328|PP2BA_MOUSE (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 391/514 (76.07%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q08209|PP2BA_HUMAN (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA PE=1 SV=1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 390/514 (75.88%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P48452|PP2BA_BOVIN (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PPP3CA PE=1 SV=1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 390/514 (75.88%), Postives = 448/514 (87.16%), Query Frame = 3
Query:   78 ISKIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1589
            +S+    + K STT+R+VK+VPFPPSHR+T  EVFD+ GKP ++ILK H + EGRL E  AL+II EGA+IL++EKN+LDI+AP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI+T+DDIRK+DRF+EPPAYGPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A C+FLQ+NNLLSI+RAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL SE +D F+G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +          A+ G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:    1 MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE-EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q27889|PP2B2_DROME (Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pp2B-14D PE=1 SV=2)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 385/500 (77.00%), Postives = 435/500 (87.00%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS-ETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS 1577
            K+       +T ER+V SVPFPPSH++T  EVFD + GKPN E+LKQHFILEGR+ E  ALKII +GA +L++EK ++DIEAP TVCGD+HGQF+DLMKLFEVGG+PA+T+YLFLGDYVDRGYFSIE VLYLW++KI YP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEIH ++DIR++DRF+EPPA+GPMCDLLWSDPLEDFGNE++ + Y+HNSVRGCSYF+SYAACCDFLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL++ E+++       A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL  A+ G SPNH I SF EAK +D VNER+PPRRD     S + + +  Q   N +
Sbjct:   68 KLHGGHTAVNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMTEESEEPLSDDEAALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSPNHKITSFAEAKGLDAVNERMPPRRDQPPTPSEDPNQHSQQGGKNGA 567          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A2C9K7B8 (Serine/threonine-protein phosphatase OS=Biomphalaria glabrata OX=6526 GN=106056819 PE=3 SV=1)

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 406/487 (83.37%), Postives = 454/487 (93.22%), Query Frame = 3
Query:   87 IMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETD-DTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENS 1544
            + T E K STTERI+KSVPFPPSHR++ +E FD+KGKP  +ILKQHFILEGR+ ED AL+IINEGA +L++EK ++DIEAP TVCGD+HGQFFDLMKLFEVGG PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM+AFDCLPL+ALMNQQFLCVHGGLSPEIHT+DDIRK+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SYAACCDFLQ NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+LNICSDDEL++E + D+ E   VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNG+LPLGALSGGK++L +ALSG SPNH I  FEEAK +DK+NER+PPR+D +++N+ E+S
Sbjct:    1 MATTENKMSTTERIIKSVPFPPSHRVSMSEAFDAKGKPRPDILKQHFILEGRVTEDVALRIINEGAALLRQEKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGPPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLSALMNQQFLCVHGGLSPEIHTLDDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSSEHFTHNTVRGCSYFYSYAACCDFLQQNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAEGEADSME---VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGLLPLGALSGGKDTLSSALSGFSPNHKISGFEEAKCLDKMNERMPPRKDAMSSNNKEHS 484          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A2C9K7B6 (Serine/threonine-protein phosphatase OS=Biomphalaria glabrata OX=6526 GN=106056819 PE=3 SV=1)

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 406/499 (81.36%), Postives = 455/499 (91.18%), Query Frame = 3
Query:   87 IMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETD-DTFEGGS------------VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENS 1544
            + T E K STTERI+KSVPFPPSHR++ +E FD+KGKP  +ILKQHFILEGR+ ED AL+IINEGA +L++EK ++DIEAP TVCGD+HGQFFDLMKLFEVGG PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM+AFDCLPL+ALMNQQFLCVHGGLSPEIHT+DDIRK+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SYAACCDFLQ NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+LNICSDDEL++E + D+ EG              +AARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNG+LPLGALSGGK++L +ALSG SPNH I  FEEAK +DK+NER+PPR+D +++N+ E+S
Sbjct:    1 MATTENKMSTTERIIKSVPFPPSHRVSMSEAFDAKGKPRPDILKQHFILEGRVTEDVALRIINEGAALLRQEKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGPPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLSALMNQQFLCVHGGLSPEIHTLDDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSSEHFTHNTVRGCSYFYSYAACCDFLQQNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAEGEADSMEGDGANKSKSQANFDLIAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGLLPLGALSGGKDTLSSALSGFSPNHKISGFEEAKCLDKMNERMPPRKDAMSSNNKEHS 499          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1C7D018 (Serine/threonine-protein phosphatase OS=Biomphalaria glabrata OX=6526 GN=106056819 PE=3 SV=1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 405/487 (83.16%), Postives = 453/487 (93.02%), Query Frame = 3
Query:   87 IMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETD-DTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENS 1544
            + T E K STTERI+KSVPFPPSHR++ +E FD+KGKP  +ILKQHFILEGR+ ED AL+IINEGA +L++EK ++DIEAP TVCGD+HGQFFDLMKLFEVGG PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM+AFDCLPL+ALMNQQFLCVHGGLSPEIHT+DDIRK+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SYAACCDFLQ NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+LNICSDDEL++E + D+ E    AARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNG+LPLGALSGGK++L +ALSG SPNH I  FEEAK +DK+NER+PPR+D +++N+ E+S
Sbjct:    1 MATTENKMSTTERIIKSVPFPPSHRVSMSEAFDAKGKPRPDILKQHFILEGRVTEDVALRIINEGAALLRQEKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGPPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMEAFDCLPLSALMNQQFLCVHGGLSPEIHTLDDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSSEHFTHNTVRGCSYFYSYAACCDFLQQNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAEGEADSME----AARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGLLPLGALSGGKDTLSSALSGFSPNHKISGFEEAKCLDKMNERMPPRKDAMSSNNKEHS 483          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A0B7A1S4 (Serine/threonine-protein phosphatase OS=Arion vulgaris OX=1028688 GN=ORF91545 PE=3 SV=1)

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 403/487 (82.75%), Postives = 451/487 (92.61%), Query Frame = 3
Query:   87 IMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETD-DTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENS 1544
            + T + K STTERI+KSVPFPPSHR++ NE FD+KGKP  ++LKQHFILEGR+ ED AL+IIN+GA +L++EK ++DIEAP TVCGD+HGQFFDLMKLFEVGG PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILY TTFFLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM AFDCLPL+ALMNQQFLCVHGGLSPEIHT++DIRK+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SYAACCDFLQ NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+LNICSDDEL+SE + D+ E   VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNG+LPLGALSGGK++L +ALSG SPNH I  FEEAK +DK+NER+PPR+D + +N+ E+S
Sbjct:    1 MATTDSKMSTTERIIKSVPFPPSHRVSMNEAFDAKGKPRPDVLKQHFILEGRVTEDVALRIINDGAALLRQEKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGPPASTRYLFLGDYVDRGYFSIECVLYLWALKILYSTTFFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMDAFDCLPLSALMNQQFLCVHGGLSPEIHTLEDIRKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSSEHFTHNTVRGCSYFYSYAACCDFLQQNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELISEGEADSME---VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGLLPLGALSGGKDTLSSALSGFSPNHKISGFEEAKCLDKMNERMPPRKDAVNSNNKEHS 484          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: B6RB22 (Serine/threonine-protein phosphatase OS=Haliotis discus discus OX=91233 PE=2 SV=1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 397/484 (82.02%), Postives = 446/484 (92.15%), Query Frame = 3
Query:   87 IMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNE 1538
            + T + K STTER+VKSVPFPPSHR+T +EVFD+KGKP  ++LKQHFILEGR+ ED AL+IINEGA +L++EK ++DIEAP TVCGD+HGQF+DLMKLFEVGG PATTRYLFLGDYVDRGYFS E VLYLWA++ILYP TFFLLRGNHECRHLTEYFTFKQECKIKYTER+YDACM++FDCLPLAALMNQQFLCVHGGLSPEIH + DIRK+DRF+EPPA+GPMCD+LWSDPLEDFGNE++ EH++HN+VRGCSYF+SYAACCDFLQ NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+LNICSDDEL++E DD+ E   VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNG+LPLGALSGGK++L +ALSG SP H I  FEEAK +DK+NER+PPR+D +   +N+
Sbjct:    1 MATTDGKLSTTERVVKSVPFPPSHRLTMSEVFDAKGKPKPDVLKQHFILEGRVTEDVALRIINEGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGPPATTRYLFLGDYVDRGYFSTECVLYLWALEILYPNTFFLLRGNHECRHLTEYFTFKQECKIKYTERVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHNLGDIRKLDRFKEPPAFGPMCDILWSDPLEDFGNEKTTEHFTHNTVRGCSYFYSYAACCDFLQQNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELMTEGDDSLE---VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGLLPLGALSGGKDTLKSALSGFSPTHKISGFEEAKCLDKLNERMPPRKDAVNQQNNK 481          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 382/502 (76.10%), Postives = 435/502 (86.65%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS--ETDDTF-----EGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            E K STT+R+VKSVPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQEC+IKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL +  E D        +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L  A+ G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:    9 EAKLSTTDRVVKSVPFPPSHRLTVKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEEIDGQLIYPPKKGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 382/505 (75.64%), Postives = 435/505 (86.14%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            E K STT+R+VKSVPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQEC+IKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL   TD+  +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L            A+ G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:    9 EAKLSTTDRVVKSVPFPPSHRLTVKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDEL--TTDEEIDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 511          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3cb (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like [Source:NCBI gene;Acc:103043949])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 377/504 (74.80%), Postives = 440/504 (87.30%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            K+  A    +  +R++KSVPFP SHR++  EVFD +GKP +++LK H   EGR+ E  AL+IINEGA IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YDACM AFDCLPLAALMNQQFLCVHGGLSPEIHT+DDI+K+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S E++SHN+VRGCSYF+SY A C+FLQ NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ ++  + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G LSGGK++L +A+ G SP H I SFEEAK +D++NER+PPRRD++  NS   S+ R     +N  D + N
Sbjct:    2 KMSNAVMGLNPADRVIKSVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRVEEPVALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIYDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSAIRGFSPQHKISSFEEAKGLDRINERMPPRRDVV--NSVGLSMGRMNMAESNGTDDNSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 382/512 (74.61%), Postives = 435/512 (84.96%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS--ETDDTF-----EGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            E K STT+R+VKSVPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQEC+IKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE++ EH++HN+VRGCSYF+SY A CDFLQ+NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL +  E D        +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L            A+ G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:    9 EAKLSTTDRVVKSVPFPPSHRLTVKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEEIDGQLIYPPKKGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp3cb (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like [Source:NCBI gene;Acc:103043949])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 377/520 (72.50%), Postives = 440/520 (84.62%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            K+  A    +  +R++KSVPFP SHR++  EVFD +GKP +++LK H   EGR+ E  AL+IINEGA IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YDACM AFDCLPLAALMNQQFLCVHGGLSPEIHT+DDI+K+DRF+EPPA+GPMCDLLWSDPLEDFGNE+S E++SHN+VRGCSYF+SY A C+FLQ NNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ ++  + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G LSGGK++L +                A+ G SP H I SFEEAK +D++NER+PPRRD++  NS   S+ R     +N  D + N
Sbjct:    2 KMSNAVMGLNPADRVIKSVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRVEEPVALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIYDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAIESVEDGEAIRGFSPQHKISSFEEAKGLDRINERMPPRRDVV--NSVGLSMGRMNMAESNGTDDNSN 519          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 365/494 (73.89%), Postives = 425/494 (86.03%), Query Frame = 3
Query:  129 VKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESL----------HTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1580
            + +VPFPPSHR+T  EVFDS  KP +++LK H + EGR+ ED AL+IIN+GA+IL+ EK ++DIEAP TVCGD+HGQFFDLMKLFEVGG+PA TRYLFLGDYVDRGYFSIE VLYLWA+KILYPTT FLLRGNHECRHLTEYFTFKQECKIKYTE +YDACM AFDCLPLAALMNQQFLCVHGGLSPE+H ++DIRK+DRF+EPPA+GPMCDLLWSDP EDFGNE++ E++ HN+VRGCSYF+SY A CDFLQNNNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL +E ++ F+  + AARKEVIRNKIRAIGKMA++F+VLR ESESVL LKGLTP G+LP G L+GG+++L          H A+ G +P   I SF EAK +D++NER+PPR+D ++ + + + +     T+ NS 
Sbjct:    1 LSAVPFPPSHRLTMKEVFDSDAKPRVDVLKNHLVKEGRVEEDVALRIINDGASILRREKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELTTEGEEAFDATATAARKEVIRNKIRAIGKMAKMFSVLRLESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAAFEAVEAHKAIKGFTPQQKITSFAEAKGLDRINERMPPRKDGVSPDGSPSIVNNSSITDGNST 494          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 216.083 bits (549), Expect = 6.549e-66
Identity = 108/275 (39.27%), Postives = 162/275 (58.91%), Query Frame = 3
Query:  240 RLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 1064
            +L E     +  +   I   +  +L++EAP  +CGD+HGQ++DL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP  FFLLRGNHE   +   + F  ECK +Y  +++      F+CLP+AA+++++  C HGGLSP++ +++ IR+I R  + P  G +CDLLWSDP      ++    +  N  RG S+ F       FL  ++L  I RAH+  + GY  + K Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:   11 QLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDP------DKDTMGWGEND-RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 271          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 210.305 bits (534), Expect = 4.905e-62
Identity = 116/259 (44.79%), Postives = 157/259 (60.62%), Query Frame = 3
Query:  333 TVCGDVHGQFFDLMKLFEVGGNPATTR-YLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGL-SPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMN--IRQFNCSPHP 1097
            TVCGD+HGQ+FDL+ +FE+ G P+ T  Y+F GD+VDRG +S+EV+L L+  K+LYP  F L+RGNHE  ++ + + F+ E K KYT +++D   + F  LPLA  +N + L +HGGL S +  T+DDIRKIDR R+PP  GPMCDLLWSDP    G  RS+      S RG S  F       F++ NNL  IIR+HE  D GY +    +       +T+FSAPNY D   NK + +      +     +F   PHP
Sbjct:  200 TVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKYTAQMFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQPQPG--RSV------SKRGVSCQFGPDVSRAFMEQNNLELIIRSHEKPD-GYEVAHDGRC------VTVFSAPNYCDQMGNKGSYIHLTAPALKPEFHEFAAVPHP 443          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 1.709e-60
Identity = 99/244 (40.57%), Postives = 146/244 (59.84%), Query Frame = 3
Query:  342 GDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGP---MCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 1064
            GD+HGQ+ DL++LFE GG P    YLFLGDYVDRG  S+E +  L A KI YP  FFLLRGNHEC  +   + F  ECK ++  +++      F+CLP+AA+++++  C HGGLSP++ +++ IR+I R  + P  G    +CDLLWSDP      ++ ++ +  N  RG S+ F       FL  ++L  I RAH+  + GY  + K Q      L+T+FSAPNY   ++N   ++  +  +M
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDP------DKDVQGWGEND-RGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGGMMSVDETLM 231          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 181.415 bits (459), Expect = 5.654e-54
Identity = 84/191 (43.98%), Postives = 124/191 (64.92%), Query Frame = 3
Query:  288 ILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFS 860
            I   +  +L++EAP  +CGD+HGQ+ DL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP  FFLLRGNHEC  +   + F  ECK ++  +++      F+CLP+AA+++++  C HGGLSP++ +++ IR+I R  + P  G +CDLLWSDP      ++ ++ +  N  RG S+ F 
Sbjct:   31 IFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDP------DKDVQGWGEND-RGVSFTFG 214          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: CNA1 (Calcineurin A; one isoform (the other is Cmp2p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CNA1 has a paralog, CMP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004425])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 268/498 (53.82%), Postives = 353/498 (70.88%), Query Frame = 3
Query:  111 STTERIVKSVPFPPSHRMTYNEVFDSK-GKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNER-------SMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAA-------------------------RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPP 1505
            ST +R + SVP       +  EVFDSK G PN   L++HF  EGRL+++ A+KI+N     L +E N+L ++AP T+CGD+HGQ++DL+KLFEVGG+PA   YLFLGDYVDRG FS E ++YL+++K+     F++LRGNHEC+HLT YFTFK E   KY   +YDAC ++F+ LPLAALMN Q+ CVHGG+SPE+ +++D+ KI+RFRE P+ G MCDLLW+DP+E++ + R       S + +  NS+RGCS+ F++ A C FL+ N LLSIIRAHEAQD GYRMY+ ++VTGFPSLIT+FSAPNYLD Y+NKAA+LKYE NVMNIRQF+ SPHPYWLP+FMDVFTWS+PFVGEKVT MLV++LNICS+ EL  E++      +V A                         R++ +RNKI AI K++R+F+VLREESE V  LK +   GVLP GAL+ G E L+  LS         +FE+A+  D +NE++PP
Sbjct:   40 STKDRPIASVPAITGKIPSDEEVFDSKTGLPNHSFLREHFFHEGRLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDYVDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNVLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFDQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMFSAPNYLDTYHNKAAVLKYEENVMNIRQFHMSPHPYWLPDFMDVFTWSLPFVGEKVTSMLVSILNICSEQELDPESEPKAAEETVKARANATKETGTPSDEKASSAILEDETRRKALRNKILAIAKVSRMFSVLREESEKVEYLKTMNA-GVLPRGALARGTEGLNETLS---------TFEKARKEDLINEKLPP 527          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: CMP2 (Calcineurin A; one isoform (the other is Cna1p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CMP2 has a paralog, CNA1, that arose from the whole genome duplication [Source:SGD;Acc:S000004521])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 274/534 (51.31%), Postives = 353/534 (66.10%), Query Frame = 3
Query:  111 STTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFG-------------NERSM-----------EHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFE-----------GGSVAA-------------------RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIY 1550
            ST  RI+  VP   SH  T  E+F   G P  E L+ HF  EG+L+   A +I+     +  +E N++ + AP TVCGD+HGQ+FDL+KLFEVGG+PATT YLFLGDYVDRG FS E ++YL+++K+ +   F+LLRGNHEC+HLT YFTFK E   KY   IY+ C ++F+ LPLAALMN Q+LCVHGG+SPE++++ DI  ++RFRE P++G MCDLLW+DP+E++              N ++M           + +  NSVRGCSY F+Y A C FLQ   LLSIIRAHEAQD GYRMY+ ++  GFPSL+T+FSAPNYLD YNNKAAILKYENNVMNIRQFN +PHPYWLP+FMDVFTWS+PFVGEKVTEMLV +LNIC++DEL ++T    E           G S A                    R++ +RNKI A+ K++R+++VLREE+  V  LK    +GVLP GALS G + L  ALS         +FE A+  D +NE++PP  D +    NEN  Y
Sbjct:   66 STNRRIMNKVPAITSHVPTDEELFQPNGIPRHEFLRDHFKREGKLSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTSYLFLGDYVDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKCCESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVLDKDLTEEDIVNSKTMVPHHGKMAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAHEAQDAGYRMYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAILKYENNVMNIRQFNMTPHPYWLPDFMDVFTWSLPFVGEKVTEMLVAILNICTEDELENDTPVIEELVGTDKKLPQAGKSEATPQPATSASPKHASILDDEHRRKALRNKILAVAKVSRMYSVLREETNKVQFLKDHN-SGVLPRGALSNGVKGLDEALS---------TFERARKHDLINEKLPPSLDEL---KNENKKY 586          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 228.024 bits (580), Expect = 7.366e-70
Identity = 122/280 (43.57%), Postives = 166/280 (59.29%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQF 1079
            L+ED   ++     ++L+ E+NV  I  P T+CGDVHGQF DL++LF++GG    T YLF+GDYVDRGY+S+E V YL AMK+ YP    +LRGNHE R +T+ + F  EC  KY +  ++      FD  P+ AL++ +  C+HGGLSP I TID +R+++R +E P  GPMCDLLWSDP +D G           S RG  + F       F   N+L  I RAH+    GY    +  V      +TIFSAPNY     N+AAI++ + N  + RQF
Sbjct:   83 LSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDP-DDRGGWGI-------SPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNV------VTIFSAPNYCYRCGNQAAIMEVDEN--HNRQF 346          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 225.713 bits (574), Expect = 9.464e-70
Identity = 107/274 (39.05%), Postives = 171/274 (62.41%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 1064
            L E+    + ++  +I  ++  +L++EAP  +CGD+HGQ++DL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP  FF+LRGNHEC  +   + F  ECK +Y  +++      F+CLP+AA+++++  C+HGGLSP++++++ IR++ R  + P  G +CDLLWSDP      ++ +  +S N  RG S+ F       FLQ  ++  I RAH+  + GY  + K Q      L+T+FSAPNY   ++N  A++  + +++
Sbjct:   29 LEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDP------DKDIVGWSEND-RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQ------LVTLFSAPNYCGEFDNAGAMMSVDESLL 289          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 226.868 bits (577), Expect = 2.622e-69
Identity = 122/280 (43.57%), Postives = 165/280 (58.93%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQF 1079
            L+ED   ++     ++L+ E+NV  I  P T+CGDVHGQF DL++LF++GG    T YLF+GDYVDRGY+S+E V YL AMK+ YP    +LRGNHE R +T+ + F  EC  KY +  ++      FD  P+ AL++ +  C+HGGLSP I TID +R ++R +E P  GPMCDLLWSDP +D G           S RG  + F       F   N+L  I RAH+    GY    +  V      +TIFSAPNY     N+AAI++ + N  + RQF
Sbjct:   91 LSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWSDP-DDRGGWGI-------SPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNV------VTIFSAPNYCYRCGNQAAIMEVDEN--HNRQF 354          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 348/458 (75.98%), Postives = 407/458 (88.86%), Query Frame = 3
Query:  144 FPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDI 1517
             PP +R+T  +V+DS GKP  ++LK HFILEGR+ ++ ALKIIN+G  IL++EK +L+++AP TVCGD+HGQF+DL+KLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW +K LY  T FLLRGNHECRHLTEYFTFK ECKIKY+E +YDACM++FDCLPLAALMNQQFLCVHGGLSPEIHT+DD++K+DRF+EPPA+GPMCDLLWSDPLED+GNE++ EH+SHN+VRGCSYF+SY A C+FLQNNNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVN+L+IC+D+EL    +D  +  ++  RKE+IR+KIRAIGKMARVFTVLREESES+LQLKGLTP G LP+G LSGGK+ +  AL G  P H I  FEEAK +D+VNER+PPR+D+
Sbjct:    1 MPPVNRLTMADVYDSNGKPRADVLKAHFILEGRVEDEVALKIINDGTAILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILSICTDEELEDGDEDEEKTEAL-KRKEIIRSKIRAIGKMARVFTVLREESESILQLKGLTPTGHLPVGLLSGGKQEVQAALQGHDPTHKISGFEEAKGLDRVNERMPPRKDM 457          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 226.098 bits (575), Expect = 1.609e-69
Identity = 126/307 (41.04%), Postives = 170/307 (55.37%), Query Frame = 3
Query:  177 VFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNV-MNIRQFNCSP 1091
            V D     ++E+  +  +   +L E     +  +   IL +E NV +++ P TVCGDVHGQF DLM+LF +GG    T YLF+GDYVDRGY+S+E V  L  +K+ +P    +LRGNHE R +T+ + F  EC  KY    ++      FD LPL AL++ Q  C+HGGLSP I T+D IR +DR +E P  GPMCDLLWSDP +D G           S RG  Y F       F   N L  I RAH+    GY       V      +TIFSAPNY     N+AAI++ ++ +  +  QF+ +P
Sbjct:    2 VDDKTTAKDLEVWIEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDP-DDRGGWGI-------SPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNV------VTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAP 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 225.328 bits (573), Expect = 6.621e-69
Identity = 106/252 (42.06%), Postives = 158/252 (62.70%), Query Frame = 3
Query:  309 VLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVM 1064
            +L++EAP  +CGD+HGQ++DL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP  FFLLRGNHEC  +   + F  ECK +Y  +++      F+CLP+AA+++++  C HGGLSP++ +++ IR+I R  + P  G +CDLLWSDP      ++ ++ +  N  RG S+ F       FL  ++L  I RAH+  + GY  + K Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:   52 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDP------DKDVQGWGEND-RGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 290          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 220.32 bits (560), Expect = 2.816e-67
Identity = 115/276 (41.67%), Postives = 164/276 (59.42%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTE-RIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDP--LEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNV 1061
            + E    ++  +   IL EE NV  +++P TVCGD+HGQF+DL +LF+VGG+   T YLF+GD+VDRG++S+E  L L A+K+ YP    L+RGNHE R +T+ + F  EC  KY    ++  C + FD L L+A+++ +  CVHGGLSP I T+D IR IDR +E P  GPMCDLLWSDP  ++ +G           S RG  Y F       +   N++  I RAH+    GY+ +    V      +T++SAPNY     N AAIL+ + ++
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPEDIQGWG----------VSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETV------LTVWSAPNYCYRCGNVAAILELDEHL 279          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO38434 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SD13])

HSP 1 Score: 154.836 bits (390), Expect = 2.808e-44
Identity = 74/161 (45.96%), Postives = 102/161 (63.35%), Query Frame = 3
Query:  243 LAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKY-TERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKI 722
            L E+   K+ +    +L EE NV  + +P TVCGD+HGQF+DL +LF  GG    T Y+F+GD+VDRGY+S+E    L  +K  +P    LLRGNHE R +T+ + F  EC+ KY     +  C + FD L +AA+++ Q LCVHGGLSP+I TID +  I
Sbjct:   17 LPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANAWRYCCKVFDLLTVAAIIDGQVLCVHGGLSPDIKTIDQVSAI 177          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000042449.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 381/492 (77.44%), Postives = 431/492 (87.60%), Query Frame = 3
Query:  108 FSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            FS +  +V +VPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SY A CDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL   TD+  +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L  A+ G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:   52 FSWSFMVVPAVPFPPSHRLTAKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKSQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDEL--TTDEELDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 541          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000036835.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 381/492 (77.44%), Postives = 431/492 (87.60%), Query Frame = 3
Query:  108 FSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            FS +  +V +VPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SY A CDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL   TD+  +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L  A+ G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:   71 FSWSFMVVPAVPFPPSHRLTAKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKSQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDEL--TTDEELDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 560          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000006588.3 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 386/512 (75.39%), Postives = 435/512 (84.96%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLS--ETDDTF-----EGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT----------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1583
            E   STT+R+VKSVPFPPSHR+T  EVFDS GKP +++LK H   EGR+ E  AL++I EGA IL+ EKN+LDIEAP TVCGD+HGQFFDLMKLFEVGG+PA+TRYLFLGDYVDRGYFSIE VLYLWA+KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM AFDCLPLAALMNQQFLCVHGGLSPEI  +DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE+S EH++HN+VRGCSYF+SY A CDFLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICS+DEL +  E D        +G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L            A+ G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:    9 EPTLSTTDRVVKSVPFPPSHRLTAKEVFDSDGKPKVDVLKAHLTKEGRVEESVALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKSQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDELTTDEELDGQLIYAPKKGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp3ca (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101168142])

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 374/504 (74.21%), Postives = 440/504 (87.30%), Query Frame = 3
Query:   84 KIMTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1595
            K+  A+   + T+R+VKSVPFP SHR+T  EVFD +GKP +++LK H   EGR+ E  AL+IINEGA IL++EK +LDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIE VLYLW++KILYP T FLLRGNHECRHLTEYFTFKQECKIKY+E++YD+CM AFDCLPLAALMNQQFLCVHGGLSPEI T+DDI+K+DRF+EPPA+GPMCDLLWSDPLEDFGNE++ E++SHN+VRGCSYF+SY A C+FLQ+NNLLSIIRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVL+ICSDDEL+++ D+ F+  + A RKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G LSGG+++L +A+ G SP H I SFEEAK +D++NER+PPR+D +  N   NS+ +   +  N  + + N
Sbjct:    2 KMSNADIVLNPTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEEPVALRIINEGAAILRQEKTILDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKTQEYFSHNTVRGCSYFYSYPAVCEFLQSNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDEDEIFDANAAAQRKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGRQTLQSAIRGFSPQHKITSFEEAKGLDRINERMPPRKDGV--NHVGNSMGKMNMSEANGTEDNSN 503          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp3cca (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform [Source:NCBI gene;Acc:101172250])

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 367/468 (78.42%), Postives = 427/468 (91.24%), Query Frame = 3
Query:  111 STTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1514
            STTER +K+VP+PP H++T  E+F+  GKPN E+L+ H + EGR+ ED ALKI+N+GANIL++EK +L++EAP TVCGDVHGQF+DLMKLFEVGG+P+ TRYLFLGDYVDRGYFSIE VLYLW++KI +PTT FLLRGNHECRHLTEYFTFKQECKIKY+ER+YDACM+AFDCLPLAAL+NQQFLCVHGGLSPEI+ +DDIRK+DRF+EPPA+GPMCDL+W+DP ED+G+E++ EH++HNSVRGCSYFFSYAA CDFL NNNLLS+IRAHEAQD GYRMYRKSQ TGFPSLITIFSAPNYLDVYNNKAA+LKYENNVMNIRQFNCSPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNICSDDEL+SE DD +EGG+ A RKEVIRNKIRA+GKMARVF+VLREESESVL LKGLTP G LP+G LSGGK++L  A+ G SP   IR+FEEA+ +D++NER+PPR+D
Sbjct:   15 STTERPIKTVPYPPQHKLTIKELFED-GKPNSEVLRNHLVKEGRVEEDVALKIVNDGANILRQEKCMLEVEAPVTVCGDVHGQFYDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTSEHFNHNSVRGCSYFFSYAAVCDFLVNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLYEGGTSAMRKEVIRNKIRAVGKMARVFSVLREESESVLTLKGLTPTGTLPVGVLSGGKQTLENAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 481          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 514/514 (100.00%), Postives = 514/514 (100.00%), Query Frame = 3
Query:   90 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFXXXXXXXXHA 1631
            MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA
Sbjct:    1 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA 514          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 514/520 (98.85%), Postives = 514/520 (98.85%), Query Frame = 3
Query:   90 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFE------GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFXXXXXXXXHA 1631
            MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFE      GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA
Sbjct:    1 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEDQSKNPGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA 520          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000077398.1 (SMESG000077398.1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 415/475 (87.37%), Postives = 451/475 (94.95%), Query Frame = 3
Query:   90 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1514
            M+   K S TER+VKSVPFPPSHR+T  EVFD+KGKPNM+ L+QHF+LEG + ED ALKII+EGA++LK EK VLDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIEVVLYLWA+K+LYPTT +LLRGNHECRHLTEYFTFKQECKIKYTERIYDACM+AFDCLPLAALMNQQFLCVHGGLSP+IHT+DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE++ EH+ HNSVRGCSYFFSY ACCDFLQNNN+LSIIRAHEAQD GYRMYRK+Q TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDEL+ E+DD+FEG +VAARKEVI+NKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLH+ALSG++PNH I SFEEAKAIDKVNERVPPR++
Sbjct:    1 MSLPNKISATERVVKSVPFPPSHRLTIQEVFDNKGKPNMDKLRQHFLLEGCVTEDVALKIISEGASLLKSEKTVLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIEVVLYLWALKLLYPTTLYLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMEAFDCLPLAALMNQQFLCVHGGLSPDIHTLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTSEHFCHNSVRGCSYFFSYPACCDFLQNNNILSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELVLESDDSFEGTNVAARKEVIKNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHSALSGVNPNHRITSFEEAKAIDKVNERVPPRKE 475          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000077398.1 (SMESG000077398.1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 414/482 (85.89%), Postives = 450/482 (93.36%), Query Frame = 3
Query:   90 MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGG-------SVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1514
            M+   K S TER+VKSVPFPPSHR+T  EVFD+KGKPNM+ L+QHF+LEG + ED ALKII+EGA++LK EK VLDIEAP TVCGD+HGQFFDLMKLFEVGG+PATTRYLFLGDYVDRGYFSIEVVLYLWA+K+LYPTT +LLRGNHECRHLTEYFTFKQECKIKYTERIYDACM+AFDCLPLAALMNQQFLCVHGGLSP+IHT+DDIRK+DRF+EPPAYGPMCDLLWSDPLEDFGNE++ EH+ HNSVRGCSYFFSY ACCDFLQNNN+LSIIRAHEAQD GYRMYRK+Q TGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDEL+ E+DD+FE         +VAARKEVI+NKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLH+ALSG++PNH I SFEEAKAIDKVNERVPPR++
Sbjct:    1 MSLPNKISATERVVKSVPFPPSHRLTIQEVFDNKGKPNMDKLRQHFLLEGCVTEDVALKIISEGASLLKSEKTVLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIEVVLYLWALKLLYPTTLYLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMEAFDCLPLAALMNQQFLCVHGGLSPDIHTLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTSEHFCHNSVRGCSYFFSYPACCDFLQNNNILSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELVLESDDSFEENIRPALCTNVAARKEVIKNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHSALSGVNPNHRITSFEEAKAIDKVNERVPPRKE 482          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000012014.1 (SMESG000012014.1)

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 368/513 (71.73%), Postives = 446/513 (86.94%), Query Frame = 3
Query:   99 EEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEGRLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEVGGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECRHLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSPEIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVRGCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSIPFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISPNHVIRSFEEAKAIDKVNERVPPRR-------------DIITANSNENSIYRHQQTNNNSVDQDINT 1598
            + + STT+R V+SVPFPPS+++T  +VFDSKGKP ++ LK HF+LEGR++ED AL++INEG  +L+ E+ +LDIEAP TVCGD+HGQFFDLMKL EVGGNPATTRYLFLGDYVDRGY+SIEVVLYLW++K+LYP T  LLRGNHECRHLTEYFTFKQECKIKY+E++Y+ACM+AFDCLPLAAL+N QFLCVHGG+SPE H++DDIR++DRF+EPPA+GPMCDLLWSDP+EDFG ER+ E++ HNSVRGCSYF++Y A C FLQ NNLL +IRAHEAQD GYRMYR++Q TGFPSLITIFSAPNYLD YNNKAAILKYENNVMNIRQFN SPHPYWLPNFMDVFTWS+PFVGEKVTEMLVNVLNIC+DDEL++E DD  E  ++AAR++VI+NKIRAIGKMARVFTVLREESES+L+LKGLTPNG+LP+G L+GGK+S+H A++G+SP+H I+SFEEAK +D+VNER+PPRR              I  +++  +SIY  Q +  N+VD   ++
Sbjct:    5 KHQISTTDRAVESVPFPPSNKLTMTDVFDSKGKPQLDRLKTHFLLEGRVSEDVALRLINEGGALLRRERTMLDIEAPVTVCGDIHGQFFDLMKLLEVGGNPATTRYLFLGDYVDRGYYSIEVVLYLWSLKLLYPNTLHLLRGNHECRHLTEYFTFKQECKIKYSEKVYEACMEAFDCLPLAALINGQFLCVHGGISPEFHSLDDIRRLDRFKEPPAFGPMCDLLWSDPIEDFGQERTSENFLHNSVRGCSYFYTYQAVCKFLQANNLLCVIRAHEAQDAGYRMYRRNQATGFPSLITIFSAPNYLDAYNNKAAILKYENNVMNIRQFNSSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICTDDELVTEEDDPAEAAAIAARRDVIKNKIRAIGKMARVFTVLREESESLLELKGLTPNGMLPMGLLTGGKDSIHGAMTGVSPHHPIQSFEEAKVLDQVNERMPPRRPSYPINSKILASPSIAQSSAGTDSIY--QASPINAVDSSASS 515          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3CA0.000e+077.38protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA0.000e+075.88protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CB0.000e+075.82protein phosphatase 3 catalytic subunit beta [Sour... [more]
PPP3CB0.000e+074.30protein phosphatase 3 catalytic subunit beta [Sour... [more]
PPP3CB0.000e+074.30protein phosphatase 3 catalytic subunit beta [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-60.000e+075.77Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-60.000e+074.70Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-60.000e+074.25Serine/threonine-protein phosphatase 2B catalytic ... [more]
pph-4.13.703e-7045.26Serine/threonine-protein phosphatase 4 catalytic s... [more]
pph-4.25.270e-7045.35Serine/threonine-protein phosphatase 4 catalytic s... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp2B-14D0.000e+077.00gene:FBgn0011826 transcript:FBtr0305593[more]
Pp2B-14D0.000e+077.00gene:FBgn0011826 transcript:FBtr0309793[more]
Pp2B-14D0.000e+077.00gene:FBgn0011826 transcript:FBtr0074294[more]
CanA-14F0.000e+078.31gene:FBgn0267912 transcript:FBtr0305198[more]
CanA-14F0.000e+078.31gene:FBgn0267912 transcript:FBtr0074292[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3ca0.000e+075.00protein phosphatase 3, catalytic subunit, alpha is... [more]
ppp3ca0.000e+072.69protein phosphatase 3, catalytic subunit, alpha is... [more]
ppp3cca0.000e+078.81protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3ccb0.000e+073.36protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3cb0.000e+072.75protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rai10.000e+077.87retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai10.000e+076.83retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai10.000e+076.79retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
mrps310.000e+076.00mitochondrial ribosomal protein S31 [Source:Xenbas... [more]
rai10.000e+078.35retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp3ca0.000e+077.58protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3ca0.000e+076.07protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3cb0.000e+075.82protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3cb0.000e+074.30protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3cb0.000e+074.30protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63329|PP2BA_RAT0.000e+076.07Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P63328|PP2BA_MOUSE0.000e+076.07Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q08209|PP2BA_HUMAN0.000e+075.88Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P48452|PP2BA_BOVIN0.000e+075.88Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q27889|PP2B2_DROME0.000e+077.00Serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K7B80.000e+083.37Serine/threonine-protein phosphatase OS=Biomphalar... [more]
A0A2C9K7B60.000e+081.36Serine/threonine-protein phosphatase OS=Biomphalar... [more]
A0A1C7D0180.000e+083.16Serine/threonine-protein phosphatase OS=Biomphalar... [more]
A0A0B7A1S40.000e+082.75Serine/threonine-protein phosphatase OS=Arion vulg... [more]
B6RB220.000e+082.02Serine/threonine-protein phosphatase OS=Haliotis d... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3CA0.000e+076.10protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA0.000e+075.64protein phosphatase 3 catalytic subunit alpha [Sou... [more]
ppp3cb0.000e+074.80serine/threonine-protein phosphatase 2B catalytic ... [more]
PPP3CA0.000e+074.61protein phosphatase 3 catalytic subunit alpha [Sou... [more]
ppp3cb0.000e+072.50serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3cb0.000e+073.89protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp1cab6.549e-6639.27protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp5c4.905e-6244.79protein phosphatase 5, catalytic subunit [Source:Z... [more]
ENSPMAT00000010086.11.709e-6040.57pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb5.654e-5443.98protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CNA10.000e+053.82Calcineurin A; one isoform (the other is Cmp2p) of... [more]
CMP20.000e+051.31Calcineurin A; one isoform (the other is Cna1p) of... [more]
PPH217.366e-7043.57Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
GLC79.464e-7039.05Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPH222.622e-6943.57Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362720.000e+075.98Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297591.609e-6941.04Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446486.621e-6942.06Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499362.816e-6741.67Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO384342.808e-4445.96Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042449.10.000e+077.44serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000036835.10.000e+077.44serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000006588.30.000e+075.39serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3ca0.000e+074.21serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3cca0.000e+078.42serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064848.10.000e+0100.00SMESG000064848.1[more]
SMESG000064848.10.000e+098.85SMESG000064848.1[more]
SMESG000077398.10.000e+087.37SMESG000077398.1[more]
SMESG000077398.10.000e+085.89SMESG000077398.1[more]
SMESG000012014.10.000e+071.73SMESG000012014.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030287 ID=SMED30030287|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1717bp
TTCATGGAGGCGTCAATAGCAACAATTTAATTTTTTATTACTGATTTTAA
AATTTACTTATTGTTTAATTCAATATTATTTCTAAAATAATGACCGCAGA
AGAAAAATTTTCAACGACAGAAAGAATTGTCAAAAGTGTTCCGTTTCCCC
CTAGTCATAGAATGACATACAATGAAGTTTTTGATTCAAAAGGCAAGCCA
AATATGGAGATTTTAAAACAACATTTCATTCTTGAAGGCCGGCTTGCTGA
GGACGCTGCATTGAAAATAATAAACGAAGGTGCAAATATTTTAAAGGAAG
AAAAAAATGTTTTGGATATAGAAGCCCCAGCTACTGTTTGTGGTGATGTA
CATGGCCAGTTCTTTGATTTGATGAAATTATTTGAAGTAGGCGGAAATCC
TGCTACGACACGATATCTATTTCTCGGAGATTATGTTGATAGAGGATATT
TCAGTATCGAAGTTGTTTTATATCTCTGGGCTATGAAAATTCTTTACCCA
ACAACTTTCTTCCTTCTACGAGGAAATCACGAATGCAGACATCTTACAGA
ATATTTTACCTTCAAACAAGAATGCAAAATCAAATACACTGAACGGATTT
ATGATGCATGCATGCAAGCTTTCGATTGCCTACCGTTAGCGGCCTTAATG
AACCAGCAGTTTCTCTGTGTACATGGCGGATTGTCCCCAGAAATTCATAC
TATTGATGACATACGAAAGATAGATAGGTTTCGAGAACCTCCTGCTTATG
GTCCTATGTGTGATTTATTATGGTCAGACCCTCTTGAAGATTTTGGAAAT
GAACGATCTATGGAACATTATAGCCATAATAGTGTTAGAGGATGCTCATA
TTTTTTCAGTTATGCTGCTTGTTGTGATTTTTTGCAAAATAATAATCTCT
TATCAATTATTCGAGCTCACGAGGCACAAGATACCGGATACCGAATGTAC
AGAAAAAGCCAGGTTACTGGATTTCCATCTCTAATCACTATTTTTAGTGC
CCCGAATTATTTAGACGTTTATAATAACAAAGCTGCTATCCTCAAATATG
AAAACAACGTCATGAATATCAGACAATTCAACTGTTCTCCTCATCCATAT
TGGTTACCTAATTTTATGGATGTGTTCACATGGTCAATACCATTTGTTGG
AGAAAAGGTGACAGAAATGTTGGTGAATGTACTGAATATATGCTCTGATG
ATGAGCTTCTATCAGAGACCGATGACACTTTTGAAGGTGGCAGCGTCGCA
GCCAGAAAGGAAGTAATCAGAAATAAAATCCGAGCAATTGGAAAGATGGC
TCGGGTATTTACTGTGCTAAGAGAAGAGAGCGAATCTGTTTTACAATTAA
AAGGTTTAACTCCTAATGGAGTATTGCCTTTAGGTGCTTTATCAGGAGGA
AAGGAATCTCTTCATACTGCTCTTTCTGGAATATCACCAAATCACGTAAT
TCGATCATTTGAAGAAGCAAAGGCAATTGATAAAGTCAACGAAAGAGTGC
CTCCGAGGCGCGACATCATCACAGCGAATAGCAATGAGAACTCGATCTAC
CGCCATCAGCAAACCAATAACAATTCTGTGGATCAAGATATTAATACTTT
CAGAAATAACTCGTCTTCAAGTCGGCATGCATAATAATACTTGCAAAATC
CAAAATTTATTATTATCATCTTCAATATCGATATTATTATTACTATTATT
ATCGTCTATTTTCAATC
back to top

protein sequence of SMED30030287-orf-1

>SMED30030287-orf-1 ID=SMED30030287-orf-1|Name=SMED30030287-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MTAEEKFSTTERIVKSVPFPPSHRMTYNEVFDSKGKPNMEILKQHFILEG
RLAEDAALKIINEGANILKEEKNVLDIEAPATVCGDVHGQFFDLMKLFEV
GGNPATTRYLFLGDYVDRGYFSIEVVLYLWAMKILYPTTFFLLRGNHECR
HLTEYFTFKQECKIKYTERIYDACMQAFDCLPLAALMNQQFLCVHGGLSP
EIHTIDDIRKIDRFREPPAYGPMCDLLWSDPLEDFGNERSMEHYSHNSVR
GCSYFFSYAACCDFLQNNNLLSIIRAHEAQDTGYRMYRKSQVTGFPSLIT
IFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSI
PFVGEKVTEMLVNVLNICSDDELLSETDDTFEGGSVAARKEVIRNKIRAI
GKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTALSGISP
NHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD
INTFRNNSSSSRHA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041751MPP_PP2B
IPR006186Ser/Thr-sp_prot-phosphatase
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 205..232
score: 53.12
coord: 109..136
score: 63.5
coord: 269..289
score: 38.78
coord: 176..202
score: 54.31
coord: 80..107
score: 56.74
coord: 142..166
score: 54.4
coord: 297..313
score: 57.46
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 52..343
e-value: 8.2E-155
score: 530.3
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 143..148
NoneNo IPR availablePIRSFPIRSF033096PPPtase_5coord: 27..343
e-value: 2.0E-85
score: 284.7
NoneNo IPR availablePANTHERPTHR45673:SF2SERINE/THREONINE-PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT GAMMA ISOFORMcoord: 4..496
NoneNo IPR availablePANTHERPTHR45673FAMILY NOT NAMEDcoord: 4..496
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 11..484
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 82..280
e-value: 1.6E-37
score: 130.0
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 3..422
e-value: 1.8E-181
score: 605.2
IPR041751PP2B, metallophosphatase domainCDDcd07416MPP_PP2Bcoord: 37..341
e-value: 0.0
score: 674.792