Tctex1 domain containing 2

Overview
NameTctex1 domain containing 2
Smed IDSMED30030286
Length (bp)490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tctex1 domain containing 2 (SMED30030286) t-SNE clustered cells

Violin plots show distribution of expression levels for Tctex1 domain containing 2 (SMED30030286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tctex1 domain containing 2 (SMED30030286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tctex1 domain containing 2 (SMED30030286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030286h1SMcG0003228 SmedASXL_004962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30030286h1SMcG0003228 dd_Smed_v6_7666_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030286h1SMcG0003228 dd_Smed_v4_7666_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 117.472 bits (293), Expect = 8.735e-34
Identity = 49/108 (45.37%), Postives = 75/108 (69.44%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+ MA+RC+WD+D+DN  H+ FMN+SL C+
Sbjct:   27 NTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCV 133          
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 74.3294 bits (181), Expect = 4.430e-17
Identity = 33/80 (41.25%), Postives = 52/80 (65.00%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGI 355
            NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+
Sbjct:   27 NTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGV 105          
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Match: AC069257.4 (novel protein)

HSP 1 Score: 73.559 bits (179), Expect = 4.687e-17
Identity = 33/80 (41.25%), Postives = 52/80 (65.00%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGI 355
            NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+
Sbjct:   27 NTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGV 105          
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 51.9878 bits (123), Expect = 3.161e-8
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY + P   + F  +  N I+K+++   L    Y  E    +TK +S E++   V  L + RYK+ + V I +   Q I + +RC WD  SD      F N+SL  +
Sbjct:   66 NTYQLGPP--KHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTIS-EVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFAL 170          
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Match: TCTEX1D4 (Tctex1 domain containing 4 [Source:HGNC Symbol;Acc:HGNC:32315])

HSP 1 Score: 50.447 bits (119), Expect = 1.477e-7
Identity = 30/115 (26.09%), Postives = 54/115 (46.96%), Query Frame = 2
Query:   95 VPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
             P + V  +Y   P   +++   +A   ++  L   L D  Y+++E + L +EL +++   L  +L   RYK+   VV+     QG+ + +R  WD   D     S+ N SL  +
Sbjct:   99 APARWVAPSYRTEPVPGERWEAARAQRALEAALAAGLHDACYSSDEAARLVRELCEQVHVRL-RELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAV 212          
BLAST of Tctex1 domain containing 2 vs. Ensembl Celegans
Match: dylt-2 (DYnein Light chain (Tctex type) [Source:UniProtKB/TrEMBL;Acc:Q18917])

HSP 1 Score: 81.6481 bits (200), Expect = 1.816e-20
Identity = 41/106 (38.68%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  122 YVIRPSFNQKFRPLKANIIVKEILKEKLSDIT-YNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLIC 436
            +V+RP+  QKFRP     +++EIL EKL  +T YN +E   ++K++S  +   L   LQL RYK  IQ +IAE    G   A +C WD D D  + + ++  S+ C
Sbjct:    9 FVLRPTPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERL-KGLQLPRYKYVIQTMIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWC 113          
BLAST of Tctex1 domain containing 2 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0306611)

HSP 1 Score: 72.7886 bits (177), Expect = 1.869e-16
Identity = 37/119 (31.09%), Postives = 61/119 (51.26%), Query Frame = 2
Query:   83 KKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +K++ P  D    Y +RP+F + F       I+  ++ EKL D TY+ +     T E++ E+   + S   ++RYK  +QV++ +    G    +RC WD D D  + E F N SL C+
Sbjct:   47 EKSEKPG-DQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCV 164          
BLAST of Tctex1 domain containing 2 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0082215)

HSP 1 Score: 72.7886 bits (177), Expect = 1.869e-16
Identity = 37/119 (31.09%), Postives = 61/119 (51.26%), Query Frame = 2
Query:   83 KKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +K++ P  D    Y +RP+F + F       I+  ++ EKL D TY+ +     T E++ E+   + S   ++RYK  +QV++ +    G    +RC WD D D  + E F N SL C+
Sbjct:   47 EKSEKPG-DQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCV 164          
BLAST of Tctex1 domain containing 2 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0300257)

HSP 1 Score: 72.7886 bits (177), Expect = 1.869e-16
Identity = 37/119 (31.09%), Postives = 61/119 (51.26%), Query Frame = 2
Query:   83 KKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +K++ P  D    Y +RP+F + F       I+  ++ EKL D TY+ +     T E++ E+   + S   ++RYK  +QV++ +    G    +RC WD D D  + E F N SL C+
Sbjct:   47 EKSEKPG-DQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCV 164          
BLAST of Tctex1 domain containing 2 vs. Ensembl Fly
Match: CG7276 (gene:FBgn0036499 transcript:FBtr0075546)

HSP 1 Score: 67.0106 bits (162), Expect = 2.825e-14
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 2
Query:   92 DVPKKDVT--NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            D P  DVT  N Y + P+F +KF      +++ +++KEKL++ TYN  E    T+E++ ++   +  +    R+K  + V++ +    G     R  WD  SD+ +  +F   S ICI
Sbjct:   45 DKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICI 162          
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 110.153 bits (274), Expect = 5.418e-31
Identity = 51/127 (40.16%), Postives = 79/127 (62.20%), Query Frame = 2
Query:   62 KLMTSAIKKTDVPKKDV-TNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            K  T+  +K D+   D   NTY+IRP++  KF+   A   + EIL+E+L  + Y+ EE+  L++ L+  +   L   +  +RYK  +QVVI E R +G+KMA RC+WD+D+DN   E +MN+SL C+
Sbjct:   16 KCETTIAQKRDISLMDTGANTYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKL-KDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMNDSLFCV 141          
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 101.679 bits (252), Expect = 1.579e-27
Identity = 48/121 (39.67%), Postives = 74/121 (61.16%), Query Frame = 2
Query:   62 KLMTSAIKKTDVPKKDV-TNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMN 421
            K  T+  +K D+   D   NTY+IRP++  KF+   A   + EIL+E+L  + Y+ EE+  L++ L+  +   L   +  +RYK  +QVVI E R +G+KMA RC+WD+D+DN   E +MN
Sbjct:   16 KCETTIAQKRDISLMDTGANTYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKL-KDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMN 135          
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.4698 bits (158), Expect = 1.781e-13
Identity = 38/113 (33.63%), Postives = 59/113 (52.21%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLIC 436
            P   + NTY I PS  ++F  L    ++K++L   L +  Y  E    +TK ++ E++   V  L + RYKI + + I + + Q I+M +RC WD + DN     F NNSL  
Sbjct:   54 PTVQMENTYRITPS--RRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTIT-EVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFA 163          
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.4698 bits (158), Expect = 1.781e-13
Identity = 38/113 (33.63%), Postives = 59/113 (52.21%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLIC 436
            P   + NTY I PS  ++F  L    ++K++L   L +  Y  E    +TK ++ E++   V  L + RYKI + + I + + Q I+M +RC WD + DN     F NNSL  
Sbjct:   54 PTVQMENTYRITPS--RRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTIT-EVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFA 163          
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Match: dynlt3 (dynein, light chain, Tctex-type 3 [Source:ZFIN;Acc:ZDB-GENE-040927-24])

HSP 1 Score: 46.2098 bits (108), Expect = 9.847e-7
Identity = 21/96 (21.88%), Postives = 47/96 (48.96%), Query Frame = 2
Query:  152 FRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            F P  A+ +VKE ++  +  + Y+  +++  T  + +  ++ LV   Q + +K  +   + +    G+  A  CYWD+ +D      + N ++ C+
Sbjct:   12 FNPDDASNVVKECIEGIIGGVDYSQNKVNQWTASIVEHSLTQLVK--QGKPFKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCV 105          
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Match: ENSXETT00000022071.1 (lysophosphatidic acid receptor 6-like [Source:Xenbase;Acc:XB-GENE-5721642])

HSP 1 Score: 108.612 bits (270), Expect = 1.688e-30
Identity = 48/108 (44.44%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY IRP+F  KF+       ++ +LKE+LSD  Y  EE+  LT+ LS+ +   L   +  +RYK+ +QVVI E R +G+KMA RC+WD+D+DN   + FMN  L C+
Sbjct:    9 NTYSIRPNFQHKFKSAPVKDCIRSVLKEELSDKQYVPEEVPQLTRFLSETIKDRL-KDMGFDRYKMVVQVVIGEQRGEGVKMAARCFWDADTDNYAEDVFMNEYLFCV 115          
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Match: coq10b (coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252])

HSP 1 Score: 59.6918 bits (143), Expect = 3.898e-11
Identity = 35/108 (32.41%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY   P+  ++F     N I+K++L   L +  Y AE    +TK +S E++   V  L + RYKI + + I +   Q +++ +RC WD  +D     SF N+SL  +
Sbjct:   64 NTYQTGPT--KRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTIS-EVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPANDTFSSYSFKNSSLFAL 168          
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Match: txnrd2 (thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GENE-5767949])

HSP 1 Score: 59.3066 bits (142), Expect = 6.122e-11
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  176 IVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +++  L E+L  ITYN      L KE+S+E+    V ++   RYK    V + E   + I + +RC WDS SD+ +   + N+SL C+
Sbjct:  102 VLESYLPERLGTITYNPASAPSLVKEVSEEVKGR-VKRVLPTRYKALCVVTLGERGQEDIAVVSRCLWDSHSDSYVAHVYENSSLFCV 188          
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Match: ENSXETT00000044463.1 (tctex1 domain-containing protein 1-like [Source:NCBI gene;Acc:100498184])

HSP 1 Score: 51.2174 bits (121), Expect = 7.986e-8
Identity = 26/88 (29.55%), Postives = 49/88 (55.68%), Query Frame = 2
Query:  176 IVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +++E L  KL + +Y+    + LTK+L +++   +V ++   RYK+   + I     + I + ++C WDS SDN    S+ N +L C+
Sbjct:  127 LIEEFLATKLKNESYDPSTCAALTKDLCEDIKK-IVRRVTPPRYKLICSMAIGSKDREDIMVTSQCLWDSYSDNVTSCSYQNRTLFCV 213          
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Match: DYNLT3 (dynein light chain Tctex-type 3 [Source:NCBI gene;Acc:101732306])

HSP 1 Score: 45.8246 bits (107), Expect = 1.692e-6
Identity = 24/96 (25.00%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  152 FRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            F   +A+IIVKE +   L  + Y+   I++    + ++ ++ LV   +  +Y ++  V+  + R  G+  A+ C+WD+++D      + N ++ CI
Sbjct:   11 FSGDEASIIVKECVDVILGGVDYDENRINEWMSAVVEQSLTHLVKMGKAFKYIVSCTVM--QKRGSGLHAASSCFWDNNTDGSCTVRWENRTMYCI 104          
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Match: Tctex1d2 (Tctex1 domain containing 2 [Source:MGI Symbol;Acc:MGI:1913311])

HSP 1 Score: 115.931 bits (289), Expect = 2.725e-33
Identity = 50/123 (40.65%), Postives = 79/123 (64.23%), Query Frame = 2
Query:   71 TSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +  + + D    +  NTY++RP F Q+FRP      +  +LKE+L+   Y+ +E+  LTK LS E++   + +L  +RYK+ +QVVI E R +G+ MA RC+WD+D+DN  H+ FMN+SL C+
Sbjct:   14 SEGLSEVDKNSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEELASAEYSPDEMPQLTKRLS-EMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNYTHDVFMNDSLFCV 135          
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 56.6102 bits (135), Expect = 1.279e-10
Identity = 32/108 (29.63%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY + P+  + F     N I++++L   L +  Y+ E    +TK +S E++ T V +L + RYK+ + V I +   Q I + +RC W+  SD     +F N++   +
Sbjct:    3 NTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTIS-EVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFAL 107          
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 56.6102 bits (135), Expect = 1.279e-10
Identity = 32/108 (29.63%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY + P+  + F     N I++++L   L +  Y+ E    +TK +S E++ T V +L + RYK+ + V I +   Q I + +RC W+  SD     +F N++   +
Sbjct:    3 NTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTIS-EVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFAL 107          
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Match: Tctex1d4 (Tctex1 domain containing 4 [Source:MGI Symbol;Acc:MGI:3045358])

HSP 1 Score: 57.7658 bits (138), Expect = 2.254e-10
Identity = 28/113 (24.78%), Postives = 53/113 (46.90%), Query Frame = 2
Query:  101 KKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
             + +  +Y + P+  + +    A   ++  L  +L+ + Y   E   L + L +++  T V +L L RYK+   VV+     QG+ + +R  WD+  D     +F N SL  +
Sbjct:   99 PRRMAPSYRLEPAPGEHWEAAGAQRALEAALTTQLNGVCYCGSEAGKLVQALCEQI-HTRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDAVHDGLASATFTNPSLFAV 210          
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 55.8398 bits (133), Expect = 7.429e-10
Identity = 32/108 (29.63%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY + P+  + F     N I++++L   L +  Y+ E    +TK +S E++ T V +L + RYK+ + V I +   Q I + +RC W+  SD     +F N++   +
Sbjct:   64 NTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTIS-EVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFAL 168          
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Match: sp|Q32P71|TC1D2_BOVIN (Tctex1 domain-containing protein 2 OS=Bos taurus OX=9913 GN=TCTEX1D2 PE=2 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 1.095e-34
Identity = 51/121 (42.15%), Postives = 80/121 (66.12%), Query Frame = 2
Query:   77 AIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
             + +T+    +  NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+ MA RC+WD+D+DNC H+ FMN+SL C+
Sbjct:   24 GLPETENNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNCTHDVFMNDSLFCV 143          
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Match: sp|Q8WW35|TC1D2_HUMAN (Tctex1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCTEX1D2 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 4.195e-33
Identity = 49/108 (45.37%), Postives = 75/108 (69.44%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+ MA+RC+WD+D+DN  H+ FMN+SL C+
Sbjct:   27 NTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCV 133          
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Match: sp|Q9CQ66|TC1D2_MOUSE (Tctex1 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tctex1d2 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.906e-32
Identity = 50/123 (40.65%), Postives = 79/123 (64.23%), Query Frame = 2
Query:   71 TSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +  + + D    +  NTY++RP F Q+FRP      +  +LKE+L+   Y+ +E+  LTK LS E++   + +L  +RYK+ +QVVI E R +G+ MA RC+WD+D+DN  H+ FMN+SL C+
Sbjct:   14 SEGLSEVDKNSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEELASAEYSPDEMPQLTKRLS-EMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNYTHDVFMNDSLFCV 135          
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Match: sp|Q66IC8|TC1D1_DANRE (Tctex1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=tctex1d1 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.345e-12
Identity = 38/113 (33.63%), Postives = 59/113 (52.21%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLIC 436
            P   + NTY I PS  ++F  L    ++K++L   L +  Y  E    +TK ++ E++   V  L + RYKI + + I + + Q I+M +RC WD + DN     F NNSL  
Sbjct:   54 PTVQMENTYRITPS--RRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTIT-EVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFA 163          
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Match: sp|A2VDD2|TC1DB_XENLA (Tctex1 domain-containing protein 1-B (Fragment) OS=Xenopus laevis OX=8355 GN=tctex1d1-b PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.772e-12
Identity = 37/110 (33.64%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  110 VTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            V NTY + P+  ++F     N I+K++L   L +  Y AE    +TK +S E++   V  L + RYKI + + I +   QG+++ +RC WD  +D     SF N+SL  +
Sbjct:   61 VENTYQMGPT--KRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTIS-EVIKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPANDTFSSYSFKNSSLFAL 167          
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Match: A0A267FZU2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022615g3 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.465e-34
Identity = 58/112 (51.79%), Postives = 77/112 (68.75%), Query Frame = 2
Query:  104 KDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            ++V NTYVIRP+F  KFRPL A  ++ E+L E+L+D  Y+ E  S L KEL+ E+ + L +    ERYK  +QV I E R QG+KMA RC WDSDSDN + + FMN+SL C+
Sbjct:   22 EEVANTYVIRPNFESKFRPLLAKPVIHEVLVERLTDKAYDKEATSGLCKELTDEIKARLRAN-GFERYKFVVQVAIGEQRGQGVKMACRCLWDSDSDNYVQDIFMNDSLFCV 132          
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Match: A0A267ECN6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022615g1 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.615e-34
Identity = 58/112 (51.79%), Postives = 77/112 (68.75%), Query Frame = 2
Query:  104 KDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            ++V NTYVIRP+F  KFRPL A  ++ E+L E+L+D  Y+ E  S L KEL+ E+ + L +    ERYK  +QV I E R QG+KMA RC WDSDSDN + + FMN+SL C+
Sbjct:   24 EEVANTYVIRPNFESKFRPLLAKPVIHEVLVERLTDKAYDKEATSGLCKELTDEIKARLRAN-GFERYKFVVQVAIGEQRGQGVKMACRCLWDSDSDNYVQDIFMNDSLFCV 134          
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Match: A0A267DR19 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022615g2 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.020e-33
Identity = 58/112 (51.79%), Postives = 76/112 (67.86%), Query Frame = 2
Query:  104 KDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            ++V NTYVIRP+F  KFRPL A  ++ E L E+L+D  Y+ E  S L KEL+ E+ + L +    ERYK  +QV I E R QG+KMA RC WDSDSDN + + FMN+SL C+
Sbjct:   24 EEVANTYVIRPNFESKFRPLLAKPVIHEALVERLTDKAYDKEATSGLCKELTDEIKARLRAN-GFERYKFVVQVAIGEQRGQGVKMACRCLWDSDSDNYVQDIFMNDSLFCV 134          
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Match: A0A341C1M8 (tctex1 domain-containing protein 2 isoform X1 OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=TCTEX1D2 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 7.639e-33
Identity = 52/121 (42.98%), Postives = 81/121 (66.94%), Query Frame = 2
Query:   77 AIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
             + +T+    +  NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+ MATRC+WD+D+DNC H+ FMN+SL C+
Sbjct:   18 GLPETEKNAGESENTYILRPIFQQRFRPSVVRDCIHAVLKEELANAEYSPEEMPQLTKRLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGVFMATRCFWDADADNCTHDVFMNDSLFCV 137          
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Match: A0A2Y9N4L8 (tctex1 domain-containing protein 2 OS=Delphinapterus leucas OX=9749 GN=TCTEX1D2 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.154e-33
Identity = 52/121 (42.98%), Postives = 81/121 (66.94%), Query Frame = 2
Query:   77 AIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
             + +T+    +  NTY++RP F Q+FRP      +  +LKE+L++  Y+ EE+  LTK LS+ +   L  ++  +RYK+ +QVVI E R +G+ MATRC+WD+D+DNC H+ FMN+SL C+
Sbjct:   18 GLPETEKNAGESENTYILRPIFQQRFRPSVVRDCIHAVLKEELANAEYSPEEMPQLTKRLSENIKDKL-KEMGFDRYKMVVQVVIGEQRGEGVFMATRCFWDADADNCTHDVFMNDSLFCV 137          
BLAST of Tctex1 domain containing 2 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 98.2117 bits (243), Expect = 7.658e-27
Identity = 40/103 (38.83%), Postives = 71/103 (68.93%), Query Frame = 2
Query:  122 YVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSL 430
            + IRP+   +FRP   +  ++E+++E+L   +Y++E  ++  + LSK +   L  +L L+RYK+ +QVVI E R +G++MA+RC+WD+D+D+C  + +MN SL
Sbjct:    8 HSIRPTQQHRFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRL-KELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNVSL 109          
BLAST of Tctex1 domain containing 2 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 96.6709 bits (239), Expect = 6.759e-26
Identity = 38/97 (39.18%), Postives = 69/97 (71.13%), Query Frame = 2
Query:  149 KFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +FRP   +  ++E+++E+L   +Y++E  ++  + LSK +   L  +L L+RYK+ +QVVI E R +G++MA+RC+WD+D+D+C  + +MN+SL C+
Sbjct:   41 RFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRL-KELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNDSLFCV 136          
BLAST of Tctex1 domain containing 2 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 62.3882 bits (150), Expect = 2.493e-12
Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLS----DITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            P   + NTY + P   +K  P++    VKEILK+ LS    ++ Y AE    +TK +S E++   V  + + RYKI + + I +   Q + + +RC WD+ SD     SF N+SL  I
Sbjct:   58 PAVQMENTYQLGP---KKRFPVQT---VKEILKDVLSSYLLEVKYEAELCRQMTKTIS-EVVKARVKDMMIPRYKIIVVISIGQLTGQNMHVGSRCLWDATSDTFCSNSFKNSSLFAI 168          
BLAST of Tctex1 domain containing 2 vs. Ensembl Cavefish
Match: dynlt3 (dynein light chain Tctex-type 3 [Source:NCBI gene;Acc:103026579])

HSP 1 Score: 45.4394 bits (106), Expect = 1.680e-6
Identity = 21/96 (21.88%), Postives = 47/96 (48.96%), Query Frame = 2
Query:  152 FRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            F P +A+  VKE ++  +  + Y+  +++  T  + +  ++ LV   Q + +K  +   + +    G+  A  CYWD+ +D      + N ++ C+
Sbjct:   12 FNPDEASNAVKECIEGVIGGVDYSQNKVNQWTATIVEHSLTQLVK--QGKPFKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCV 105          
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Match: EDO37919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEG2])

HSP 1 Score: 102.064 bits (253), Expect = 1.154e-28
Identity = 43/112 (38.39%), Postives = 68/112 (60.71%), Query Frame = 2
Query:  104 KDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +D+ N+Y IRP+F  KFRP     ++ + L E+L   TY+AEE     K ++  ++S  +  L+L+RYK  +QV I E R +G+ +A RC WDSD+DN   +  M ++  C+
Sbjct:    3 EDLANSYAIRPNFKNKFRPAAVKGLIHDTLNEELGGKTYDAEEAKSWPKLITDSVLSK-IKDLELDRYKFVVQVTIGEQRGEGVNVACRCLWDSDTDNYAQDLLMTDTFFCV 113          
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Match: EDO46891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP6])

HSP 1 Score: 70.0922 bits (170), Expect = 3.890e-16
Identity = 40/120 (33.33%), Postives = 62/120 (51.67%), Query Frame = 2
Query:   74 SAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLI 433
            +A +    P     NTY   P  ++KFR    + I+ ++L E+L  + Y+AE    L+  L++E+ S  V +L  +RYKI   V I     Q +++A+RC WD + D     SF N SL 
Sbjct:    2 AAHRFEHAPTNKYCNTYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSH-VKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWDENQDRAASGSFCNESLF 120          
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Match: EDO28932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T530])

HSP 1 Score: 67.3958 bits (163), Expect = 4.497e-15
Identity = 37/106 (34.91%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLI 433
            N+Y   P  ++KFR    + I+ ++L E+L  + Y+AE    L+  L++E+ S  V +L  +RYKI   V I     Q +++A+RC WD + D     SF N SL 
Sbjct:   16 NSYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSH-VKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWDENQDRAASGSFCNESLF 120          
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Match: EDO45313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT02])

HSP 1 Score: 66.2402 bits (160), Expect = 7.880e-15
Identity = 36/108 (33.33%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY + PS   +F   K   I++E  +E L++ +Y AE    +T +LS EL+   V  L   RYK+   V I +   QG+++ +RC W+++ DN +  S+ N +L  +
Sbjct:    2 NTYRMEPS--NRFSHKKVKDIIEEAFQEHLNEHSYEAEFCKHMTTKLS-ELIKQRVKHLGFTRYKLICIVYIGQVMNQGMRIGSRCLWNTNFDNVVEGSYRNGNLFAV 106          
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Match: EDO45441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB6])

HSP 1 Score: 63.5438 bits (153), Expect = 2.927e-13
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            NTY   P+  +KF       I+KE+L E L+D+ Y+      LTK +S E +   V +L ++RYKI   V I +   Q +++ +RC WD++ D      F N SL  +
Sbjct:   64 NTYQTTPT--KKFPEGNIRNIMKEVLIENLADVNYDPNTCRQLTKTIS-ETLKNRVKELSVQRYKIICLVHIGQLGKQAMRIGSRCLWDANFDTYTTYEFKNGSLFGV 168          
BLAST of Tctex1 domain containing 2 vs. Ensembl Medaka
Match: tctex1d2 (Tctex1 domain containing 2 [Source:NCBI gene;Acc:101160473])

HSP 1 Score: 86.2705 bits (212), Expect = 7.794e-22
Identity = 38/97 (39.18%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  149 KFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            +F+P      V EI++E+LS + Y  E+I +    L+ + +   V  L +++YKI +QV+I E R QG+KM +R +WD+D+DN   + FMN+SL C+
Sbjct:   39 RFKPAIVKEFVHEIVRERLSGVKYEPEKIPETCSSLA-DCIRDKVKSLGIDKYKIIVQVMIGEQRGQGVKMCSRFFWDADTDNYAEDVFMNDSLFCV 134          
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Match: SMESG000027829.1 (SMESG000027829.1)

HSP 1 Score: 216.853 bits (551), Expect = 1.051e-73
Identity = 109/124 (87.90%), Postives = 109/124 (87.90%), Query Frame = 2
Query:   68 MTSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            MTSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTL              VVI EHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI
Sbjct:    1 MTSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTL--------------VVITEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 110          
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.984e-10
Identity = 32/114 (28.07%), Postives = 57/114 (50.00%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            P   V NTY + P  +QKF   K   I K++++  L++  Y  +    ++K +S E++   + +L+++RYK+   + + E    G    +RC WD   D+     F N SL  +
Sbjct:   56 PTVRVENTYQLGP--DQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTIS-EVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAV 166          
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.723e-10
Identity = 32/114 (28.07%), Postives = 57/114 (50.00%), Query Frame = 2
Query:   98 PKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            P   V NTY + P  +QKF   K   I K++++  L++  Y  +    ++K +S E++   + +L+++RYK+   + + E    G    +RC WD   D+     F N SL  +
Sbjct:   68 PTVRVENTYQLGP--DQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTIS-EVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAV 178          
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Match: SMESG000021852.1 (SMESG000021852.1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.157e-9
Identity = 32/109 (29.36%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  116 NTYVIRPSFNQKFRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSD-SDNCMHESFMNNSLICI 439
            NTY I P  ++KF       I++++L + LS + Y+++ + +L+K L  + +  LV  L   R+K+   V+I +     + +A+RC W+S+  D+    SF   S+  I
Sbjct:   67 NTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSK-LIADRIKRLVRDLCYNRFKLVCIVLIGDKSGANVCIASRCLWNSENGDDVAQASFDGGSIFAI 174          
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Match: SMESG000078291.1 (SMESG000078291.1)

HSP 1 Score: 45.4394 bits (106), Expect = 1.287e-6
Identity = 26/96 (27.08%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  152 FRPLKANIIVKEILKEKLSDITYNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMATRCYWDSDSDNCMHESFMNNSLICI 439
            F P +   I K+ + + L+  TYN   +S  +  +  + +  LV KL  + Y+  +  +I +    G+  A+ CYWD  +D C    + NN ++C+
Sbjct:   22 FVPDEVIEIAKKCISDILNSATYNRLFVSQWSAVIVDQCVGQLV-KLP-KSYRYIVNCLITQDNEAGLHSASVCYWDETNDGCCTIKYTNNDILCL 115          
The following BLAST results are available for this feature:
BLAST of Tctex1 domain containing 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTEX1D28.735e-3445.37Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
TCTEX1D24.430e-1741.25Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
AC069257.44.687e-1741.25novel protein[more]
TCTEX1D13.161e-831.48Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
TCTEX1D41.477e-726.09Tctex1 domain containing 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dylt-21.816e-2038.68DYnein Light chain (Tctex type) [Source:UniProtKB... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG53591.869e-1631.09gene:FBgn0037773 transcript:FBtr0306611[more]
CG53591.869e-1631.09gene:FBgn0037773 transcript:FBtr0082215[more]
CG53591.869e-1631.09gene:FBgn0037773 transcript:FBtr0300257[more]
CG72762.825e-1429.66gene:FBgn0036499 transcript:FBtr0075546[more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tctex1d25.418e-3140.16Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d21.579e-2739.67Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d11.781e-1333.63Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d11.781e-1333.63Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
dynlt39.847e-721.88dynein, light chain, Tctex-type 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000022071.11.688e-3044.44lysophosphatidic acid receptor 6-like [Source:Xenb... [more]
coq10b3.898e-1132.41coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252][more]
txnrd26.122e-1134.09thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000044463.17.986e-829.55tctex1 domain-containing protein 1-like [Source:NC... [more]
DYNLT31.692e-625.00dynein light chain Tctex-type 3 [Source:NCBI gene;... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d22.725e-3340.65Tctex1 domain containing 2 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.279e-1029.63Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.279e-1029.63Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d42.254e-1024.78Tctex1 domain containing 4 [Source:MGI Symbol;Acc:... [more]
Tctex1d17.429e-1029.63Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32P71|TC1D2_BOVIN1.095e-3442.15Tctex1 domain-containing protein 2 OS=Bos taurus O... [more]
sp|Q8WW35|TC1D2_HUMAN4.195e-3345.37Tctex1 domain-containing protein 2 OS=Homo sapiens... [more]
sp|Q9CQ66|TC1D2_MOUSE1.906e-3240.65Tctex1 domain-containing protein 2 OS=Mus musculus... [more]
sp|Q66IC8|TC1D1_DANRE1.345e-1233.63Tctex1 domain-containing protein 1 OS=Danio rerio ... [more]
sp|A2VDD2|TC1DB_XENLA2.772e-1233.64Tctex1 domain-containing protein 1-B (Fragment) OS... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FZU22.465e-3451.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267ECN62.615e-3451.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DR191.020e-3351.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A341C1M87.639e-3342.98tctex1 domain-containing protein 2 isoform X1 OS=N... [more]
A0A2Y9N4L88.154e-3342.98tctex1 domain-containing protein 2 OS=Delphinapter... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d27.658e-2738.83Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d26.759e-2639.18Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d12.493e-1234.75Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
dynlt31.680e-621.88dynein light chain Tctex-type 3 [Source:NCBI gene;... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379191.154e-2838.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468913.890e-1633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289324.497e-1534.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453137.880e-1533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454412.927e-1334.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d27.794e-2239.18Tctex1 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tctex1 domain containing 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027829.11.051e-7387.90SMESG000027829.1[more]
SMESG000040148.11.984e-1028.07SMESG000040148.1[more]
SMESG000040148.12.723e-1028.07SMESG000040148.1[more]
SMESG000021852.12.157e-929.36SMESG000021852.1[more]
SMESG000078291.11.287e-627.08SMESG000078291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030286 ID=SMED30030286|Name=Tctex1 domain containing 2|organism=Schmidtea mediterranea sexual|type=transcript|length=490bp
CTGCTGTATGTTTCAAATTATTTTCTTATATTAATATATTTATATTATAT
ATCAGTTTATTAAATTAATGACTAGTGCTATTAAAAAGACAGATGTTCCA
AAAAAAGATGTTACCAATACATATGTTATCAGACCTTCTTTTAATCAAAA
ATTTCGTCCATTAAAAGCAAATATTATTGTTAAAGAAATTTTAAAAGAAA
AGTTATCAGATATAACATACAATGCTGAAGAAATATCAGATTTAACAAAA
GAACTGAGTAAAGAGCTAATGTCTACTCTAGTTAGTAAATTACAACTGGA
ACGATATAAAATTGCTATTCAGGTAGTAATTGCTGAGCATCGTGCTCAAG
GAATTAAAATGGCCACTAGATGTTATTGGGATTCAGACAGTGACAATTGT
ATGCATGAATCATTCATGAATAATTCATTAATATGTATTGTTTCCGTTTA
CGGTGTTTACTTTTATTAATTATATGTTGATTTGTTATAA
back to top

protein sequence of SMED30030286-orf-1

>SMED30030286-orf-1 ID=SMED30030286-orf-1|Name=SMED30030286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MTSAIKKTDVPKKDVTNTYVIRPSFNQKFRPLKANIIVKEILKEKLSDIT
YNAEEISDLTKELSKELMSTLVSKLQLERYKIAIQVVIAEHRAQGIKMAT
RCYWDSDSDNCMHESFMNNSLICIVSVYGVYFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005813centrosome
GO:0005930axoneme
GO:0031021interphase microtubule organizing center
GO:0097546ciliary base
GO:0005868cytoplasmic dynein complex
Vocabulary: biological process
TermDefinition
GO:1905799regulation of intraciliary retrograde transport
GO:0060271cilium morphogenesis
GO:1902017regulation of cilium assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0045505dynein intermediate chain binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 36..131
e-value: 1.1E-23
score: 83.4
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 13..133
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 33..131
e-value: 2.5E-25
score: 90.2
NoneNo IPR availablePANTHERPTHR21255:SF7TCTEX1 DOMAIN-CONTAINING PROTEIN 2coord: 13..133