BHLH domain-containing protein

Overview
NameBHLH domain-containing protein
Smed IDSMED30030281
Length (bp)997
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BHLH domain-containing protein (SMED30030281) t-SNE clustered cells

Violin plots show distribution of expression levels for BHLH domain-containing protein (SMED30030281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BHLH domain-containing protein (SMED30030281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BHLH domain-containing protein (SMED30030281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030281SMESG000019789.1 SmedASXL_007962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030281SMESG000019789.1 SmedASXL_007960SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030281SMESG000019789.1 SmedASXL_007961SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30030281SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30030281SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030281SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: CCDC169 (coiled-coil domain containing 169 [Source:HGNC Symbol;Acc:HGNC:34361])

HSP 1 Score: 48.1358 bits (113), Expect = 5.254e-6
Identity = 67/237 (28.27%), Postives = 108/237 (45.57%), Query Frame = 2
Query:  134 LKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMR--SSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            LK   L+E + K  V+ S  EL   I E E +L+  N E +EWKTRY+ Q E ND++ KQI+ +++K+++      D   ++R    +P ES       +L+K L+EE+  L  Q +    ++ QE+KA+ K N +R+    E+                             SG    +  Q+V +L    P +   + K       R  P  Q+ +  K GP+KK +   +LP L
Sbjct:   17 LKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDN-EGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVES-----LNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQG--------------------------SGLHQVSKRQQVDQL----PRMQENLVKTG-----RYNPAKQKTVSAKRGPVKKITRPNHLPEL 212          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: ccdc169 (coiled-coil domain containing 169 [Source:ZFIN;Acc:ZDB-GENE-091204-29])

HSP 1 Score: 72.4034 bits (176), Expect = 1.446e-14
Identity = 64/198 (32.32%), Postives = 109/198 (55.05%), Query Frame = 2
Query:  152 QEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI--LSATENINELKYMTDP--GPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKL 733
             E+++K +++DS S+L  T+A+ E+RL +V  E NEW+TRY+ Q E N+Q+ KQI ++++++Q  ++   D   ++RS   YE    D     +K L  E+  L  Q  D   RI+QE KA+ K  E+R+A   EI  LS+T N++  + M +      +P ++  +S       A     ++ S  N    +R+P+L
Sbjct:   20 HEREVKEMLQDSVSDLRNTLADLERRLHSVEEEENEWRTRYETQLELNEQLEKQISVVRERLQTLRSDPSDRLASIRS---YEEMSEDALRQRLKLLSSEKSGLQAQLMDFRMRIVQEGKAYQKVYEERRAYLAEIAKLSSTLNLSRKQQMAEARRTAAAPDKTAGKSTKQHSGAA-----KKGSVNNTPARSRLPRL 209          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000001146.1 (coiled-coil domain containing 169 [Source:NCBI gene;Acc:100497065])

HSP 1 Score: 68.1662 bits (165), Expect = 6.738e-13
Identity = 55/148 (37.16%), Postives = 88/148 (59.46%), Query Frame = 2
Query:  122 GIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRS--SVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI 559
            G  +L +    EK+MK +++ S  EL  TIAE E+RL++V  E NEWKTRY+ Q E N Q+ +QI I+++K +  +    D   ++RS   +P    LG ++   +K L +E+  +  Q +D + RI QE KA++K N +R+   +EI
Sbjct:   14 GSYQLTEDIQLEKKMKEMLQISTFELKNTIAELERRLNSVEDEGNEWKTRYETQVELNKQLERQIYILREKSENIRGNPTDRLSSIRSFDQMP----LGALN-QFLKHLDDEKILMENQLKDFELRIEQEAKAYYKVNNERRMYVSEI 156          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ccdc169 (coiled-coil domain containing 169 [Source:MGI Symbol;Acc:MGI:2444356])

HSP 1 Score: 59.6918 bits (143), Expect = 4.493e-10
Identity = 67/214 (31.31%), Postives = 118/214 (55.14%), Query Frame = 2
Query:  113 SVEGIK--ELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMR--SSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI--LSATENINELKYMTDPGP---QSPPRSPKQSVSGQPPT----APVQRVQR---LSTVNP 706
            + EG+    LK   L+E  MK +V+ S  E+   IAE E  L+  +   +EWKTRY+ Q E NDQ+ KQI+ +++K+++ +    D   ++R    +P ES        L+K L++E+  L  Q ++  +R+ QE+KA+H+ N +R++   E+  +S +  +++ + M DP P   +SP ++ + +   Q  T     PV++V R   L  +NP
Sbjct:    8 TFEGVSTDRLKLELLEEIHMKDVVQLSTLEIRHKIAELEANLNG-DLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVYEKMPVES-----LNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQM-DPLPRMKESPVKTGRHNSMNQKTTNAKKGPVKKVPRSNHLPKLNP 214          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ccdc169 (coiled-coil domain containing 169 [Source:MGI Symbol;Acc:MGI:2444356])

HSP 1 Score: 53.5286 bits (127), Expect = 5.516e-8
Identity = 56/174 (32.18%), Postives = 100/174 (57.47%), Query Frame = 2
Query:  113 SVEGIK--ELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMR--SSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI--LSATENINELKYMTDPGPQ 616
            + EG+    LK   L+E  MK +V+ S  E+   IAE E  L+  +   +EWKTRY+ Q E NDQ+ KQI+ +++K+++ +    D   ++R    +P ES        L+K L++E+  L  Q ++  +R+ QE+KA+H+ N +R++   E+  +S +  +++ + M DP P+
Sbjct:    8 TFEGVSTDRLKLELLEEIHMKDVVQLSTLEIRHKIAELEANLNG-DLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVYEKMPVES-----LNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQM-DPLPR 174          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3KPT0|CC169_XENLA (Coiled-coil domain-containing protein 169 OS=Xenopus laevis OX=8355 GN=ccdc169 PE=2 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.282e-9
Identity = 51/137 (37.23%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  155 EKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRS--SVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI 559
            EK  K +++ S  EL  TIAE E+RL++V  E NEWKTRY+ Q E N Q+ +QI I+++K +  +    D   ++RS   +P    +G ++   +K L +E+  L  Q ++ + RI QE KA++K N +R+   +EI
Sbjct:   25 EKNKKEMLQMSTFELKNTIAELEQRLNSVEDEGNEWKTRYETQIELNKQLERQIYILREKSENIRGNPTDRLSSIRSLDQMP----VGALN-QFVKHLDDEKILLENQLKNFELRIEQEAKAYYKVNNERRMYISEI 156          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BXX9|CC169_MOUSE (Coiled-coil domain-containing protein 169 OS=Mus musculus OX=10090 GN=Ccdc169 PE=2 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 3.143e-9
Identity = 67/214 (31.31%), Postives = 118/214 (55.14%), Query Frame = 2
Query:  113 SVEGIK--ELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMR--SSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEI--LSATENINELKYMTDPGP---QSPPRSPKQSVSGQPPT----APVQRVQR---LSTVNP 706
            + EG+    LK   L+E  MK +V+ S  E+   IAE E  L+  +   +EWKTRY+ Q E NDQ+ KQI+ +++K+++ +    D   ++R    +P ES        L+K L++E+  L  Q ++  +R+ QE+KA+H+ N +R++   E+  +S +  +++ + M DP P   +SP ++ + +   Q  T     PV++V R   L  +NP
Sbjct:    8 TFEGVSTDRLKLELLEEIHMKDVVQLSTLEIRHKIAELEANLNG-DLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVYEKMPVES-----LNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQM-DPLPRMKESPVKTGRHNSMNQKTTNAKKGPVKKVPRSNHLPKLNP 214          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8HTG9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008072g1 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 4.319e-42
Identity = 97/248 (39.11%), Postives = 150/248 (60.48%), Query Frame = 2
Query:  125 IKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELK----------YMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            ++ L+ + +QE QMK +VE+SC+EL  T+AE EKR + +  E+NEWKTR++IQ+E N+Q+ KQI+I+Q+K+ Q+    +D+Q+ ++S+    ++ G  + ++IK LQ+E+  L+ Q++D+DWR+ QE KA+HKANE+RK +  EI     N+ +++                P+SP  SPK+S+ GQ                                RNIPPDQR+IDP+ GPIKK +AVK LP L
Sbjct:    9 LERLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNT-ITTEFGSATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKAYHKANEERKNIQEEINQINANLGDIRKSNALTTGGEGGAGGRPKSPRGSPKRSI-GQ--------------------------------RNIPPDQRVIDPRKGPIKKTAAVKQLPSL 222          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8FUN8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.269e-41
Identity = 97/248 (39.11%), Postives = 150/248 (60.48%), Query Frame = 2
Query:  125 IKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELK----------YMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            ++ L+ + +QE QMK +VE+SC+EL  T+AE EKR + +  E+NEWKTR++IQ+E N+Q+ KQI+I+Q+K+ Q+    +D+Q+ ++S+    ++ G  + ++IK LQ+E+  L+ Q++D+DWR+ QE KA+HKANE+RK +  EI     N+ +++                P+SP  SPK+S+ GQ                                RNIPPDQR+IDP+ GPIKK +AVK LP L
Sbjct:   57 LERLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNT-ITTEFGSATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKAYHKANEERKNIQEEINQINANLGDIRKSNALTTGGEGGAGGRPKSPRGSPKRSI-GQ--------------------------------RNIPPDQRVIDPRKGPIKKTAAVKQLPSL 270          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8F213 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.394e-33
Identity = 91/248 (36.69%), Postives = 142/248 (57.26%), Query Frame = 2
Query:  125 IKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELK----------YMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            ++ L+ + +QE QMK +VE+SC+EL  T+AE EKR + +  E+NEWKTR++IQ+E N+Q+ KQI+I+Q+K+ Q+    +D+Q+ ++S+    ++ G  + ++IK LQ+E+  L+ Q++D+DWR+ QE K    A    K +  EI     N+ +++                P+SP  SPK+S+ GQ                                RNIPPDQR+IDP+ GPIKK +AVK LP L
Sbjct:    9 LERLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNT-ITTEFGSATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKPTRSA----KNIQEEINQINANLGDIRKSNALTTGGEGGAGGRPKSPRGSPKRSI-GQ--------------------------------RNIPPDQRVIDPRKGPIKKTAAVKQLPSL 218          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A210QE62 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12520 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 3.564e-32
Identity = 92/229 (40.17%), Postives = 135/229 (58.95%), Query Frame = 2
Query:  152 QEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            QEKQMK ++E S SEL  TI E EKR D V  E NEWKTR + Q+E NDQ+ KQI ++Q K+Q++K+ L+D  K+ +    ++ DL D +  +++ L++E++ L  Q RD++WR+ QE+KA+HKA+E+RK  + EI +A    N L                          P+   +    + P+  +R P+       RNIP DQRI+DPK GPI+K +AVK+LP L
Sbjct:   20 QEKQMKEMLEQSSSELRYTIEELEKRYDGVVDEGNEWKTRCETQQEMNDQLDKQIFMLQSKVQEAKSNLKDAGKSTKDMKNFD-DLSDATPHMVRMLEKEKNMLHNQMRDIEWRLDQESKAYHKAHEERKTYSTEIHAAATR-NRL--------------------------PITHRE----LEPIPGSRTPR----DMGRNIPEDQRILDPKRGPIRKTAAVKSLPSL 212          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A2T7PLU9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05677 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.002e-30
Identity = 86/222 (38.74%), Postives = 130/222 (58.56%), Query Frame = 2
Query:  173 LVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            +++ S +EL ATI E EKR D++  E NEWKTRY+ Q+E N Q+ +QI+++Q+K++++++ L++  K  R +  ++ DL D S  ++K L  E+  L  Q RDL+WR+ QE+KA+HKAN++RK    EI +A  +I+E+K        +P         GQP T    R  R +                    NIP DQRIIDP+ GPIK+ + VK+LP L
Sbjct:   97 MLDQSAAELKATIDELEKRFDSIENEGNEWKTRYETQQEMNQQLERQIILLQNKVEEARHNLKEANKTPRDNRNFD-DLSDASPQMVKALDREKQLLHNQLRDLEWRLDQESKAYHKANDERKQYVLEINAAKGSISEMKTRQRQALMAP---------GQPETGSSPRTYRDNAG------------------NIPDDQRIIDPRRGPIKRTAGVKSLPSL 290          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: ccdc169 (coiled-coil domain-containing protein 169-like [Source:NCBI gene;Acc:111195093])

HSP 1 Score: 60.4622 bits (145), Expect = 1.729e-10
Identity = 49/144 (34.03%), Postives = 81/144 (56.25%), Query Frame = 2
Query:  152 QEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENIN 583
            QE+++K ++  S S+L +T+ + E+RL +V  E NEW+TRY+ Q E N Q+ +QI ++Q+K++       D   ++RS   Y+    D     +K L  E+  L  Q  +   RI QE KA+ KA ++R+A   EI   +  I+
Sbjct:   20 QEREVKEMLVGSVSDLRSTLTDLEQRLHSVEGEGNEWRTRYETQLELNGQLERQIGVVQEKLEGHSGNPMDRLASIRS---YDEMTVDALRQRLKLLSTEKTTLQNQLLEYRLRIDQEGKAYQKAYDERRAYLTEIAKVSSAID 160          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003020.1 (pep scaffold:Pmarinus_7.0:GL477049:63953:68183:1 gene:ENSPMAG00000002756.1 transcript:ENSPMAT00000003020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.185e-7
Identity = 36/127 (28.35%), Postives = 68/127 (53.54%), Query Frame = 2
Query:  257 EWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQ--SPPRS 631
            EW+TRY+ Q+E N+++  Q+  ++ K+++ ++ LR+    M+    Y     +    L+   +EER  L     D +WRI QE KA+HK   +++ V N++   +  +  ++Y     P+  S PR+
Sbjct:    4 EWRTRYETQRELNERLRLQLEEMRTKVKEGRDTLRERMNVMQG---YNQQSKESLKQLLWKKEEERQSLQETLVDYEWRIAQEAKAYHKVINEKREVLNQLGEVSACMCSIQYQFKALPRKVSTPRA 127          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO37982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE60])

HSP 1 Score: 93.5893 bits (231), Expect = 4.517e-22
Identity = 82/247 (33.20%), Postives = 127/247 (51.42%), Query Frame = 2
Query:  125 IKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAM----RSSVPYE-SDLGDISMSLIKTL--QEERDKLV--RQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            I+ L+    QEKQMK ++E S  EL  TI E + + +    E+NEWKTR++ Q E N Q+ KQI++           LRD  + M    R   P+       ++ + +K L  Q ERDKL    Q RDL+WR+  E+KA+HK +E+RK     +   +  I++ K           R+ +++++            R S       A + K+ + ++F  +P +QRIIDPK GPIKK +AV+ LP +
Sbjct:   70 IERLRAEIQQEKQMKEMLEQSSEELDKTIVELQGKFEIAGDEDNEWKTRFETQHEMNTQLEKQIIL-----------LRDKLEQMKIPSREGKPHPLRTYNGLTDADVKKLMRQTERDKLQLEGQLRDLEWRLDNESKAYHKISEERKQYFTALNETSAVIDDTKTKRKHALIESQRNSEETLA------------RFS------QATMRKIDSNSSF-GLPDNQRIIDPKKGPIKKTAAVRKLPKI 286          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000019789.1 (SMESG000019789.1)

HSP 1 Score: 459.144 bits (1180), Expect = 8.936e-165
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 2
Query:  101 MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL
Sbjct:    1 MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 246          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000019789.1 (SMESG000019789.1)

HSP 1 Score: 237.654 bits (605), Expect = 6.552e-79
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 2
Query:  101 MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENK 511
            MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENK
Sbjct:    1 MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENK 137          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000052476.1 (SMESG000052476.1)

HSP 1 Score: 132.109 bits (331), Expect = 9.309e-37
Identity = 94/240 (39.17%), Postives = 141/240 (58.75%), Query Frame = 2
Query:  119 EGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNXXXXXXXXXXXXXXXXXXNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 838
            E I+ L  +   E+  + ++E S SE+   +++ EK++  +  E+NEWKTRYDIQ E NDQ +KQIL++QDK+  SKNQL++VQK++R++       G+I+   ++ L+ E++ L+ Q++D+DWRI QE KA+HKA E RK    E+ +A  N+ ELK                 +  Q      Q V   ST++       PK +     RNIP +QRIID K GPIKK +A+K LP +
Sbjct:    5 EEIERLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELK-----------------IKNQKEMDAQQMVTSRSTISH--TRHSPKRT--IGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 223          
The following BLAST results are available for this feature:
BLAST of BHLH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1695.254e-628.27coiled-coil domain containing 169 [Source:HGNC Sym... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1691.446e-1432.32coiled-coil domain containing 169 [Source:ZFIN;Acc... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000001146.16.738e-1337.16coiled-coil domain containing 169 [Source:NCBI gen... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1694.493e-1031.31coiled-coil domain containing 169 [Source:MGI Symb... [more]
Ccdc1695.516e-832.18coiled-coil domain containing 169 [Source:MGI Symb... [more]
back to top
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3KPT0|CC169_XENLA1.282e-937.23Coiled-coil domain-containing protein 169 OS=Xenop... [more]
sp|Q8BXX9|CC169_MOUSE3.143e-931.31Coiled-coil domain-containing protein 169 OS=Mus m... [more]
back to top
BLAST of BHLH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HTG94.319e-4239.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FUN81.269e-4139.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8F2131.394e-3336.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210QE623.564e-3240.17Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A2T7PLU91.002e-3038.74Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1691.729e-1034.03coiled-coil domain-containing protein 169-like [So... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003020.12.185e-728.35pep scaffold:Pmarinus_7.0:GL477049:63953:68183:1 g... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO379824.517e-2233.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000019789.18.936e-165100.00SMESG000019789.1[more]
SMESG000019789.16.552e-79100.00SMESG000019789.1[more]
SMESG000052476.19.309e-3739.17SMESG000052476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030281 ID=SMED30030281|Name=BHLH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=997bp
ATGTTAATATTAATAAATTCAAACATAAATATTTGACTGATACGTTCAGA
GTGAAATTGTGAATATTATAGAAAGGAAAAAATAAAATTTAATATTGAAA
ATGGCAGAAACCTCGGTGGAAGGTATCAAAGAATTAAAGGACAGCGCATT
GCAAGAAAAGCAGATGAAGGCATTGGTGGAAGATTCATGTAGCGAACTGC
TCGCTACGATCGCCGAATACGAGAAACGACTTGATGCGGTCAATTATGAA
AACAATGAATGGAAGACGCGCTACGACATTCAGAAGGAGACCAACGACCA
AATTTCCAAGCAAATATTGATTATTCAGGACAAGATTCAACAATCAAAAA
ATCAACTTCGAGATGTGCAAAAGGCAATGAGATCAAGCGTTCCCTACGAA
TCTGATCTAGGAGACATTTCAATGAGTTTAATAAAAACCCTTCAAGAGGA
AAGAGACAAGTTGGTGAGACAGAAGCGGGACCTGGATTGGAGGATCATCC
AGGAGAACAAGGCCTTCCACAAAGCCAATGAGCAACGCAAGGCGGTTACT
AATGAAATCCTTTCCGCGACCGAGAATATCAATGAACTGAAATATATGAC
TGATCCTGGGCCACAGTCTCCTCCACGCAGTCCCAAACAGTCCGTGTCGG
GACAACCGCCGACAGCGCCAGTTCAACGCGTCCAGAGGTTGTCTACGGTG
AATCCGATGATAGCCGCTCGGGTGCCGAAATTGTCTACTGCAACTGCATT
CAGAAATATTCCTCCTGATCAAAGAATAATCGATCCTAAAATGGGGCCAA
TCAAAAAGGAGTCTGCGGTGAAAAATCTGCCTCCCCTGTGATAAATAATG
AGAAATGAAGATAAAAATCGGAAATATTGAAATAAAATTAATGATATTTT
TACAAATACAAAATATTGATTGAATCGGTTTGATTATTGAATTTAGATAG
GCTGATTGCATTGATGATGTGTGTGTGTATGTATGATAATGAGTGGC
back to top

protein sequence of SMED30030281-orf-1

>SMED30030281-orf-1 ID=SMED30030281-orf-1|Name=SMED30030281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MAETSVEGIKELKDSALQEKQMKALVEDSCSELLATIAEYEKRLDAVNYE
NNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYE
SDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVT
NEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTV
NPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046983protein dimerization activity
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028022DUF4600
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 30..57
NoneNo IPR availableCOILSCoilCoilcoord: 72..92
NoneNo IPR availableCOILSCoilCoilcoord: 111..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..191
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 177..191
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..246
IPR028022Protein of unknown function DUF4600PFAMPF15372DUF4600coord: 50..164
e-value: 7.2E-25
score: 87.9
IPR028022Protein of unknown function DUF4600PANTHERPTHR28671FAMILY NOT NAMEDcoord: 9..244