RNB domain-containing protein

Overview
NameRNB domain-containing protein
Smed IDSMED30030278
Length (bp)5964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNB domain-containing protein (SMED30030278) t-SNE clustered cells

Violin plots show distribution of expression levels for RNB domain-containing protein (SMED30030278) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNB domain-containing protein (SMED30030278) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNB domain-containing protein (SMED30030278) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030278

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030278SMESG000026073.1 dd_Smed_v4_8176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNB domain-containing protein vs. Ensembl Human
Match: HELZ2 (helicase with zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:30021])

HSP 1 Score: 291.967 bits (746), Expect = 1.303e-78
Identity = 237/828 (28.62%), Postives = 382/828 (46.14%), Query Frame = 2
Query: 3365 NGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSS-VGGDLLCLRLKKDNWNNYWIGHGEVV---HVAKPKLESGEFKIVIFM----LTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSID-THPLLKEVILGINELSPDDE---NNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKT---NVPLTGE----LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLI 5755
            +G     P+L  V+P F +CL H + P   F   G++   +   +  + D+ EY   + P   +ES    + E  + TL  +++ W   E+  T + +  G  +L   F +      N        R E L     S   G   L   L  D     W+ HG+        +   +    ++ +F+    + +   ++    +    ++V++  K +   R++EA+  ++   PL+  + LG     P      + F+     +I   R  K N +Q+ A+  A+    ++I GPPGTGKT +G  + + F + N      G             +LYCGPSN  V+++A  + ++  +L P  LR+Y EQ E ++FP+P   S+      P  G     L+ I+LH+ IRQ    ++  + + D   Q+     R               ++ Y+  + EA+K  +  +++E++LCT +  A+  +++ ++ QI++DEAGM  EPETLIP+       E VVL+GDHKQLRP++ N+  + LGL+ SLFERY E       ML+ QYRMH  IC FPS  FY  +LKT                     W G+          S+L  +   + P                         ++F HV G E    V+T  GNENS+ N +EV  V  I K++    T     P  I VLT Y  Q   +    +             V ++ +SQGS+  Y++ STVR+   + D++Q PT  W K++LGF+ DPNQ+NVA+TRAQ+GL +IG+  LLR   +W+ L+
Sbjct: 1324 HGFLVPSPQLWTVAPGFSLCLEHVERPGDCF--SGRV---YRAPRDRYRDVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSW---EASRTPQGQLQGAFRLEAAFLEENCADINFSCCYLCIRLEGLPAPTASPRPGPSSLGPGLNVDPGTYTWVAHGQTQDWDQERRADRQEAPRRVHLFVHHMGMEKVPEEVLRPGTL---FTVELLPKQLPDLRKEEAVRGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYNIPGGR-HKLNPSQNVAVREALEKPFTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDVLAGLLLRRM-ELKP--LRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRSITLHHRIRQAPNPYSSEIKAFDTRLQRGELFSRE-------------DLVWYKKVLWEARKFEL--DRHEVILCTCSCAASASLKILDVRQILVDEAGMATEPETLIPLVQFPQA-EKVVLLGDHKQLRPVVKNERLQNLGLDRSLFERYHE----DAHMLDTQYRMHEGICAFPSVAFYKSKLKT---------------------WQGLR------RPPSVLGHAGKESCP-------------------------VIFGHVQGHERSLLVSTDEGNENSKANLEEVAEVVRITKQLTLGRT---VEPQDIAVLTPYNAQASEISKALRREGIAGVA-----VSSITKSQGSEWRYVLVSTVRTC-AKSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLL 2055          

HSP 2 Score: 63.1586 bits (152), Expect = 6.105e-9
Identity = 102/467 (21.84%), Postives = 178/467 (38.12%), Query Frame = 2
Query:  932 AIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKI----NDPKNH-TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISL--ICQINPLD---ITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYF------VCSVNDCY---KDMDIETIFE-ARIVIEEFMLLANEYVA 2272
            AIP+D   D     I++  R +CG  AF  D V V++      P+    G+V+GV +     +   ++C++      +M P++ S  KI V       +  +  + + + + +  E+ +    E   SR                                       F V    W   F YP G +   +    +++    ++ L    ++ P D   IT   QK   E+ + A       ++L      FT+D +   ++DDALS    G    + VHITDV  ++     +  +A  +   +Y P      P+ +L  +L  DVLSL P + R  +S        + +  +    ++    F   V+ S  +L+YEE    ++Q    P     L   L+ + A         +   YF          +DC+    D D    F  A I+++E+M+  N  VA
Sbjct:  575 AIPLD---DASSGPIQVRGRLDCGM-AFAGDEVLVQLLSGDKAPEGRLRGRVLGVLKRKRHEL--AFVCRMDTWDPRIMVPINGSVTKIFVAELKDPSQVPIYSLRKGRLQRVGLERLTA---EARHSRL--------------------------------------FWVQIVLWRQGFYYPLGIVREVLPEASTWEQGLRILGLEYSLRVPPSDQATITKVLQKYHTELGRVAGRREDCRAFL-----TFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVPRDGVLDVEARRQGAAFYAP---GREPVPMLPASLCQDVLSLLPGRDRLAIS--------LFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH---PGAGRELPARLDSVDACV-------VAACYFSRLLRRHRLRSDCFYEQPDEDGTLGFRAAHIMVKEYMIQFNRLVA 968          
BLAST of RNB domain-containing protein vs. Ensembl Human
Match: HELZ2 (helicase with zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:30021])

HSP 1 Score: 285.034 bits (728), Expect = 2.213e-76
Identity = 240/834 (28.78%), Postives = 387/834 (46.40%), Query Frame = 2
Query: 3365 NGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLL------ERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVV---HVAKPKLESGEFKIVIFM----LTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSID-THPLLKEVILGINELSPDDE---NNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKT---NVPLTGE----LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLI 5755
            +G     P+L  V+P F +CL H + P   F   G++   +   +  + D+ EY   + P   +ES    + E  + TL  +++ W   E+  T + +  G  +L   F +      N        R E L         G SS+G  L       D     W+ HG+        +   +    ++ +F+    + +   ++    +    ++V++  K +   R++EA+  ++   PL+  + LG     P      + F+     +I   R  K N +Q+ A+  A+    ++I GPPGTGKT +G  + + F + N      G             +LYCGPSN  V+++A  + ++  +L P  LR+Y EQ E ++FP+P   S+      P  G     L+ I+LH+ IRQ    ++  + + D   Q+     R               ++ Y+  + EA+K  +  +++E++LCT +  A+  +++ ++ QI++DEAGM  EPETLIP+       E VVL+GDHKQLRP++ N+  + LGL+ SLFERY E       ML+ QYRMH  IC FPS  FY  +LKT     W GL                          S+L  +   + P                         ++F HV G E    V+T  GNENS+ N +EV  V     +I + LT  R   P  I VLT Y  Q   +         +++      V ++ +SQGS+  Y++ STVR+   + D++Q PT  W K++LGF+ DPNQ+NVA+TRAQ+GL +IG+  LLR   +W+ L+
Sbjct: 1893 HGFLVPSPQLWTVAPGFSLCLEHVERPGDCF--SGRV---YRAPRDRYRDVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSW---EASRTPQGQLQGAFRLEAAFLEENCADINFSCCYLCIRLEGLPAPTASPRPGPSSLGPGL-----NVDPGTYTWVAHGQTQDWDQERRADRQEAPRRVHLFVHHMGMEKVPEEVLRPGTL---FTVELLPKQLPDLRKEEAVRGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYNIPGGR-HKLNPSQNVAVREALEKPFTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDVLAGLLLRRM-ELKP--LRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRSITLHHRIRQAPNPYSSEIKAFDTRLQRGELFSRE-------------DLVWYKKVLWEARKFEL--DRHEVILCTCSCAASASLKILDVRQILVDEAGMATEPETLIPLVQFPQA-EKVVLLGDHKQLRPVVKNERLQNLGLDRSLFERYHE----DAHMLDTQYRMHEGICAFPSVAFYKSKLKT-----WQGL----------------------RRPPSVLGHAGKESCP-------------------------VIFGHVQGHERSLLVSTDEGNENSKANLEEVAEV----VRITKQLTLGRTVEPQDIAVLTPYNAQASEIS-----KALRREGIAGVAVSSITKSQGSEWRYVLVSTVRTCA-KSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLL 2624          

HSP 2 Score: 63.1586 bits (152), Expect = 6.507e-9
Identity = 102/467 (21.84%), Postives = 178/467 (38.12%), Query Frame = 2
Query:  932 AIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKI----NDPKNH-TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISL--ICQINPLD---ITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYF------VCSVNDCY---KDMDIETIFE-ARIVIEEFMLLANEYVA 2272
            AIP+D   D     I++  R +CG  AF  D V V++      P+    G+V+GV +     +   ++C++      +M P++ S  KI V       +  +  + + + + +  E+ +    E   SR                                       F V    W   F YP G +   +    +++    ++ L    ++ P D   IT   QK   E+ + A       ++L      FT+D +   ++DDALS    G    + VHITDV  ++     +  +A  +   +Y P      P+ +L  +L  DVLSL P + R  +S        + +  +    ++    F   V+ S  +L+YEE    ++Q    P     L   L+ + A         +   YF          +DC+    D D    F  A I+++E+M+  N  VA
Sbjct: 1144 AIPLD---DASSGPIQVRGRLDCGM-AFAGDEVLVQLLSGDKAPEGRLRGRVLGVLKRKRHEL--AFVCRMDTWDPRIMVPINGSVTKIFVAELKDPSQVPIYSLRKGRLQRVGLERLTA---EARHSRL--------------------------------------FWVQIVLWRQGFYYPLGIVREVLPEASTWEQGLRILGLEYSLRVPPSDQATITKVLQKYHTELGRVAGRREDCRAFL-----TFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVPRDGVLDVEARRQGAAFYAP---GREPVPMLPASLCQDVLSLLPGRDRLAIS--------LFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH---PGAGRELPARLDSVDACV-------VAACYFSRLLRRHRLRSDCFYEQPDEDGTLGFRAAHIMVKEYMIQFNRLVA 1537          
BLAST of RNB domain-containing protein vs. Ensembl Human
Match: UPF1 (UPF1 RNA helicase and ATPase [Source:HGNC Symbol;Acc:HGNC:9962])

HSP 1 Score: 166.007 bits (419), Expect = 1.957e-40
Identity = 190/765 (24.84%), Postives = 312/765 (40.78%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS      ++  R    + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P               +  ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  296 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSGNEDLVIIWLRDMRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQ-----GNGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSP---------------VSFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 911          
BLAST of RNB domain-containing protein vs. Ensembl Human
Match: UPF1 (UPF1 RNA helicase and ATPase [Source:HGNC Symbol;Acc:HGNC:9962])

HSP 1 Score: 159.073 bits (401), Expect = 2.654e-38
Identity = 189/765 (24.71%), Postives = 310/765 (40.52%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  296 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPI-RLQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 900          
BLAST of RNB domain-containing protein vs. Ensembl Human
Match: DIS3L2 (DIS3 like 3'-5' exoribonuclease 2 [Source:HGNC Symbol;Acc:HGNC:28648])

HSP 1 Score: 128.642 bits (322), Expect = 6.335e-31
Identity = 118/396 (29.80%), Postives = 182/396 (45.96%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQ-IP----------NDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIET-------IFEAR---IVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECS--VKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLD 2767
            +FTID  T +D+DDALS       +  +GVHI DV+ ++    ++ K A  R  + Y      + P  +L   L  ++ SL P   +   SV++       + P+ K   I+   F + +I S  KL+YE   S ++ P + IP          +  E +  A+  +  +AK++R+ R  +             +D ET       I+E R    ++EEFMLLAN  VA KI+  +P+  LLR   P +                    L EFC+ + + P +F +   L  +K+  + F        D   SL + +   N          QM   A Y CS  ++D  + +H++LN PLYTHFTSPIRRF D++VHRLL + L   E  D+  D
Sbjct:   14 IFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVY--LVQKVVP--MLPRLLCEELCSLNPMSDKLTFSVIW------TLTPEGK---ILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQAVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPEQALLRRHPPPQT--------------RMLSDLVEFCDQMGL-PVDFSSAGAL--NKSLTQTFG-------DDKYSLARKEVLTN----MCSRPMQM---ALYFCSGLLQDPAQFRHYALNVPLYTHFTSPIRRFADVLVHRLLAAALGYRERLDMAPD 365          
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 144.05 bits (362), Expect = 4.186e-34
Identity = 157/615 (25.53%), Postives = 258/615 (41.95%), Query Frame = 2
Query: 3962 YSVDVYLKSVVSKRQQEAISSI-----DTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPI-VKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            ++VDV   +   +RQ +A++++        P L + +LG     P +E      +   +    + + N +Q QA+   +   LSLI GPPGTGKT +   + Y   QK      +G VL C PSN  V+ +A    +K      K++R+    +E          S+T VP       ++L + ++  G +            QK++       L +   E      L Y   +K  K++ ++    +++ CT +  A   +       ++IDE+    EPE L+   S    V  +VL+GDH QL P++  K A   GL  SLFER   L  +    L  QYRMHP + EFPS  FY   L+       +G+  +D          G+++     H+            P    PAF                    F+H  G E +    T   N     N           +K++  L      P+ I V+T Y+ Q+  +               + + + +V   QG + DYII + VRS     DI     +G     +GF++DP ++NVA+TRA+ GL+++GN ++L  + +W  LI   + +  + E
Sbjct:  384 FTVDVVWNATTFERQYKALAALLNDSKAISPYLYQKLLG----HPAEEMMLKFDLPRRLSVAGLPELNSSQMQAVKQVLTRPLSLIQGPPGTGKTVVSATIVYHLVQKT-----EGNVLVCSPSNIAVDHLA----EKIHKTGLKVVRLCARSRE---------HSETTVPY------LTLQHQLKVMGGAE----------LQKLI------QLKDEAGELEFKDDLRYMQ-LKRVKEHELLA-AADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILV---SIMRGVRQLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRPF-RLQVQYRMHPVLSEFPSNVFYDGSLQ-------NGVTEND------RHMTGVDW-----HW------------PKPNKPAF--------------------FWHCSGSEELSASGTSFLNRTEAAN----------VEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRS----NDI-----LG-----IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKSKEMLYE 874          
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 144.05 bits (362), Expect = 4.186e-34
Identity = 157/615 (25.53%), Postives = 258/615 (41.95%), Query Frame = 2
Query: 3962 YSVDVYLKSVVSKRQQEAISSI-----DTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPI-VKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            ++VDV   +   +RQ +A++++        P L + +LG     P +E      +   +    + + N +Q QA+   +   LSLI GPPGTGKT +   + Y   QK      +G VL C PSN  V+ +A    +K      K++R+    +E          S+T VP       ++L + ++  G +            QK++       L +   E      L Y   +K  K++ ++    +++ CT +  A   +       ++IDE+    EPE L+   S    V  +VL+GDH QL P++  K A   GL  SLFER   L  +    L  QYRMHP + EFPS  FY   L+       +G+  +D          G+++     H+            P    PAF                    F+H  G E +    T   N     N           +K++  L      P+ I V+T Y+ Q+  +               + + + +V   QG + DYII + VRS     DI     +G     +GF++DP ++NVA+TRA+ GL+++GN ++L  + +W  LI   + +  + E
Sbjct:  384 FTVDVVWNATTFERQYKALAALLNDSKAISPYLYQKLLG----HPAEEMMLKFDLPRRLSVAGLPELNSSQMQAVKQVLTRPLSLIQGPPGTGKTVVSATIVYHLVQKT-----EGNVLVCSPSNIAVDHLA----EKIHKTGLKVVRLCARSRE---------HSETTVPY------LTLQHQLKVMGGAE----------LQKLI------QLKDEAGELEFKDDLRYMQ-LKRVKEHELLA-AADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILV---SIMRGVRQLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRPF-RLQVQYRMHPVLSEFPSNVFYDGSLQ-------NGVTEND------RHMTGVDW-----HW------------PKPNKPAF--------------------FWHCSGSEELSASGTSFLNRTEAAN----------VEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRS----NDI-----LG-----IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKSKEMLYE 874          
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 144.05 bits (362), Expect = 4.186e-34
Identity = 157/615 (25.53%), Postives = 258/615 (41.95%), Query Frame = 2
Query: 3962 YSVDVYLKSVVSKRQQEAISSI-----DTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPI-VKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            ++VDV   +   +RQ +A++++        P L + +LG     P +E      +   +    + + N +Q QA+   +   LSLI GPPGTGKT +   + Y   QK      +G VL C PSN  V+ +A    +K      K++R+    +E          S+T VP       ++L + ++  G +            QK++       L +   E      L Y   +K  K++ ++    +++ CT +  A   +       ++IDE+    EPE L+   S    V  +VL+GDH QL P++  K A   GL  SLFER   L  +    L  QYRMHP + EFPS  FY   L+       +G+  +D          G+++     H+            P    PAF                    F+H  G E +    T   N     N           +K++  L      P+ I V+T Y+ Q+  +               + + + +V   QG + DYII + VRS     DI     +G     +GF++DP ++NVA+TRA+ GL+++GN ++L  + +W  LI   + +  + E
Sbjct:  384 FTVDVVWNATTFERQYKALAALLNDSKAISPYLYQKLLG----HPAEEMMLKFDLPRRLSVAGLPELNSSQMQAVKQVLTRPLSLIQGPPGTGKTVVSATIVYHLVQKT-----EGNVLVCSPSNIAVDHLA----EKIHKTGLKVVRLCARSRE---------HSETTVPY------LTLQHQLKVMGGAE----------LQKLI------QLKDEAGELEFKDDLRYMQ-LKRVKEHELLA-AADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILV---SIMRGVRQLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRPF-RLQVQYRMHPVLSEFPSNVFYDGSLQ-------NGVTEND------RHMTGVDW-----HW------------PKPNKPAF--------------------FWHCSGSEELSASGTSFLNRTEAAN----------VEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRS----NDI-----LG-----IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKSKEMLYE 874          
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Match: disl-2 (DIS3-like exonuclease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09568])

HSP 1 Score: 112.079 bits (279), Expect = 2.002e-24
Identity = 115/412 (27.91%), Postives = 180/412 (43.69%), Query Frame = 2
Query: 1649 VVFTIDSETTKDMDDALSF-------HKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQP------NQIPN-DKENLIYALNE----IFAVAKKIRRAR---------LPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYE-QFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIE-NKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDD-ITLDIGEVCTIAN 2794
            +VFTID +T +D+DDAL          K    + IGVHI DVT ++    E+ K A  R  + Y  +      I +L   L   + SL P   R   S +F+             +E+    F + VI S+ KL YE    +++ P      +++P+    N  + + E    +  +A+ +R+ R         LP   F    +   + + I  I ++  ++EEFMLLAN  VA+KI E +P+  LLR   P K                    + E C  +       D R   ++S +  + Q  + L + I +  S L            I+   Q    A+Y C+ +  +    HF+LN   YTHFTSPIRR+ D++VHR L + L   E  + +  +I E+CT  N
Sbjct:  340 IVFTIDPKTARDLDDALHAKHIDDCDGKGTPGLEIGVHIADVTFFLKEGTELDKWASERGNSTYLSQTV----IPMLPRILCEQLCSLNPGVDRLSFSTVFKMSYE---------AELYDVWFGRSVIRSRVKLAYEHAQDFIENPEKDFTCDELPDISDGNTPFEIKEKTLMLHRIAQVLRQKREDSGALRIELPRLKFALDEDKKPQGVSIYEIKDSNKLVEEFMLLANMEVAKKIAENFPEHALLRNHPPPKE--------------KMIKDVAEQCARIGF---PLDGRTSGLLSTSLRKYQGKSRLDMCIRQVISSLT-----------IKPMQQ----AKYFCTFEMPLSFYHHFALNVDHYTHFTSPIRRYPDVIVHRQLAAALGYNERSERVPEEIQEICTRCN 706          
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Match: dis-3 (Probable exosome complex exonuclease RRP44 [Source:UniProtKB/Swiss-Prot;Acc:Q17632])

HSP 1 Score: 105.531 bits (262), Expect = 2.246e-22
Identity = 119/494 (24.09%), Postives = 202/494 (40.89%), Query Frame = 2
Query: 1421 FIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-------NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIV----------IEEFMLLANEYVARKIYEKYPDFTLLRMQD-PVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFA 2845
             +V  ++W     YP G  V +I    S +    ++ L   I       + LD  PR + E D  + +     V       D  + ++D     D+DDAL   + G D+  +GVHI DVT ++     I  +A  R  T Y         I +L   L++++ SL   + R   S ++              ++I    + + +I S+  LTYE+    +  P +    + ++   L  +  ++K +   R        + ++   DMD E+    +++          +EEFMLLAN  VA KI E+YPD  LLR    P+K   + L           A + + F  ++       D+  + +  KN     N  L +   +    +    Y++   V + ++                   +HF L   +YTHFTSPIRR+ D++VHRLL + +   +I    L+    CT    K+  N N+    A +A
Sbjct:  407 IVVAIDHWPRDSKYPLGHYVRSIGEMGSRETENEVLLLEHDIPHAPFSESVLDCLPREEWEPDLTENRGPLPRVD----LRDLTICSVDPLGCTDIDDALHCKQIGEDLFEVGVHIADVTHFVRPGTAIDDEAALRGTTVYLCD----RRIDMLPCLLSSNLCSLRGEEERYAFSCIWTMTSS---------ADIQSVKYHKSLIKSKAALTYEKAQEIIDDPKE----QNDVALGLRGLMKLSKVLNARRTGNGALTLASSEVRFDMDWESRTPKKVMEKQHLDTHSMVEEFMLLANISVAEKILEEYPDCALLRRHPVPLKESYKPLVE---------AARHRGFEIIVESGKGLADSLNRCVDKKN--PMLNRLLRMLTTRC---MTQAVYFSAGTVPVPQY-------------------QHFGLACAIYTHFTSPIRRYADVIVHRLLAAAIGADDIQSGLLNQAR-CT----KICTNINYRHKQAQYA 841          
BLAST of RNB domain-containing protein vs. Ensembl Fly
Match: Upf1 (gene:FBgn0030354 transcript:FBtr0342744)

HSP 1 Score: 148.673 bits (374), Expect = 1.946e-35
Identity = 165/621 (26.57%), Postives = 259/621 (41.71%), Query Frame = 2
Query: 3959 NYSVDVYLKSVVSKRQQEAIS--SIDTHPL---LKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSK----TNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            N++VD   K     R   A+   +ID + +   +   +LG      +DE  F            +   N++Q  A+ +A+   LSLI GPPGTGKT     + Y   +      + G VL C PSN  V+    ++ +K      K++R+  + +E  D P+  F +      N+    EL++  L  L  + GE     LSS D         ++ Y    N++ A  N +L   D                ++ CT        +     T I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A + GL  SLFER   L  +    L  QYRMHP + +FPS  FY   L+       +G+  +D              R  KL               D  WP                 PER +F+ V  G E I       G+  S  N  E   V  I  + ++    P Q    I ++T Y+ Q+ +L++          ++  +  + +V   QG + D II S VRS               E+Q +GF+ DP ++NVALTRA+ G+II+GN ++L    +W  L+   ++R  + E
Sbjct:  385 NFTVDFIWKCTSFDRMTRALCKFAIDRNSVSNFIYSRLLGHGRADSNDEVLFRGPQPKLFSAPHLPDLNRSQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQLVK-----LHGGTVLVCAPSNTAVD----QLTEKIHRTNLKVVRVCAKSREAIDSPV-SFLALHNQIRNMETNSELKK--LQQLKDETGE-----LSSAD---------EKRY---RNLKRAAENQLLEAAD----------------VICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFR-LEVQYRMHPELSQFPSNFFYEGSLQ-------NGVCAED--------------RRLKL---------------DFPWPQ----------------PERPMFFLVTQGQEEI------AGSGTSFLNRTEAANVEKITTRFLKAGIKPEQ----IGIITPYEGQRAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSN--------------ERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYKDRKVLVE 880          
BLAST of RNB domain-containing protein vs. Ensembl Fly
Match: Upf1 (gene:FBgn0030354 transcript:FBtr0073596)

HSP 1 Score: 148.673 bits (374), Expect = 1.946e-35
Identity = 165/621 (26.57%), Postives = 259/621 (41.71%), Query Frame = 2
Query: 3959 NYSVDVYLKSVVSKRQQEAIS--SIDTHPL---LKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSK----TNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            N++VD   K     R   A+   +ID + +   +   +LG      +DE  F            +   N++Q  A+ +A+   LSLI GPPGTGKT     + Y   +      + G VL C PSN  V+    ++ +K      K++R+  + +E  D P+  F +      N+    EL++  L  L  + GE     LSS D         ++ Y    N++ A  N +L   D                ++ CT        +     T I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A + GL  SLFER   L  +    L  QYRMHP + +FPS  FY   L+       +G+  +D              R  KL               D  WP                 PER +F+ V  G E I       G+  S  N  E   V  I  + ++    P Q    I ++T Y+ Q+ +L++          ++  +  + +V   QG + D II S VRS               E+Q +GF+ DP ++NVALTRA+ G+II+GN ++L    +W  L+   ++R  + E
Sbjct:  385 NFTVDFIWKCTSFDRMTRALCKFAIDRNSVSNFIYSRLLGHGRADSNDEVLFRGPQPKLFSAPHLPDLNRSQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQLVK-----LHGGTVLVCAPSNTAVD----QLTEKIHRTNLKVVRVCAKSREAIDSPV-SFLALHNQIRNMETNSELKK--LQQLKDETGE-----LSSAD---------EKRY---RNLKRAAENQLLEAAD----------------VICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFR-LEVQYRMHPELSQFPSNFFYEGSLQ-------NGVCAED--------------RRLKL---------------DFPWPQ----------------PERPMFFLVTQGQEEI------AGSGTSFLNRTEAANVEKITTRFLKAGIKPEQ----IGIITPYEGQRAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSN--------------ERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYKDRKVLVE 880          
BLAST of RNB domain-containing protein vs. Ensembl Fly
Match: Dis3l2 (gene:FBgn0035111 transcript:FBtr0072487)

HSP 1 Score: 112.079 bits (279), Expect = 3.125e-24
Identity = 113/394 (28.68%), Postives = 180/394 (45.69%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALSFHKEG-SDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQI--------------PNDKENLIYALNEIFAVAKKIRRARLPES----------YFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDP--VKNCGEWLENLFNLT---NMNFAGQLKE-FCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDS--IENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVL 2734
            +FTID  T +D+DDA+S  K G ++  IGVHI+DV+ ++   +E+    + R  + Y    +N   IH+L  +L     SL P + +   SV +R  G+ ++     L +  +P F + VI S  +  YE     +  PN+               P+D  N +  L++I   A  IR+ RL             + +  +       ++E   EA  +IEEFMLLAN+ VAR I++ +PD  +LR   P  +K+     E L  L    + + +  L+E    L N  P                    N ++++   ++ L++  A                  A Y CS   S   +  H++L+ P+YTHFTSPIRR+ DI+VHRLL + L
Sbjct:  556 IFTIDPMTARDLDDAVSIEKLGDNEYEIGVHISDVSHFLIEDNELDNIVKERSTSIY---LAN-EVIHMLPQSLCMRC-SLLPGQDKFAFSVFWRMNGKGVM-----LQK--KPEFCRTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPDDIRNRVLWLHDI---ASSIRKTRLDNGALTINNAKLRFLLDPITGEPLSFEVEKQREANRLIEEFMLLANQAVARFIHDSFPDIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNEAP--------------------NPVAMNACLSQLLMKPMAR-----------------ATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDILVHRLLAAAL 897          
BLAST of RNB domain-containing protein vs. Ensembl Fly
Match: Dis3l2 (gene:FBgn0035111 transcript:FBtr0072486)

HSP 1 Score: 112.079 bits (279), Expect = 3.295e-24
Identity = 113/394 (28.68%), Postives = 180/394 (45.69%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALSFHKEG-SDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQI--------------PNDKENLIYALNEIFAVAKKIRRARLPES----------YFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDP--VKNCGEWLENLFNLT---NMNFAGQLKE-FCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDS--IENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVL 2734
            +FTID  T +D+DDA+S  K G ++  IGVHI+DV+ ++   +E+    + R  + Y    +N   IH+L  +L     SL P + +   SV +R  G+ ++     L +  +P F + VI S  +  YE     +  PN+               P+D  N +  L++I   A  IR+ RL             + +  +       ++E   EA  +IEEFMLLAN+ VAR I++ +PD  +LR   P  +K+     E L  L    + + +  L+E    L N  P                    N ++++   ++ L++  A                  A Y CS   S   +  H++L+ P+YTHFTSPIRR+ DI+VHRLL + L
Sbjct:  568 IFTIDPMTARDLDDAVSIEKLGDNEYEIGVHISDVSHFLIEDNELDNIVKERSTSIY---LAN-EVIHMLPQSLCMRC-SLLPGQDKFAFSVFWRMNGKGVM-----LQK--KPEFCRTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPDDIRNRVLWLHDI---ASSIRKTRLDNGALTINNAKLRFLLDPITGEPLSFEVEKQREANRLIEEFMLLANQAVARFIHDSFPDIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNEAP--------------------NPVAMNACLSQLLMKPMAR-----------------ATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDILVHRLLAAAL 909          
BLAST of RNB domain-containing protein vs. Ensembl Fly
Match: armi (gene:FBgn0041164 transcript:FBtr0309840)

HSP 1 Score: 100.138 bits (248), Expect = 1.426e-20
Identity = 97/355 (27.32%), Postives = 148/355 (41.69%), Query Frame = 2
Query: 4742 NITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQE----------------LKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIE-NLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLI 5755
            + T ++ DEAG C EPET++P+         VVL GD +QL+ I+ +++A K+G  IS  ER  E                  P ++T L Y YR  PSI    S+ FY  +L   +S        D  E    S+        C    E  + Q++ +                              FY +IG+        Q  +  S  NPQEV  V  +   +   N+T  +     I ++T Y+ Q  +L                P + +V   QG + D I+ STVRS    E+I +       +  LGF+    ++NVA++RA+  +II GN  LL V+  W++LI
Sbjct:  821 HFTHVLFDEAGQCTEPETMVPIVMLTKKRSQVVLSGDPRQLQSIVTSRIASKMGFSISFLERLLERSPYRKDLQRFPESSGYNPLVLTKLLYNYRALPSIMSIYSRLFYDDELIPVLSE------KDSRESRLLSKLR------CVFESEKDIPQAHGT-----------------------------FFYGIIGE------NRQNNDSPSWFNPQEVREVFLMTIALYRANVTADQ-----IGIITPYQKQVKMLRSMFIGTDVVM-----PKIGSVEEFQGQERDIILISTVRS---SEEILRMDA----RFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLLAVDECWRQLI 1111          
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Match: helz2 (helicase with zinc finger 2, transcriptional coactivator [Source:ZFIN;Acc:ZDB-GENE-120920-1])

HSP 1 Score: 402.905 bits (1034), Expect = 5.828e-113
Identity = 462/1733 (26.66%), Postives = 759/1733 (43.80%), Query Frame = 2
Query:  824 NSRKKLLYE--IYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNH--TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-----NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEAR---IVIEEFMLLANEYVARKIYEKYP--DFTLLRMQDPVKNCGEWLENLFNLT------NMNFAGQLKEF--CNLLNVRP----DNFDARKKLI-VSKNFYEQFNNFLSIDI----DKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEK----ICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKE---IKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYS-CNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQE-IRRSYLPAV-KLKDKLHQLKSSFVNQTFDTVISSDSISLANPI-----IDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSN-------GSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHV----------AKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSI-DTHPLLKEVILGINELSPDDENNFINSIKNDIE-----NRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG----VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFF------SKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXX-XIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            N   ++ YE  ++T   + K+ +++K          G A P+D S       I +  R N G  AF  D V V+I    +H   G+V+ + ES        ++C + R    +M+P++K   KI                    T   +++   +A       R  ++L    F IK+N+ + +                   FIV    W   F YP G +VG +    +  +   ++S+  Q+     + L    +Y + +D  +K      +    LPT    FT+D   ++D+DDA+S    G  + IGVHI+DV  +++   E+ K A     T+YP       PI++    L+T++LSL PN+ R  +S        ++I  D + + I +    + VI S  K +Y+EV   L+    + +  E     L ++   A+  RR R  + +       CYK  D +     R    ++EE M++ N  VA ++         T LR QD  +   + L  +F+        +++F+ Q  E     L+   P    D F   K ++   K+  EQ N +  ID     D    LL        F V  R  +      R   +    I   H+ L+   YT  +SP+RR+ D++V RLL SV++ T++   TLDI   C   ++K +    +E+    +     +  ++++K  +I++      TN ++ F  P+    SSI E   I   DL L   P   + D    S +LKW++ IYS  N +  +   ++N    NS    ++P  ++K   + IR     A+  L ++L +       Q  +T+ +S      +P+      ++ L+I     + +Q       GL     +L +V P F+IC+ H  DPV  F      +   ++ +  +   K+YQ  + P+  +ES    + E  +  ++DV ++W   E+   KR +  G   LP D  KS+  I  D R+S          +    LE   ++   D+             W+ HG +              +PK    +F I    +T     IF   +    +++++  K +   R++ AI S+   + L+K + +G   ++ D      N      E        +   N +QS+A+  A+ +  +LI GPPGTGKT +G  + Y   +   +++  G     +LYCGPSN  V++VA  +      L P  LR+Y +Q E+ +FP PG        SK       EL  I+LH+LIR++G   +  + + D   Q      R   L++  R+        +R+ +K+A+K+ ++   ++++LCT T  +   + E  +  QIIIDE  M  EPE  IP+ +  +  E +VL+GDHKQL+P++H +VA++LG+  SLFERY E       ML+ QYRM   IC FPS EFY  +L+T + P  S L                            L Q+  + +       F H+                      G E    V T+ GNENS+ N +E E V     ++   LT        I +LT Y  Q     +             D  V T++RSQGS+  Y+I STVRS    E I   P   W  + LGFITDP+Q+NV +TRAQ+GL IIGN+ LLR + +W++L+   +E+ CV
Sbjct: 1123 NQVAEVYYEEPMFTSSTVHKQCEIVK-----EGYDRGYAKPLDEST----LRIDIKGRANIG-RAFPGDKVTVEILSATSHPPMGRVINILESADTVKE--FVCALERHDNQVMTPINKCITKIF-------------------TPFWKDKPNHIA------VRNPESLKVEKF-IKINEEAHR----------------KSLFIVKVLSWRNVFRYPLGIVVGVLPKIATLDDGLHVLSIEYQLRRTLSSSLRKQMQYLQRLDIFEKGRRDFRM----LPT----FTVDPAHSQDLDDAISLQDFGEYLEIGVHISDVASFVAKDSELDKFARQLCTTFYP---REKEPIYMFPKELSTNLLSLIPNQDRRAIS--------LIIEVDAQTNRIKRRFICKSVIHSNRKFSYDEVEDILENGEPLSDLLE---ICLVKVSNFAEVHRRYRKQDDW-------CYKMPDEDVTLGRRRSHQMVEELMVMFNHMVAERLLSDGATRSKTPLRCQDRPQT--DKLIEIFDKNAALIPLSVHFSSQAHELNKQGLIQHNPQTDSDTFPVLKSILRCLKSAAEQENIYKIIDFVATDDIHPQLL-------PFAVAFRRLFHKACIQRSNSTHVSRI--GHYDLDLDSYTWASSPVRRYLDVIVQRLLHSVIDKTDVKYTTLDINLSCLEFSRKNDQQSAYERKANALHFALKLSSQSERKVAYIVELNPLG-TNFKVSF--PL--NRSSISENLDIMSRDLLLAVQP---EFDVTNNSMILKWERRIYSFSNSHIHAEVKQQN---PNSVM-AYVPAKTWKCIADAIREQNWNAIFPLIEELQRNSGINARQFHETLSASKCTKNYDPLHAEHYAELYLRIKQGEAVEVQLGASTARGLMTPSIQLFVVHPKFEICVEHVRDPVKCFS-----EYALSSSRSSYNLYKDYQAIWRPMCEMESASSAVAENESILIVDVPLKW---ENSNPKRLQ--GFFLLPLDK-KSQWSIDCDLRNSFLCIRTRIQKQSSPFLESAQNTALMDIPSF---------TWVVHGVITEAEETESKESTNQEPKSLRIDFLINHMPMTNIPEQIFHERTR---FTLELIPKLLPDVRKENAIDSLTKANQLVKNIAMG-RRITSDRGCKIPNQNTGRFEINSYHPSGLSHLNNSQSKAIREALTNPFTLIQGPPGTGKTVVGVHILYWLHKNIQQLQASGSKKRAILYCGPSNKSVDVVAGHLLHLRDHLKP--LRVYSDQMEMLEFPYPGCNLKLSRNSKRGEKPNTELSSIALHHLIRKEGNPFSTQIRAFDMKVQ------RGDQLTDEERKL-------FREILKKARKHELL--HHDVILCTCTAASHPALAETLDFKQIIIDECAMATEPEAFIPLVA--HKPEQIVLLGDHKQLQPVVHCEVAERLGMSRSLFERYME----NALMLDTQYRMQEDICAFPSNEFYGGRLQTGI-PAKSKL---------------------------FLTQTKQTCI------VFGHVE---------------------GKEKSLVVRTEQGNENSKANMEEAEEV----VRVAILLTEAGIKTKDIAILTPYNAQ-----VAKISESLHNNHIRDITVNTIMRSQGSEWRYVIMSTVRSCPKSE-IETQPPKSWIMKRLGFITDPHQVNVGITRAQEGLCIIGNENLLRCSSLWRKLLNHYQEKGCV 2637          
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Match: zgc:113057 (zgc:113057 [Source:ZFIN;Acc:ZDB-GENE-050508-3])

HSP 1 Score: 328.561 bits (841), Expect = 9.068e-91
Identity = 439/1711 (25.66%), Postives = 733/1711 (42.84%), Query Frame = 2
Query:  863 EQLSKRTDLIK-CILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNH--TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIH-VDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDE--IKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYA-LNEIFAVAKKI----RRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEK--YPDFTLLRM-QDPVKNCG-EWLENLFNLTNMN--FAGQLKEFCNLLNVRPDNFD-ARKKLIVSKNFYEQFNNFL-SIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPA--RYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGT---EIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSD-ITNEEIRFVHPM-LQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKST--SNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVN------QTFDTVISSDSISLANPII---DIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEW-----LVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESG---EFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSID-THPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRN---------------KGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGF------FSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXX-XIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQH---PTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            E L+ R ++ K C L+        A P+D         IK+  R N G  +   D V V+I + +     G+V+G+   +   +  +++CK+  D    ++ ++K   +I  V  +PG    EV  ++  +             + +E +  A+N    V  IK       P+     V+P     CD F    +E  D                          I L  +  P    P +Q++ D+  ++++ +          +D   FTIDS +T+D+DDA+S  +      IG+HITDV  YI    E  + A     T Y P+  ++    +    ++ + LSL   + R  +S        +L+  D K S+I    F   +I S  +++Y+E    +++     ++ E L ++ L +  AVA +     R++RL   +       C + ++      ++ ++EE M L N   A ++       D T LR  Q P  N   ++ E   +L  M+  F+    E     N   D F+ +     +  +   +   F  S D      L+  D  +      +R++ ++   A     C+ K+S    H+ L    YT  +SP+RR+ D++V RLL ++L+     + D    +I   C      L+G +  E+  A      +   +   +++ A  D IT +   F+    LQ +  +  I +  L +   P   K +E   S  L WK+ +Y+    FK+   SN    V          P SS      + +  + AVK +D   +++  F N         + +IS  S +  N  +   ++ L++ + + +++Q      +GLP    +L  V+  F+ICL H  +P   F     +       K  +   +EYQ  ++ L  +++    L E ++  L +V I W     L G   +TK ++    ++     C     +   + D N  ++   ++R  S+V     CL          W+ H       K    +     FKI    +T     IF+  +    ++++V  K +    +++A++++   + L+K V  G  EL+ D +   I+    D ++  +   N +Q +A+  AM    ++I GPPGTGKT +G  + + F +KN                    K  +LYCGPSN  V++VA ++ K    L P  LRIY +Q E+ +FP  G        S  +     EL+ I+L YL+R+            + + ++I   ++N S+         + I +YR  +K+A ++ I K  Y++VLCT +      + E+ +  QI+IDE  M  EPE  IP+ S  +  + +VL+GDH+Q+RPI+     K  G+E SLFERY +    L  ML+ QYRMH  IC FPS EFY  +LKT         GP                  C L         N S  P      F HI  K                     EV   V+T+ GNENS  N +E E   C+   +I+       SP  I +LT Y  Q   ++M  +    +     +  V TV++SQGS+  Y+I STVRS  +  DI  +   P   W  + LGF+TD NQ+NVA+TRAQ GL I+GN  LLR   +W RL+     ++CV
Sbjct:   26 ELLTTRPNVFKRCKLETERHDQAYARPLDEPT----LTIKIFGRENMG-RSLPGDEVCVEILNTEECLCEGRVVGLINRDEDSL--VFVCKMVEDNPKCVTAVNKCMTRIRTVQGKPGMGLVEVRQLKYGRW------------VTKEFAEIAENNMLVVKIIKWESTKPHPLGVVTKVIP----ACDAF----HEILD--------------------------IELGSKGKP----PPFQQQKDKEGVEREDL----------SDIFTFTIDSTSTQDLDDAISVTEMDDSYQIGIHITDVASYIIKNSEQDEFARMLGRTIYTPEKGDV--AFMFSREISKEYLSLIDGEERRALS--------LLVVVDKKTSQIRSTQFALTLINSDRRMSYKEADQIIQK---YFSETEPLRFSRLEDCVAVAYRFSEAHRKSRLEGGW------QCGRQVEQT---RSQAMVEELMTLYNSAAAEELISADVTKDLTPLRCHQGPDPNLLIQFKEKYTDLIPMSAYFSNMFDENMEY-NPEHDGFEHSGMPFTIFTSILHKMEEFAQSRDYYSLTQLIFSDEIHPTLVPMVRDFREIKRKAVILRSCTSKES-RLGHYDLQMNAYTWASSPMRRYLDLIVQRLLHTMLSKQYLKQADYTNDEINRYC------LSGMEAEEEQDALVFRLRKIQFEPRDVVNLATVDQITPKGHEFIISFPLQPSLDLITIMYKHLKVVDQP---KYNEDKNSMTLHWKRRVYTFGEVFKNRFPSNPMKNVT---------PVSSI-----LWKRLISAVKHQD-WAKIEQCFQNIKREEKPEMEKLISEASSTQENSKMHYKELNLELKLGDVVQVQLGSEFKDGLPVPVVQLLSVNECFEICLEHSRNPTLCFSDSVCI-----ASKISYESYEEYQKIWTQLCQIDTAYNALEENNSVILEEVFINWSDEINLQGFFHLTKTQKTQWSLEFDLTNCFLCIRLRRQKLDENLGKH---IDR--SAVSDLQGCLPFT-------WVAHAVTTKSKKKDANTKGRINFKITHRSMTYIPARIFNKGTK---FTIEVIPKKIPYLLREQAVANLKRANNLVKSVATGKLELNDDADLRNISLYDVD-KSLNLPTLNMSQKKAVKEAMKKPFTVIQGPPGTGKTVVGIHIVFQFFKKNKDFMTSFKPNHTNPDGNPPKKPAILYCGPSNKSVDIVAEQLLKLSGVLKP--LRIYCDQMEMREFPYTGSELKLCRRSLRDEKPKEELRDITLMYLVRK----------PENPFSEEIKALEKNLSV---------DQIDNYRKLLKKANQHEIEK--YDVVLCTCSSALKPELREVMDFRQILIDECAMATEPEAFIPLVS--HNPQQIVLLGDHQQIRPIVQCGHVKNKGMEKSLFERYMD----LANMLDTQYRMHAEICSFPSDEFYDGKLKTGAE-----RGP-----------------CCLL---------NKSKEPTAML--FGHIEGK---------------------EVSLVVSTEKGNENSMANTEEAEQAVCVADLLIKQ---SGVSPEHIAILTPYNAQVSEIKMTLEKKNVR-----NVTVCTVMKSQGSEWPYVIVSTVRSC-STSDIQAYRVRPHKAWLGKRLGFVTDANQVNVAITRAQDGLCILGNSDLLRCCELWDRLLDHYYRKSCV 1508          
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-97a13.6 (si:dkey-97a13.6 [Source:ZFIN;Acc:ZDB-GENE-070912-617])

HSP 1 Score: 317.005 bits (811), Expect = 1.796e-86
Identity = 357/1435 (24.88%), Postives = 623/1435 (43.41%), Query Frame = 2
Query: 1667 SETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKI----RRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAG-QLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNN-FLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARY--ECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCF-ILDCACSDITNEEIRFVHPMLQKASSIK-EIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAV--KLKDKLHQLKSSFV------NQTFDTVISSDS--------ISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNN------------YWIGHGEVVHVAKPKLESG-EFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSI-DTHPLLKEVILG---INELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKN----YRIRN------KGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTG---------ELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXX-XIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            S  +  + DA+S  +      IG+H  D   Y+S                      NI  +        +D+ +LAP K R  +S++ +   R          ++++       I S   L+Y E  S + Q  +    KE     L +   V  +     R  RL       + +D     D     + R+++EE  L+         +++  D  ++  Q    N    L N     N  F   Q+ E C    + P+N       I+  + +++  +  L+ D  K   L+  D  +      I +       A +    S ++++   H+SL+   YTH +SPIRR+ D+V+ RL+ +VL    ++    DI  +C    +     + +E       I     K+  + +         +E  +   P  +     K  +++ +L L   PL +K   K +   L WKK IY  +                       P  + K+  EI++S   A+   ++D+      S V      + + ++ +S  S         S  +   D ++ + + +T+++Q    +  G  A   +L  +S +F+IC+ H D+P+  F      ++  +  K  +++++EY   + PL  +ES    + +     + +V I W   +S ++      G   LP++  K   I F+                    +G  LLC+R K+D   N             W+ H      +     SG +FKI+ F +  +   I     N + ++V++  K +   R++ A++++   + L++ + L    +N+ S  D   ++  +  +     + + N++Q +A+  A+N K ++I GPPGTGKT +G  + Y F+Q N    +R+++      + V+LYCGPSN  V++VA E   KF +   KLLR+Y  Q E+ ++P PG    +N+ L+          EL+ I+LH+ IR            H+ Y Q+I  TD +  +  +        I  Y+  + +A+ + +   +++++LCT T  A+  + +  +  QI+IDE  M  EP+TL+P+ S +   E VVL+GDHKQLRPI+ N   ++LG+  SLFERY +       ML+ QYRMH  IC+FPS+ +Y   LKT V                         R   L+ E+  R                            R  +RI+F  + G+E+   V+T  GNENS+ N  EV+    I    I+ +T  R  P  I +L+ Y  Q  + +++ +    + K  T   V T+ +SQGS+  Y+I S VRS  + E I   P+  W  +++GF+ D NQINV +TRAQ GL I+GN+ +L  +  W++L++      CV
Sbjct:  945 SPLSSQLRDAISVSESEFHFEIGIHKADFLNYVSE--------------------DNIQNL-----GAQSDMWNLAPGKKRCAISLMLKVEKRN--------GKLVEEKMVLSRIRSCKALSYSEADSIINQLGE----KEMKFGTLEDCILVVCRFALDHRTKRLSRQVNSSNPSDLASSED----SKCRLMMEELKLM---------FKRASD-QIINQQTQFPNTSPGLVNRLKKYNEKFESLQVLEKC----LDPNNGQNCGSFIILTSVWKKIKSAALTCDFYKMADLISTDDIHPQLVPAIVQLSASINKAFFIRSLSCREALVG-HYSLHLDSYTHASSPIRRYIDVVLQRLMHAVLGNRPVEYSQTDIDLLCEKCKRGEKRAQEYESKVEALQIAVNLQKQSTYKVAFVTVVKRDSESFKLSFPFDKGTFPEKLPVQYRNLQLEDQPLFIK---KPKHVKLTWKKRIYGLSM-------------------TQSPLQNMKISSEIQQSTWQAIVEAVRDEKWDEAKSLVLAAHVKDNSRNSELSDTSRWDPDRTFTSEEDHYTDFQINLKVGDTVQVQLTSERDRGYWAPTVQLFRLSSSFEICVEHTDNPIKCFS-----RIADHPSKGSYSNVEEYVQIWRPLCEMESAATAVDDSDCVVIENVAITW--DDSRLS------GNFSLPEENIKKWAIEFD--------------------LGRCLLCIR-KRDLEQNQAEQSELDPKYFTWVAHAVTTLCSDSPENSGNKFKIINFNVKYASMKIPKFKRN-ETFTVEIIPKLLPDIRKESAVNNLKGANELVQNIALKHRIVNQSSNQDVPLYL--LMREEAPAGLPQLNESQFKALEKALNGKFTIIQGPPGTGKTVVGAYIVYWFSQLNSRNLWRLKDPTDKDKREVILYCGPSNKSVDVVA-EYLLKFGEKL-KLLRVYSRQMEMQEYPYPG----SNLQLSHKSRQERSKPELRAITLHHRIRM----------GHNPYSQRI--TDFDDRIKSDPYSLTDTDIEEYKKLLNDARLHEL--ERHDIILCTCTAAASPNLKKTLSARQILIDECAMATEPQTLVPLVSFKP--EKVVLLGDHKQLRPIVKNNHVRRLGMTRSLFERYMD----RAIMLDTQYRMHEEICKFPSEAYYNDMLKTVVRE-----------------------RTSVLNAETEGR----------------------------RQSKRILFGDIRGEEIGLVVSTARGNENSKANFDEVKKAVEI---CIQLVTVGRVRPEDIAILSPYNAQ--VAQIRERLSDFELKGFT---VTTITKSQGSEWQYVILSIVRSCPSDE-IEPMPSREWLSKHIGFVGDENQINVGITRAQVGLCILGNQAVLNCSPAWQKLLKHYSGHGCV 2178          

HSP 2 Score: 76.6406 bits (187), Expect = 3.256e-13
Identity = 133/543 (24.49%), Postives = 214/543 (39.41%), Query Frame = 2
Query:  830 RKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKI--NDPKNHTGKVMGVYESNHKPVNSIYIC----------KVSRDQG---SLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHF-FIVCYEYWDPYFMYPNGKI-----VGTI--SSYDSFKNNFPLISL-ICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAV----AKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDF---TLLRMQDPVKNCGEWLENLFN 2365
            ++ LL  +     L KR +L+          SG  IP D  ++     I +  R N G  +F  D V V+I  +D  + TG+V+G+  +N  P +S  +C          K++ DQ     +M PLD +  KI +             + +K+ + +    K V+       R                            VP N +T  ++ F+V    W  +  +P G++     VGT         K+ F L+S  + Q N L      +  +D+ ++K            T    FT+D    + +DDA+S +  GS   IGVH+ DV  ++S    I   A+    T+Y P      P  +    L+T   SL P K R  +S        +++  + +   I + TF   ++ S+ +LTY E    + Q      D E     L +   V    A+  R+ RL E +    +N   K  +     EA  +IEE  ++ N  V+ K   +Y D    T LR QD      E LE + N
Sbjct:  442 KENLLEMVRNQPALYKRGELV-----MEGYQSGYIIPYDNPSE----RIDIKGRKNIGM-SFPGDEVVVEIRRHDEGHLTGRVLGL--TNRSPTSSECVCSLEDENYNRKKLNPDQNLVPKMMIPLDHTTTKIRI-------------LVKKEARKLIPLWKCVSGNWTITGR----------------------------VPINEQTKQNYVFVVQILGWKEHCSFPLGRVTDILPVGTSLEEGLKILKSEFKLMSPPLMQENTL-----LEIRIDDKRRKDF----------TGLKTFTVDPPNAEVLDDAISINDLGSCYEIGVHVADVASFVSKDSSIDAFAKDMGATFYAP---GKEPAFMFPKHLSTTCWSLLPGKDRKAIS--------LIVEVEKQSGVITKKTFDLSMVKSKRQLTYNEAEDIICQ-----CDGELRFDTLEDCVRVAYHFARSQRKTRLKEDWSYAQLNKHQKPGE----REAHRMIEELNIMFNHEVS-KFLSEYTDTKSCTPLRCQDSPN--AEALEKISN 893          
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Match: upf1 (UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-GENE-040426-2836])

HSP 1 Score: 161.77 bits (408), Expect = 2.478e-39
Identity = 191/765 (24.97%), Postives = 310/765 (40.52%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS   R           + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S S+  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  275 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSGDMRL----------MQGDEICLRYKGD-MAPLWKGIGHVIKV--PDNYGDEIAIELRSSAGAPVEV------PHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSSDEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRLKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 880          
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Match: upf1 (UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-GENE-040426-2836])

HSP 1 Score: 161.77 bits (408), Expect = 2.478e-39
Identity = 191/765 (24.97%), Postives = 310/765 (40.52%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS   R           + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S S+  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  275 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSGDMRL----------MQGDEICLRYKGD-MAPLWKGIGHVIKV--PDNYGDEIAIELRSSAGAPVEV------PHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSSDEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRLKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 880          
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Match: tbx21 (T-box 21 [Source:Xenbase;Acc:XB-GENE-479103])

HSP 1 Score: 181.03 bits (458), Expect = 5.786e-45
Identity = 239/1037 (23.05%), Postives = 418/1037 (40.31%), Query Frame = 2
Query: 1415 HFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYA-LNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEAR---IVIEEFMLLANEYVARKIYEK--YPDFTLLRMQDP--VKNCGEWLENLFNLTNMN--FAGQLKEFCNLLNVRPD--NFDARKKLIVSKNFYEQFNNFLS-IDIDKARSLLQYDAYYNDFFVHIREWYQ-MNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEK----ICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKA-SSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYF-KSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQL----KSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKK----------DNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQ------SDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSI-DTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRI----------RNKGVVLYCGPSNDCVNLVALEMKKKFSDL 4372
              F+V    W   F YP G +   +       +   ++ L   +      P    E      +   + V G     + + FT+D    KD+DDA+S  +      IGVHITD+   I    ++ ++A  R  T+Y PK       H+L   + T   SL P   R  +S+       +L+  +     ++     Q VI S  +L+YEE ++ L   +Q  +     +   L   +  ++  R  RL E+         YK  D +    AR   ++IEE M+L N +VA  +  K    D   +R Q P  ++   E  +   +L  ++   +  L E        P+       +++ V    ++Q     +  D D AR LL  D  + +    +RE+ + +   +       D+    H+SL    YT  +SP+RR+ DIVV RLL+ +L G+       D+  +C    +K++   ++E+    +    A+     +K   ++     D      + V PM   + ++  ++++  L L   P  +    +     L W++ +Y  + Y  K   ++R   +          FS+   +  +      A+ L D    L    K   V +    V  S      N  + +ELK    +T+ +Q C  +  G+P  +P+L   +P   ICL H + PV  F       L H    + + + +EYQ  + PL  +E+    +GE +A  L +V I W          K+  G       F  +  +I + E D +           F +     LCLR++           D+    W+ H           E G    V F L Q       +  + S+NS    ++V++  K +   R++ A+  + +   L K ++LG   ++  D   F N    DI        N +Q +A+ +A+    +LI GPPGTGKT +G  + Y F Q N              ++ +++YCGPSN  V+++A +   K+  +
Sbjct:  259 QLFVVQVIAWRKGFYYPLGIVTRILRPIQRLDDGLEVLDLEFGVTGTGQYPLGASEEASRLCREAQVEV-GRRDCRNILTFTVDPRDAKDLDDAISVQERDGHYEIGVHITDLASVIPPGGDLDREAMRRGVTFYSPKREA---AHMLPVPMCTARCSLKPLCERRALSLF------VLVEKETDW--MVSGHLCQSVISSDRQLSYEEANAILA--DQGSHSAFGSVEGCLAACWHFSQVHRAHRLQEAAT-------YKQPDEKCPPGARKAQMMIEEMMILYNSWVADFLTGKDSAMDLVPVRCQAPPTLRKIQELRDKFSHLLPLSSYLSHHLLEAPESPGPAPESPGLAPEQRITVFTPVWQQIEECAARGDYDGARDLLLTDDLHPELCHAVREFRRNLGRASTIRSGTADA--TGHYSLQLWAYTWASSPLRRYLDIVVQRLLQGILVGSVPPVAPKDMDFLCHHFERKVHQAASYERKGLAMELALALRGRGQQKLAVVVSV---DAAGSSFQLVFPMNGDSLAAPMKVEYRYLQLAQQPEGIPGGVR-----LSWRRRVYCYHTYREKPLGHKRRSDITT--------FSARAWYDALY-----ALSLSDPGQALCTLHKGVEVAEDGAEVQQSSCGHHTN--LTLELK--PGDTLPVQLCSAQERGIPMPRPQLFSPTPGIHICLEHSESPVDCFS-----GLAHRAPLRCYGNAQEYQAVWGPLCAMEAAMSAVGEGNAVVLRNVPIRW--------HNKDTGGGPARKGSFKLTPPLIADCELDMD-----------FQNC---YLCLRMEGLQGAQAESPLDSHLYTWVAHCLTDPSNHVTEEHG--GAVTFHLHQRPNQEIPEAVLHSDNS----FTVELIPKLLPDIRKEAALDQMKEASELAKNIVLG-KRVTETDITTFRNERNFDIPALG-RGLNPSQREAVQSALRGPFTLIQGPPGTGKTVVGVHIIYWFHQMNQGAVPPCAQEGEGPDRKLLMYCGPSNKSVDVLAGKGGAKWGSV 1212          
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Match: UPF1 (UPF1 regulator of nonsense transcripts homolog [Source:NCBI gene;Acc:100135270])

HSP 1 Score: 159.844 bits (403), Expect = 1.434e-38
Identity = 189/765 (24.71%), Postives = 311/765 (40.65%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR   ES  ++     +  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  282 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIRNM-ESMPEL-----QKLQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 886          
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Match: UPF1 (UPF1 regulator of nonsense transcripts homolog [Source:NCBI gene;Acc:100135270])

HSP 1 Score: 159.844 bits (403), Expect = 1.447e-38
Identity = 189/765 (24.71%), Postives = 311/765 (40.65%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR   ES  ++     +  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  277 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIRNM-ESMPEL-----QKLQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 881          
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Match: UPF1 (UPF1 regulator of nonsense transcripts homolog [Source:NCBI gene;Acc:100135270])

HSP 1 Score: 159.844 bits (403), Expect = 1.452e-38
Identity = 189/765 (24.71%), Postives = 311/765 (40.65%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR   ES  ++     +  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  289 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIRNM-ESMPEL-----QKLQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 893          
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Match: UPF1 (UPF1 regulator of nonsense transcripts homolog [Source:NCBI gene;Acc:100135270])

HSP 1 Score: 159.458 bits (402), Expect = 1.732e-38
Identity = 189/765 (24.71%), Postives = 311/765 (40.65%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR   ES  ++     +  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  303 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIRNM-ESMPEL-----QKLQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 907          
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Match: Helz2 (helicase with zinc finger 2, transcriptional coactivator [Source:MGI Symbol;Acc:MGI:2385169])

HSP 1 Score: 288.115 bits (736), Expect = 1.799e-77
Identity = 195/565 (34.51%), Postives = 292/565 (51.68%), Query Frame = 2
Query: 4142 KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGE-------LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERN 5776
            K NQ+Q +A+ +A+  + ++I GPPGTGKT +G  + Y F + N                    VLYCGPSN  V+++   + ++ +++ P  LR+YGEQ E  +FPLPG  +++    T +       L+ I+LH+ IRQ    +A    +  + F   L   + +S  E++R         YR  + +A+K+ +   ++ ++LCT +  A+  +++ N+ QI+IDEAGM  EPETLIP+     TVE VVL+GDHKQLRP++ ++  + LG++ SLFERY     +   ML+ QYRMH  IC FPS EFY  +LKT                                                  W   R +P    + G  +    ++F  V G E    V+T+ GNENSR NP+EV  V     +II+ LT  R   P  I VLT Y  Q   +          ++  T   V ++ +SQGS+  Y+I STVR+   R D++Q PT  W K++LGF+ DP+Q+NVA+TRAQ+ L IIG+  LLR   +W RL+   E ++
Sbjct: 2448 KLNQSQDRAVRSALQKQFTVIQGPPGTGKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRKTEMKP--LRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYA----AEIRKFDAQLREGKIFS-KEDLR--------VYRRVLGKARKHEL--ERHSVILCTCSCAASKSLKILNVRQILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERYH----RDAIMLDTQYRMHKDICSFPSVEFYGGKLKT--------------------------------------------------WSDLRRLPSILGHTG--KPSCSVIFGSVQGHEQKLLVSTEDGNENSRANPEEVTQV----VRIIKQLTLDRTVDPKDIAVLTPYNAQAAAIS-----RGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRTC-PRSDVDQRPTKSWLKKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQH 2929          

HSP 2 Score: 70.4774 bits (171), Expect = 3.288e-11
Identity = 116/596 (19.46%), Postives = 228/596 (38.26%), Query Frame = 2
Query: 1049 PKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-----NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQ-PN---QIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF---EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSI-DIDKARSLLQYDAYYNDFF---VHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLL-------KSVLNGTEIDDITLD 2767
            P +  G+VMGV +     +   ++C++      +M P++ S  KI V      ++  ++ + + + + +++E     D    L                                         F V    W   F YP G ++  +    +++    ++ L   +     +P  ++   Q+   E+   A        +L      FT+D +   ++DDALS    G    + VHI DV   +     +  +A  +   +Y P   N  P+ +L  +L  D LSL P + R  +S        + +  +    +I    F   +I S  +L+YEE    +K+ P    ++P   +++   +      +  +RR RL  + +       Y+  D +++     A I+++E+M+  N +VA  +       TL  ++       + L+++F      + G +    +L +    ++   K+L +  + ++Q        D  +   L+  D  +       + +R     +   R   S        H SL    YT  TSPIRR+ D+V+ RL+        S  +  +ID + LD
Sbjct: 1417 PGSLQGRVMGVLKRRRHEL--AFVCRMDEWDPRIMIPINGSVTKIFVAEMKDPQQVPIHRLIQGQVQRVRHETLKPEDRSTRL-----------------------------------------FWVRIVLWRERFYYPLGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRHFL-----TFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAP---NREPVLMLPASLCQDALSLLPGQDRLAIS--------LFLTMEKGGGQIKSLRFAPSIIRSDRQLSYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLSAACY-------YEPPDEDSVLGFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFK----KYRGLVPLSLHLCHHSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACLDLRRALGRSVFGR--SSQGKQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGSTYSNRDIDGLCLD 1940          
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Match: Helz2 (helicase with zinc finger 2, transcriptional coactivator [Source:MGI Symbol;Acc:MGI:2385169])

HSP 1 Score: 288.115 bits (736), Expect = 1.810e-77
Identity = 195/565 (34.51%), Postives = 292/565 (51.68%), Query Frame = 2
Query: 4142 KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGE-------LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERN 5776
            K NQ+Q +A+ +A+  + ++I GPPGTGKT +G  + Y F + N                    VLYCGPSN  V+++   + ++ +++ P  LR+YGEQ E  +FPLPG  +++    T +       L+ I+LH+ IRQ    +A    +  + F   L   + +S  E++R         YR  + +A+K+ +   ++ ++LCT +  A+  +++ N+ QI+IDEAGM  EPETLIP+     TVE VVL+GDHKQLRP++ ++  + LG++ SLFERY     +   ML+ QYRMH  IC FPS EFY  +LKT                                                  W   R +P    + G  +    ++F  V G E    V+T+ GNENSR NP+EV  V     +II+ LT  R   P  I VLT Y  Q   +          ++  T   V ++ +SQGS+  Y+I STVR+   R D++Q PT  W K++LGF+ DP+Q+NVA+TRAQ+ L IIG+  LLR   +W RL+   E ++
Sbjct: 2448 KLNQSQDRAVRSALQKQFTVIQGPPGTGKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRKTEMKP--LRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYA----AEIRKFDAQLREGKIFS-KEDLR--------VYRRVLGKARKHEL--ERHSVILCTCSCAASKSLKILNVRQILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERYH----RDAIMLDTQYRMHKDICSFPSVEFYGGKLKT--------------------------------------------------WSDLRRLPSILGHTG--KPSCSVIFGSVQGHEQKLLVSTEDGNENSRANPEEVTQV----VRIIKQLTLDRTVDPKDIAVLTPYNAQAAAIS-----RGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRTC-PRSDVDQRPTKSWLKKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQH 2929          

HSP 2 Score: 70.4774 bits (171), Expect = 3.291e-11
Identity = 116/596 (19.46%), Postives = 228/596 (38.26%), Query Frame = 2
Query: 1049 PKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-----NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQ-PN---QIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF---EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSI-DIDKARSLLQYDAYYNDFF---VHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLL-------KSVLNGTEIDDITLD 2767
            P +  G+VMGV +     +   ++C++      +M P++ S  KI V      ++  ++ + + + + +++E     D    L                                         F V    W   F YP G ++  +    +++    ++ L   +     +P  ++   Q+   E+   A        +L      FT+D +   ++DDALS    G    + VHI DV   +     +  +A  +   +Y P   N  P+ +L  +L  D LSL P + R  +S        + +  +    +I    F   +I S  +L+YEE    +K+ P    ++P   +++   +      +  +RR RL  + +       Y+  D +++     A I+++E+M+  N +VA  +       TL  ++       + L+++F      + G +    +L +    ++   K+L +  + ++Q        D  +   L+  D  +       + +R     +   R   S        H SL    YT  TSPIRR+ D+V+ RL+        S  +  +ID + LD
Sbjct: 1417 PGSLQGRVMGVLKRRRHEL--AFVCRMDEWDPRIMIPINGSVTKIFVAEMKDPQQVPIHRLIQGQVQRVRHETLKPEDRSTRL-----------------------------------------FWVRIVLWRERFYYPLGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRHFL-----TFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAP---NREPVLMLPASLCQDALSLLPGQDRLAIS--------LFLTMEKGGGQIKSLRFAPSIIRSDRQLSYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLSAACY-------YEPPDEDSVLGFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFK----KYRGLVPLSLHLCHHSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACLDLRRALGRSVFGR--SSQGKQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGSTYSNRDIDGLCLD 1940          
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Match: Helz2 (helicase with zinc finger 2, transcriptional coactivator [Source:MGI Symbol;Acc:MGI:2385169])

HSP 1 Score: 264.618 bits (675), Expect = 3.051e-70
Identity = 185/540 (34.26%), Postives = 274/540 (50.74%), Query Frame = 2
Query: 4217 GTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGE-------LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERN 5776
            GTGKT +G  + Y F + N                    VLYCGPSN  V+++   + ++ +++ P  LR+YGEQ E  +FPLPG  +++    T +       L+ I+LH+ IRQ    +A    +  + F   L   + +S  E++R         YR  + +A+K+ +   ++ ++LCT +  A+  +++ N+ QI+IDEAGM  EPETLIP+     TVE VVL+GDHKQLRP++ ++  + LG++ SLFERY     +   ML+ QYRMH  IC FPS EFY  +LKT                                                  W   R +P    + G  +    ++F  V G E    V+T+ GNENSR NP+EV  V     +II+ LT  R   P  I VLT Y  Q   +          ++  T   V ++ +SQGS+  Y+I STVR+   R D++Q PT  W K++LGF+ DP+Q+NVA+TRAQ+ L IIG+  LLR   +W RL+   E ++
Sbjct: 2429 GTGKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRKTEMKP--LRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYA----AEIRKFDAQLREGKIFS-KEDLR--------VYRRVLGKARKHEL--ERHSVILCTCSCAASKSLKILNVRQILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERYH----RDAIMLDTQYRMHKDICSFPSVEFYGGKLKT--------------------------------------------------WSDLRRLPSILGHTG--KPSCSVIFGSVQGHEQKLLVSTEDGNENSRANPEEVTQV----VRIIKQLTLDRTVDPKDIAVLTPYNAQAAAIS-----RGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRTC-PRSDVDQRPTKSWLKKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQH 2885          

HSP 2 Score: 70.4774 bits (171), Expect = 3.282e-11
Identity = 116/596 (19.46%), Postives = 228/596 (38.26%), Query Frame = 2
Query: 1049 PKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-----NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQ-PN---QIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF---EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSI-DIDKARSLLQYDAYYNDFF---VHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLL-------KSVLNGTEIDDITLD 2767
            P +  G+VMGV +     +   ++C++      +M P++ S  KI V      ++  ++ + + + + +++E     D    L                                         F V    W   F YP G ++  +    +++    ++ L   +     +P  ++   Q+   E+   A        +L      FT+D +   ++DDALS    G    + VHI DV   +     +  +A  +   +Y P   N  P+ +L  +L  D LSL P + R  +S        + +  +    +I    F   +I S  +L+YEE    +K+ P    ++P   +++   +      +  +RR RL  + +       Y+  D +++     A I+++E+M+  N +VA  +       TL  ++       + L+++F      + G +    +L +    ++   K+L +  + ++Q        D  +   L+  D  +       + +R     +   R   S        H SL    YT  TSPIRR+ D+V+ RL+        S  +  +ID + LD
Sbjct: 1417 PGSLQGRVMGVLKRRRHEL--AFVCRMDEWDPRIMIPINGSVTKIFVAEMKDPQQVPIHRLIQGQVQRVRHETLKPEDRSTRL-----------------------------------------FWVRIVLWRERFYYPLGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRHFL-----TFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAP---NREPVLMLPASLCQDALSLLPGQDRLAIS--------LFLTMEKGGGQIKSLRFAPSIIRSDRQLSYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLSAACY-------YEPPDEDSVLGFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFK----KYRGLVPLSLHLCHHSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACLDLRRALGRSVFGR--SSQGKQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGSTYSNRDIDGLCLD 1940          
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Match: Upf1 (UPF1 regulator of nonsense transcripts homolog (yeast) [Source:MGI Symbol;Acc:MGI:107995])

HSP 1 Score: 166.777 bits (421), Expect = 7.906e-41
Identity = 190/765 (24.84%), Postives = 312/765 (40.78%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS      ++  R    + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  291 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAFFTLP-------------KTDSGNEDLVIIWLRDMRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPI-RLQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVE 906          
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Match: Upf1 (UPF1 regulator of nonsense transcripts homolog (yeast) [Source:MGI Symbol;Acc:MGI:107995])

HSP 1 Score: 159.844 bits (403), Expect = 9.689e-39
Identity = 189/765 (24.71%), Postives = 310/765 (40.52%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  291 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAFFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPI-RLQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVE 895          
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Match: sp|E9QAM5|HELZ2_MOUSE (Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.258e-76
Identity = 195/565 (34.51%), Postives = 292/565 (51.68%), Query Frame = 2
Query: 4142 KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGE-------LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERN 5776
            K NQ+Q +A+ +A+  + ++I GPPGTGKT +G  + Y F + N                    VLYCGPSN  V+++   + ++ +++ P  LR+YGEQ E  +FPLPG  +++    T +       L+ I+LH+ IRQ    +A    +  + F   L   + +S  E++R         YR  + +A+K+ +   ++ ++LCT +  A+  +++ N+ QI+IDEAGM  EPETLIP+     TVE VVL+GDHKQLRP++ ++  + LG++ SLFERY     +   ML+ QYRMH  IC FPS EFY  +LKT                                                  W   R +P    + G  +    ++F  V G E    V+T+ GNENSR NP+EV  V     +II+ LT  R   P  I VLT Y  Q   +          ++  T   V ++ +SQGS+  Y+I STVR+   R D++Q PT  W K++LGF+ DP+Q+NVA+TRAQ+ L IIG+  LLR   +W RL+   E ++
Sbjct: 2448 KLNQSQDRAVRSALQKQFTVIQGPPGTGKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRKTEMKP--LRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYA----AEIRKFDAQLREGKIFS-KEDLR--------VYRRVLGKARKHEL--ERHSVILCTCSCAASKSLKILNVRQILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERYH----RDAIMLDTQYRMHKDICSFPSVEFYGGKLKT--------------------------------------------------WSDLRRLPSILGHTG--KPSCSVIFGSVQGHEQKLLVSTEDGNENSRANPEEVTQV----VRIIKQLTLDRTVDPKDIAVLTPYNAQAAAIS-----RGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRTC-PRSDVDQRPTKSWLKKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQH 2929          

HSP 2 Score: 70.4774 bits (171), Expect = 2.300e-10
Identity = 116/596 (19.46%), Postives = 228/596 (38.26%), Query Frame = 2
Query: 1049 PKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQI-----NPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQ-PN---QIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF---EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSI-DIDKARSLLQYDAYYNDFF---VHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLL-------KSVLNGTEIDDITLD 2767
            P +  G+VMGV +     +   ++C++      +M P++ S  KI V      ++  ++ + + + + +++E     D    L                                         F V    W   F YP G ++  +    +++    ++ L   +     +P  ++   Q+   E+   A        +L      FT+D +   ++DDALS    G    + VHI DV   +     +  +A  +   +Y P   N  P+ +L  +L  D LSL P + R  +S        + +  +    +I    F   +I S  +L+YEE    +K+ P    ++P   +++   +      +  +RR RL  + +       Y+  D +++     A I+++E+M+  N +VA  +       TL  ++       + L+++F      + G +    +L +    ++   K+L +  + ++Q        D  +   L+  D  +       + +R     +   R   S        H SL    YT  TSPIRR+ D+V+ RL+        S  +  +ID + LD
Sbjct: 1417 PGSLQGRVMGVLKRRRHEL--AFVCRMDEWDPRIMIPINGSVTKIFVAEMKDPQQVPIHRLIQGQVQRVRHETLKPEDRSTRL-----------------------------------------FWVRIVLWRERFYYPLGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRHFL-----TFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAP---NREPVLMLPASLCQDALSLLPGQDRLAIS--------LFLTMEKGGGQIKSLRFAPSIIRSDRQLSYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLSAACY-------YEPPDEDSVLGFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFK----KYRGLVPLSLHLCHHSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACLDLRRALGRSVFGR--SSQGKQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGSTYSNRDIDGLCLD 1940          
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BYK8|HELZ2_HUMAN (Helicase with zinc finger domain 2 OS=Homo sapiens OX=9606 GN=HELZ2 PE=1 SV=6)

HSP 1 Score: 285.034 bits (728), Expect = 1.063e-75
Identity = 240/834 (28.78%), Postives = 387/834 (46.40%), Query Frame = 2
Query: 3365 NGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLL------ERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVV---HVAKPKLESGEFKIVIFM----LTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSID-THPLLKEVILGINELSPDDE---NNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG------------VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKT---NVPLTGE----LQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ-SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLI 5755
            +G     P+L  V+P F +CL H + P   F   G++   +   +  + D+ EY   + P   +ES    + E  + TL  +++ W   E+  T + +  G  +L   F +      N        R E L         G SS+G  L       D     W+ HG+        +   +    ++ +F+    + +   ++    +    ++V++  K +   R++EA+  ++   PL+  + LG     P      + F+     +I   R  K N +Q+ A+  A+    ++I GPPGTGKT +G  + + F + N      G             +LYCGPSN  V+++A  + ++  +L P  LR+Y EQ E ++FP+P   S+      P  G     L+ I+LH+ IRQ    ++  + + D   Q+     R               ++ Y+  + EA+K  +  +++E++LCT +  A+  +++ ++ QI++DEAGM  EPETLIP+       E VVL+GDHKQLRP++ N+  + LGL+ SLFERY E       ML+ QYRMH  IC FPS  FY  +LKT     W GL                          S+L  +   + P                         ++F HV G E    V+T  GNENS+ N +EV  V     +I + LT  R   P  I VLT Y  Q   +         +++      V ++ +SQGS+  Y++ STVR+   + D++Q PT  W K++LGF+ DPNQ+NVA+TRAQ+GL +IG+  LLR   +W+ L+
Sbjct: 1893 HGFLVPSPQLWTVAPGFSLCLEHVERPGDCF--SGRV---YRAPRDRYRDVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSW---EASRTPQGQLQGAFRLEAAFLEENCADINFSCCYLCIRLEGLPAPTASPRPGPSSLGPGL-----NVDPGTYTWVAHGQTQDWDQERRADRQEAPRRVHLFVHHMGMEKVPEEVLRPGTL---FTVELLPKQLPDLRKEEAVRGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYNIPGGR-HKLNPSQNVAVREALEKPFTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDVLAGLLLRRM-ELKP--LRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRSITLHHRIRQAPNPYSSEIKAFDTRLQRGELFSRE-------------DLVWYKKVLWEARKFEL--DRHEVILCTCSCAASASLKILDVRQILVDEAGMATEPETLIPLVQFPQA-EKVVLLGDHKQLRPVVKNERLQNLGLDRSLFERYHE----DAHMLDTQYRMHEGICAFPSVAFYKSKLKT-----WQGL----------------------RRPPSVLGHAGKESCP-------------------------VIFGHVQGHERSLLVSTDEGNENSKANLEEVAEV----VRITKQLTLGRTVEPQDIAVLTPYNAQASEIS-----KALRREGIAGVAVSSITKSQGSEWRYVLVSTVRTCA-KSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLL 2624          

HSP 2 Score: 63.1586 bits (152), Expect = 3.125e-8
Identity = 102/467 (21.84%), Postives = 178/467 (38.12%), Query Frame = 2
Query:  932 AIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKI----NDPKNH-TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISL--ICQINPLD---ITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYF------VCSVNDCY---KDMDIETIFE-ARIVIEEFMLLANEYVA 2272
            AIP+D   D     I++  R +CG  AF  D V V++      P+    G+V+GV +     +   ++C++      +M P++ S  KI V       +  +  + + + + +  E+ +    E   SR                                       F V    W   F YP G +   +    +++    ++ L    ++ P D   IT   QK   E+ + A       ++L      FT+D +   ++DDALS    G    + VHITDV  ++     +  +A  +   +Y P      P+ +L  +L  DVLSL P + R  +S        + +  +    ++    F   V+ S  +L+YEE    ++Q    P     L   L+ + A         +   YF          +DC+    D D    F  A I+++E+M+  N  VA
Sbjct: 1144 AIPLD---DASSGPIQVRGRLDCGM-AFAGDEVLVQLLSGDKAPEGRLRGRVLGVLKRKRHEL--AFVCRMDTWDPRIMVPINGSVTKIFVAELKDPSQVPIYSLRKGRLQRVGLERLTA---EARHSRL--------------------------------------FWVQIVLWRQGFYYPLGIVREVLPEASTWEQGLRILGLEYSLRVPPSDQATITKVLQKYHTELGRVAGRREDCRAFL-----TFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVPRDGVLDVEARRQGAAFYAP---GREPVPMLPASLCQDVLSLLPGRDRLAIS--------LFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH---PGAGRELPARLDSVDACV-------VAACYFSRLLRRHRLRSDCFYEQPDEDGTLGFRAAHIMVKEYMIQFNRLVA 1537          
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9FJR0|RENT1_ARATH (Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 1.331e-42
Identity = 198/768 (25.78%), Postives = 327/768 (42.58%), Query Frame = 2
Query: 3494 IKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFI-NSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHV-IGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            ++  + D  +YQ+ F+PL+ +E+  + + + S  +  ++T+ W +G   + K++  Y V      F K  N              E+ L      V GD L LR   D  +  W   G V+     KL + E ++ + +       I  N+     +SVD   KS    R Q A+ +           +    L  + E   + N++        + + N +Q  A+ + +   +SLI GPPGTGKT     + Y  A++      +G VL C PSN  V+    ++ +K S    K++R+  + +E    P+               + ++LHY +R     H D     + +  + L  D    LS +  +   N        +K A +  I ++  +++ CT    A   +  F   Q++IDE+    EPE LIP+      V+ VVL+GDH QL P+I  K A + GL  SLFER   L  K +  L  QYRMHP++ EFPS  FY   L+  V+ +               Q  GI++                       WP                 P R +F++V +G E I    T   N     N           +K++         P+ I V+T Y+ Q+ +++    ++   ++++  +  V +V   QG + DYII S VRS       N+H       Q +GF+ DP ++NVALTRA+ G++I+GN ++L    +W  L+   +E  C+ E
Sbjct:  311 VQPKYEDAYQYQNVFAPLIKLEADYDKMMKESQ-SKENLTVRWDIG---LNKKRVAYFV------FPKEEN--------------ELRL------VPGDELRLRYSGDAVHPSWQSVGHVI-----KLTAQE-EVALELRANQGVPIDVNHG----FSVDFVWKSTSFDRMQGAMKNFAVDETSVSGYIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKTVTSAAIVYHMAKQG-----QGQVLVCAPSNVAVD----QLAEKISATGLKVVRLCAKSREAVSSPV---------------EYLTLHYQVR-----HLDTSEKSELHKLQQLK-DEQGELSSSDEKKYKN--------LKRATEREITQSA-DVICCTCVGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLG---VKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVTLGIKPI-RLQVQYRMHPALSEFPSNSFYEGTLQNGVTII-------------ERQTTGIDF----------------------PWPV----------------PNRPMFFYVQLGQEEISASGTSYLNRTEAAN----------VEKLVTAFLKSGVVPSQIGVITPYEGQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRS-------NEH-------QGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVE 920          
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EPU0|RENT1_MOUSE (Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 5.530e-40
Identity = 190/765 (24.84%), Postives = 312/765 (40.78%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS      ++  R    + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  291 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAFFTLP-------------KTDSGNEDLVIIWLRDMRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPI-RLQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVE 906          
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92900|RENT1_HUMAN (Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 9.400e-40
Identity = 190/765 (24.84%), Postives = 312/765 (40.78%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS      ++  R    + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P               +  ++LH  IR     + D +    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  296 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSGNEDLVIIWLRDMRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEV------THNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQ-----GNGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSP---------------VSFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSADEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRVKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 911          
BLAST of RNB domain-containing protein vs. TrEMBL
Match: A0A210QEW8 (Helicase with zinc finger domain 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08385 PE=4 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 9.232e-148
Identity = 485/1752 (27.68%), Postives = 790/1752 (45.09%), Query Frame = 2
Query:  893 KCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHT-------------------GKVMG-VYESNHKPV-NSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNE-QKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNP-ETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSV-------VFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQ--PTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVN-DCYKDMDIETIF---EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQD--PVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRP---------DNFDARKKLIVS--KNFYEQFNNFL-SIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYEC--SVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQK-ASSIKEIKFADLSLNAVPLSLKNDEKA---ESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSF-VNQTFDT--VISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPA--------IKPELHIVSPTFQI---------CLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFN------------DERDSNGSRYEVLLERGFSSVGGDLLCLRLKKD-------------NWNNYWIGHGEVVHVAK-PKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENN--FINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKG----VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFF------SKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKI--LTTDRNYSLSENIREAI--HNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIM---ELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            KC LK  +AH      +    D+K  EI++  R  CG N  ++++V   +N+ +  +                   GKV+G +     + + + + +C +   +  LM PLDK+ PK+H+ N                 K+++N  Q  V D +      + +L +S                  +VV  NP +   + F+V +  WD   +YP G ++  + S     +   ++ L  Q+ P        + V  I   +     P   L  D +       VFTID + +KD+DD LS  +   ++  +GVHI DVT Y+     I ++A+SR  T+YP       P H+L + L+ ++ SL PNK +  +SV   F             E+I+   + +Q V+ S+ + +Y++V   +        D E     + ++F +AK +R  RL ES     +  D     + E +F   EA  ++EEFM+LAN   A  +   + D  LLR Q+  P +   +WL +   + ++           L N++P         +   AR ++++   K  +      +   +   A  L+  D ++ +  +   EW      A Y C  S+K+  E  HF+LN   YTHFTSPIRR+ DIV HRL+ + LN  E+     +I ++C   N+     K + K C     +    ++   + +     ++++ I+   P +Q    + +E++   L ++  P  +K+ +     +   L W+K +YS   Y  ST    N  VD  Q      F  Y  +Q++ +     V +      LK +F VN  +     + S   +  + ++D+  ++  +  +   FC++ ++   A         +P+  ++ PT QI         CL H  DPV +       K +    K     I EY + +  L+ +E+     G   A T+ D+ +          K  E+ G   +  DFC+ RNI F+            D+ +S+ ++Y             D LCL+ + +                  W+ HG+V  + K  K+   E   ++   +QS      N+      SV++  K   ++R + A+  +D    L + I    ++   D+N+      ++ +++   + + N  Q QA+  A+ ++ +LI GPPGTGKT  G  L Y F + N     +G     V+YCGPSN  V+LVA   KKK  +  P+++R+YG   E  DFP+PG           N P   +LQ I+LH LIRQ+G+ HAD +   DKYFQ+     +  ++ L+E  +  +  +NS+LS     K  ++ L     Y+++ CTT +T            I Q IIDE GMC EPE+L  + + +   E VVLIGDHKQLRP++  + A +LGLE SLFERY E        L+ QYRM+P IC+F S EFY  +L T  S  W        E+   S W                           K+P   HI                 F HV G+E    V+T+ GNE+S  N  EVE V  +++++   L     +P +I +++QY  Q H ++    D            V TV+ SQG + DY+IFST RS+ + + I   PT+GW KQ LGFITD +QI+VAL+RA+KGL+IIGN+ LL+ + +WK L+    +R CV
Sbjct:  643 KCTLKIESAHKAICGLLQPEGDLK--EIEISGRSKCGKNFMEDEVVVEILNNDQKQSDVIPRLNKKLKTTGAETKYGKVVGRLSRKRFRDIEHPVLVCGLDELEYHLMRPLDKTVPKLHIFN-----------------KHVENNFQVEVYDYDS----CSCDLKFS------------------NVVNINPAQKHSYVFLVVFIRWDA--VYPLGAVIKVMRSDGGINSGLKILELQHQV-PTTYNHDTIQSVQSIM--STMPEEPAPILTEDRIDFSESLSVFTIDPKDSKDLDDGLSIQRLSDNVYEVGVHIADVTSYVHKGDAIDEEAKSRATTFYPGHAKP--PYHMLPEPLSQNLCSLLPNKKKLALSVFLYFSAD---------GELIRQRTSIKQTVVKSRRQFSYQDVQDIILDSTV---DDETTSSDIIDLFRIAKGLRWRRLGESMHSFPIEVDLLNGRESERMFDTLEAHFLVEEFMILANMTAASLVSSSFRDCALLRCQNAPPPEKVNQWLNDYPRIADV--------ILKLQNIKPTPQRQLKIANAPKARYRVVIELQKWIWSCLEQHVKDGNYRDACKLIGSDEFHPEQAIAWNEWICFQEHAEYRCLGSMKNRKERFHFTLNISPYTHFTSPIRRYADIVTHRLVHAALNKKEVPYTRCEIEDICYHINEVSRRAKQYSKQCRALH-YGHVLRRNPAMFNGFIETVSDKCIQLCIPGMQGLPQNCRELQLNLLGVSRKPDIIKDRDDDRPFDILTLAWQKRLYSHRGYAPSTRGLENIRVDPHQ---RAIFQQYLRWQDLLK-----VLVHGDTKLLKKNFAVNADYQEGDQLKSYVPACTSTVVDVSSEVR-QGAITKHFCEFSMSFNHAQILLVQIGAEPQKGVLVPTPQILELTNNFILCLQHTSDPVKYLAKYATRKAHTENYKS----IAEYLEVWLSLIRMEAAT-MAGHDDAITVNDLPV----------KLNEKDGTFSMTMDFCEDRNIEFSSMSMEFILHGNEDDENSDETKY---------VPSSDFLCLKCRYEVDDVIYKGLKGSPGEQRIWLAHGQVDKIKKMKKMGRIEVHFLLHPSSQSLPPQLLNSERKPKCSVEIMAKPESNRRTEAALLCLDKANGLAQKIAMRFKIPALDKNHLALARRMEAEVDVVGLARNNTKQYQAIQQALTNRFTLIQGPPGTGKTFTGMKLLYLFTKLNRVWHQEGNPLKQVVYCGPSNKSVDLVARWTKKKLGEHAPRMVRMYGSSHECMDFPIPGKLYSHKSRRAKNRP-DEDLQDIALHRLIRQEGKPHADEILEFDKYFQQFHNCPSISDHDLAETFKNKLKDYNSLLS-----KAGQEEL---QHYDVIFCTTAMTTNPKFIRGTKDKIFQCIIDENGMCTEPESLATIIATK--AEQVVLIGDHKQLRPVVMCQHAARLGLEKSLFERYSE----KAVFLSTQYRMNPRICDFVSAEFYNDKLDTAPSRAWK-------EETPLSIW---------------------------KYPDVPHI-----------------FCHVEGEEEYLTVSTEEGNEHSCSNKAEVEKVMQVFRRM---LKTEGVNPRYINIISQYNAQCHAIKTALVDSGYINCN-----VNTVVASQGGEWDYVIFSTTRSLPDYK-IEPIPTLGWCKQNLGFITDEHQIDVALSRARKGLVIIGNENLLQCHKVWKHLLDHYRKRECV 2217          
BLAST of RNB domain-containing protein vs. TrEMBL
Match: A0A210QEY4 (Helicase with zinc finger domain 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08384 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 7.933e-147
Identity = 500/1761 (28.39%), Postives = 793/1761 (45.03%), Query Frame = 2
Query:  896 CILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHT----------------GKVMGVYES-NHKPV-NSIYICKVSRDQGSLMSPLDKSFPKIHVDNE------PGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHF-FIVCYEYWDPYFMYPNGKIVGTISSYDS-FKNNFPLISLICQINPL--DITPRYQKEVDEIKKKAVCIHVPGSY--LPTDSVVFTIDSETTKDMDDALSFHKEGSDI-IIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKN--CGEWLENLFNLTNMNFAGQLKEF--------CNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENK---HFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTE-IDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEI-KFADLSL-----NAVPLSL---KNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNS----QFDCHLP--FSSYKLFQEIRRSYLPA--------VKLKDK------LHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQI--CLIHRDDPVPFFIPGGKLKLNHNTI--KKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNI--------IFND--ERDSNGSRYEVLLERGF--SSVGGDLLCLR--LKKD--------------NWNNYWIGHGEVVHVAKPKLES-GEFKIVIFMLTQSDFDIFSNNSNIQNY-SVDVYLKSVVSKRQQEAI------SSIDTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYR----IRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTG-----ELQQ--ISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREA-IHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNIT-----QIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKL------VTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLE 5767
            C L+  ++HS  A  ++   ++K   I ++ R  CG  AF  D V V+I + KN                  GKVMG  +    K V + ++I       G LM P+ K+ PKI V  E      P +R ++V   E  ++K I                    L Y                  + +    PE  D + F+VC+ +W   ++YP G ++G + +  +       +I +  Q+  L  ++T R  + + E   +       GS   L      FTID   +KD+DDALS      D  ++GVHI DVT  +S    + K+A SR  TYY         +H+L + L+ D LSL PN+ RA +SV F      +I        +  P  R+  I S+ +LTYEE  + +       +D  +    L  + A  ++  R +     F   ++D  +  +I    EA  ++EEFM++AN  V + + E+      LR QD  +N     WL     L ++  A Q ++          N+ NV P  +  R   I +  +    +     DI + + L+  D  +      ++EW      A+Y+CS       K   HFSL    Y HFTSPIRR+ DIV+HRLL + ++G + +     +I ++C   NK    ++ ++K C    +     +K    L     D+++E +    P L+   +   + +F+ L +     N+V L L      EK E   + W++ IY  +  F+  + +   + D+S    + D H    F  Y  + E+  ++L          +K  +K       H+   S +    D    + +    NPI   +L   +  T+ +Q       G   + P + +   T  +  CL H D+PV F    G+    ++T+  K  +  ++ Y   + P+  +ES    +    + T+  + I++          + + G   L   +C+ R I        IF D  E D+       L E+G     +  + LC+R  +K+               +    WIGHGE  H+ K K++  G    + F L   +     N + I +  ++++ +KS V +R +  +      + + T   L + I  +N+L  +        I  D+E   + K N  Q +A+ NA   + SLI GPPGTGKT  G  L Y F   N R       +  +++ GPSN  V+LVA ++  +     PK++R+YG+  E  DFP+PG  S ++  L       +L++  + LH++IR+ G+ +A+ +   D+ F        N S + +I E   +  ILS   A KE  KN      Y+++ CTT++      +L   T     Q IIDE GMC EPE ++P+ +     E VVLIGDH QL+PII  K A  LGLE SLFERY +L+ K+       TML +QYRM+P ICEFPSK+FY ++LKT  SP W    P  +       WN  +                          +  H+P              + F H+ G E +  V+T+ GNE SR N +E + V  +YK +IE     +   N I ++TQY  Q+H ++          +   +  + TV++SQG + DY+IFSTVR++  R  I  +PTIGW ++ LGFITD +QINVALTRA+KGLIIIGNK LLR + +W+ LI   E
Sbjct:  972 CRLEIQSSHSALATLINPRRNLKT--IAILGRSKCG-QAFTEDKVVVEILNKKNFKKETSVVEREKKDADAYGKVMGTIDRVRQKDVEHPVFIATQDPHAGHLMLPICKTIPKISVLAENIKKYSPKQRMHKVEVYEYVESKGI--------------------LRY------------------QGITDIKPEERDQYRFLVCFLHWGKKYVYPRGAVIGIVRTDGTDIGTGLKIIGIQNQVPTLYDELTVREVQSIIETHNEPA----NGSREDLTERVAAFTIDPPFSKDLDDALSVLVLSRDTFLVGVHIADVTGVVSLDSNVDKEARSRCSTYY--SIPQARALHMLPEPLSQDKLSLLPNQKRAAISVFFTMKENGII--------VKTPVIRRTFIQSRRRLTYEEAQTIIHTTTSPCSDPIHAQIKLLNLLAQNRRRDRLKGALHVFPVELDDSIETNNILQNIEAHNLVEEFMIMANHAVGQYLVEECGVVVPLRCQDDPENDALSSWLNKNTYLADIIIALQDRKLYTSAGTRTLNVSNVPPSRY-TRLLPIQTWVWKAIVDAAERDDIQRVKQLIGSDDLHPQQSFALQEWISFQETAQYKCSGPMEQSKKGGYHFSLGINNYVHFTSPIRRYVDIVIHRLLHAAMDGLDKLPYTESEINDICNDMNKVRQRSRVYQKQCN-MLLLSTKLRKCPLKLVGFVEDMSDEGVTLHFPGLKNVKNQNRLLRFSLLDVVSQPQNSVDLDLLPPNTSEKRELTSVMWQRRIY-LHKGFEEKAQKIEHIDDDSTTVHRVDPHQRTIFLKYTAWVEMLNNFLDKKDSSLINLIKETEKDMHFGATHKYAQSSLKAVQDVSCQNRTSEFVNPICKFKLPFHLNQTVAVQMTADYNRG--TLSPYIQVFDMTRNVSFCLQHVDNPVKFL---GR----YSTVPSKPQYGTVENYIKTWLPIAQMESAINAVRSQESATITGIPIQF----------RGKRGKFYLKIHYCRMREIEFGNTALDIFKDDTEEDARDKPANDLKEKGVLKEIMCSNYLCIRCPVKRSIPTKHSRSVQGRIADEKVMWIGHGEFTHMRKRKVDKCGHCYEIHFRLQNDNTPAPMNEAEISDGCNLEILMKSKVDRRTENLMKLLPEATCLATAVALAKQIPKMNDLHYE----IAKEIPRDVEIGTLPKNNHQQRKAIENAFTSRFSLIQGPPGTGKTFTGIKLIYLFNLFNQRYFERTHERRQLVFSGPSNKSVDLVARQVLHRLCKHAPKIIRMYGQAYEYLDFPVPGKISCSHRKLRDSKPDEDLKESGVVLHHVIREDGKPYANEIKEFDQRF-------LNASYTASIEEIDKYQEILS--KATKEELKN------YDVIFCTTSMAGNP--KLLKATKGKVYQCIIDECGMCTEPECMVPLIATR--AEQVVLIGDHMQLQPIILCKEAGDLGLETSLFERYAKLQKKMEKLNMKYTMLVWQYRMNPKICEFPSKKFYENKLKTAKSPYWMVEQPLQI-------WNNPS--------------------------SEEHVP--------------LAFCHIEGSEEVLTVSTEQGNERSRKNKEEAQHVARVYKHLIE---VEKVKINHIQIITQYNAQRHAIK-----EALVDERIINTKINTVVKSQGCEWDYVIFSTVRTL-PRYLIEHNPTIGWCRKNLGFITDQHQINVALTRARKGLIIIGNKHLLRCDEVWRDLINKYE 2576          
BLAST of RNB domain-containing protein vs. TrEMBL
Match: A0A1S3IYB3 (helicase with zinc finger domain 2 OS=Lingula unguis OX=7574 GN=LOC106168606 PE=4 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 4.863e-143
Identity = 503/1798 (27.98%), Postives = 781/1798 (43.44%), Query Frame = 2
Query:  896 CILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPK-----NHT--GKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISL---ICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWL---KQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFN------LTNMNF---------AGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDI----TLDIGEVCTIAN------KKLNGNKNFEKICAPF---------AIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAES--CLLKWKKIIYSCNPYFKSTSNRRN------FVVDNSQFDCHLPFSSY-----KLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSI-----SLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSR---------------YEVLLER---------GFSSVGGD---------------LLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDF-DIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLL-KEVILG-------INELSPDDENNFINSIKNDIE--------------------NRRIF------------KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYR--IRNKGVVLYCGPSNDCVNLVALEMKKKFS-----------DLCPKLLRIYGEQQELADFPLP---GFFSKTNVPLTGELQQISLHYLIRQQGES-HADILSSHDK---YFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCX-XXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            C L         AIP+    + +   I+L  R   G    ++D+V    N PK     +HT  GKV+GV+        S + C +     +L  P+ ++ PKI +   P                          D  QE     D  Y  ++ ++ N      + + K +        D   +V Y  W P+ ++P G  VG +    S +    L+ +   + +  P  +  R  K + +  KK     +         V  TIDS  T+D+DDALS  + G DI  IGVHI DVT ++     I K+A +R  ++YPP   +   I +L D L T + SL   + R  +SV F F        D KL+++ + T ++ V+ S+ KL+YEE    L     PN+I N        L ++  +A KI+  RL E        D    M       A + +EEFM+LAN  + R + E +    LL    PV +  +  +  FN       T  N+          G  +     L++R   +  +K L +S+N   Q    L I   +  + L Y A++N   + ++   +M   A Y  +   S   +H  LN   YT FTSPIRR+ DIVVHR + ++L+  + DD       ++ E+C   N      KK +G     + C             I    D  F  +    C DI +  +R              ++F  + LN  P SL+ D  A+   C L+WKK +Y    + K T  +R         V+ +QF   LP   +      + Q+  ++ L  ++ K +    ++    + F+  I++D+      ++AN    ++LK+ +   +R+        G    +  L  +SP   ICL H DDPV  F     +K   +T    +TD+K YQ    PL+ +E  Q  + +  + T+ +V + W+       K +  YG + L D FC+ R I  +  ++ +G                 Y  ++ R          +S   GD                +CL     +  + W+GHG +VHV +        K V+F L      +   + +  +  +V+   + + S R + A+ S+    +L K + LG       +N+    D   F +  + D E                    +RR              + N+ Q +A+ +A+    SLI GPPGTGKT  G  L+Y F + N R     +  VLYCGPSN  V++VA   K+KFS            +CPK+LR+YG+     DFP+P         +   T   + I+LH+LIR +G     DIL    K   YF+  +  D + ++           I  Y+  V +A+++ I   Q++++LCT TT  +  ++    I Q I+DE+GMC EP+ L+P+    +  + +VLIGDHKQLRPI+ N++A+ +GLE SLFERY    P+   MLN QYRMHP IC+FPS EFY  QL +Q                              L + S     +++   +  WP       +   +      +R V  HV G+E    ++T  G E S+ N  E++ V  IY  ++   +      N I VL+QY+ Q + +E   K+   +        V TV+ SQG + D +IFSTVRSI   + I Q PT GW K  LGFITD +QINVALTR ++ LIIIGNK LLR N    +LI   E    VK+
Sbjct:  173 CTLYIETNQKAHAIPI--GTNEQIPRIELYGRTRSGLAFNESDVVVEVFNPPKRDPIPSHTYRGKVIGVWFEPRVKKFSRFACTIDDYSSNLAKPICQTVPKIKLLGFP--------------------------DYVQE----KDESYVPIYSVEYNGQ----LKYKKKMKIEAKYKDDIILLVRYLKWKPFHVFPLGVAVGVLKGSASLEREMRLLMIQHDLVKTFPTHVADRV-KALSKKHKKIPAREIKKRLDYRGVVTLTIDSADTRDIDDALSVEEIGDDITRIGVHIADVTYFVKKDDLIDKEARARGVSFYPP--HDQPRIFMLPDELTTSMCSLVEGEDRLALSVFFDF--------DKKLNKVSKHTIKRTVVKSKQKLSYEEAEDILCGTGLPNEISN-------TLKKLHHIASKIQAQRLKEGSAFNQFQDKGAPM-------AHVTVEEFMILANVTIGRSLGESFQHVLLLVQDPPVDSALQMWQKEFNQVAKHSTTLKNYRRKYDTNAPPGSKQRQLATLHLREALW--KKALELSRNGGGQ--ELLEIFSREQHAPLIYSAHWN--LIELQRPTRM---AAYSSAAIPSQYKRHHGLNMTDYTWFTSPIRRYVDIVVHRFVHAMLD--KADDTPPYTQEELKEICKEMNALHKKAKKFHGACELMQFCLQLKENTTSTILPIVTALDDSFIQLRLPCCEDIPSRHLR--------------LRFGSMGLNQRP-SLEQDTGAQIQFCPLRWKKKLYDRVAFPKPTDGKRQQRAQDWHDVNPNQFLTPLPVRVWDDIIEAVSQQNPQALLTLIQKKHENIASEAQEEKEKFNVNINTDAYRNRDGTIANKESKLQLKMTLGTVVRVLAQVKFHRGSLCPRLSLMSLSPNAHICLKHHDDPVACFCDISPVKPLDDT----YTDVKTYQSTLIPLLQIEGAQAAVIDEVSLTVRNVRVSWM------KKHRNWYGSVVLGDTFCEDRGIRLSSSQEDDGDAAANPDRIVDTGEYRGYVCIVYRDLPPDSQCVSYSGATGDCPVDHQSSHSEPSSRSICLPQYNSDAESTWLGHGLIVHVRR------RDKRVVFKLHDGIVPETIESKTYPKLATVEFLDRIMPSVRMENAVRSLGEATILAKNIALGKANLRDVMNDRDFKDVKTFFDLHEEDPEKKKQRKKRKEPSRVKSEDLFDRRTIYSKGRYLENYLPRANEKQREAVISAIMKPFSLIQGPPGTGKTLTGIRLAYLFVEWNRRNSPGERKHVLYCGPSNKSVDVVADFFKRKFSPQQYDPNDERPSICPKILRVYGKSLVNRDFPIPKEPDMPRAKDAVSTERHKDIALHHLIRSKGTKISKDILELDAKFKSYFENPVKNDVSLAI-----------INRYKRLVAKAEEDEI--KQHDVILCTCTTAGSNAVLRSGIIEQNIVDESGMCVEPDCLVPI--VHSKAKQIVLIGDHKQLRPIVLNQLARDMGLERSLFERYATQFPEQTIMLNKQYRMHPDICDFPSSEFYGGQLYSQPG----------------------------LRFSSDPMFRDFTPAAEVLWPRI----RQDRRQRRRVEDKRFVMCHVEGEEESLVISTAEGGEMSKKNKAEIQEVERIYSILVSKTSLNLSKAN-IMVLSQYRAQVNGIEKALKERHGEGVQ-----VSTVVASQGGEWDIVIFSTVRSIPEYQ-IVQRPTKGWCKVNLGFITDDHQINVALTRPRRFLIIIGNKNLLRCNPTLGKLISHYEHYGRVKD 1813          
BLAST of RNB domain-containing protein vs. TrEMBL
Match: V4A037 (RNB domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_235246 PE=4 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 5.213e-142
Identity = 472/1721 (27.43%), Postives = 781/1721 (45.38%), Query Frame = 2
Query:  893 KCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNH--TGKVMGVYESNHKPV-NSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIET-IFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPV--KNCGEWLENLFNLTNMNFAGQ---LKEFCNLLNVRPDNFDARKKLIVSKNFY-EQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYE-CSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDC-HLPFSSYKLFQEIRRSYLPAVKLKDK-------------LHQLKSSFVN------QTFDTVISSDSISLANPIIDI---ELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNI-----IFNDERDSNGSRYEVLLERGFSSVGGDLLCLR--LKKDNWNNY-WIGHGEVVHVAKPK--LESGEFKIVIFML--TQSDFDIFSNNSNIQN---YSVDVYLKSVVSKRQQEAISS--IDTHPLLKEVILGINELSPD-DENNFINSIKNDI--ENRRIFKF---NQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIR-------------NKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVP-----LTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXX-XXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQ------------SPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            KCI+   ++ S      +       ++I +  R  CG   F  D V V+I    N    GKV+G+++ N     N +++C ++ ++  LM P+ K+ PKI + +    +R+           NI N +  V  ++++ S F  + ++++   K  +                     + F+V Y  W P F YP G ++  I +Y  ++ +  ++      N   I P Y  EV +   + V +    S    D  V TID + +KD+DDAL   +   +I  +GVHI DV  ++    EI K+AE R  ++YP    +   IH+L + L+ D  SL   + R  +SV+F+         D    ++ +P  ++  + S  +LTY E    +       +D  N +  + +++ ++K IRR+RL +  +    +D +   + ET   EA  ++EE+M++ N ++ + I E++P   LLR+Q P   K   +W      + N+    Q    +     L++  DN  +   L V K+ + E      + D  K +S+L  D  +   F+    W  +   A Y+ CS   +  + HF+LN  LYTHFTSP+RRF D++ HR + + L+  +    T ++  +     ++    K + K      +  E  K+   I+    S   N+ +    P      +  +I F  L +   P     D   E+   K          + +    RR  +  N    C ++P    K++ ++  + + + + +DK             + Q+    +N       T D V      S  + + D+     K      +  Q       GLP  K  +  ++     CL H+DDPV             +T  + +  I EY   +S LV +E+  +++     F +  V + +   +S         G       FC  R++     I  DE++   +               D +C+R  + +D+ N + W+GHG++V+  K +  +ES E + V F L  T++      +  NI     +++++  +S   +R ++ +    I+++PL+K ++L  +    D D  +    I+ D+  E  +I K    N  Q +A+  ++    +LI GPPGTGKT+ G  L Y F + N  I+              K  VLYCGPSN  V++VA  + KK  + CPK++R+YG      DFP+PG  S +           +L  ++LH++IRQ+G+ +AD +   DK F+K +     +  S+ I + +   I +Y   V++A++  +    YE +LCTT V      M+   + Q IIDE GMC EPETL+P+  A+     +VLIGDHKQLRPI+    A KLGLE SLFERY E        LN QYRMHP IC FPSK+FY  +L+T         GP                                S + + K P  R I  K           +I+F+H+ G+E    V T  G+E S+ N QEV+ V    +K+ +    P              +P  I ++TQYK Q  L++ K K+         D  V TV+ SQG + DY+I STVRS+   + I   PT GW  + LGF+ D NQ NVALTRA+KGL+IIGNK +L+ +  W+ L+   E++ C+++
Sbjct: 1039 KCIINVDSSQSATCTTTENPIG---EQIVINGRSKCG-QTFSGDEVCVEIIGKANDKDCGKVVGIFKRNRSDTKNPVFLCTITGEEAHLMGPICKTVPKISIFHNQVLKRFS----------NIPNSKIEVYKMDKKKS-FKFSHFFTINPAKRQQ---------------------YIFVVVYLNWSPKFAYPKGMVIDVIQNYKDYQASLKILG-----NQFAIDPIYPSEVIQ---EIVGMKKDDSVPSYDFDVLTIDPKGSKDLDDALHITRLSENIFEVGVHIADVAHFVVKGSEIDKEAERRATSFYP---EDSRSIHMLPEPLSEDRCSLREREVRRTISVIFKL--------DANGEQLNEPVIQRSFVRSMQQLTYHEAQLIINGHRDGFSDTINGM--ITDLYRLSKSIRRSRLKKRLYHVQYSDGFLRGENETNETEAHDLVEEYMIMTNCHIGQIITEQFPRGILLRVQQPPDDKKLVQWFGQNQPVGNLILYLQGYSCQSSNGNLSLSLDNNHSDGHLTVQKSVWTEVLRAKEAKDWKKLQSILCMDDIHPSHFIARTRWNGIMESAEYKLCSGARATGSHHFTLNFNLYTHFTSPLRRFVDLINHRFIHAYLDKKKAPYTTHELQMISLHLGRRAKQQKLYGKHSKTLKLAYELTKQPAQIMG-FISQADNDGVEIEIPQWPFLKANNDIPFHLLDVCERPTV--KDTLTETSWRKRSFHTLGAVGHVRPEMKRREKLQLNPIKHCLNIPL---KMWADLLTNLISSTESEDKQRSKRCKKEVEKIIDQIGMEGINPIGTLYGTVDKVTCEGGRSNISSLTDMCRFSFKFAPGRVLCTQLSTVFEKGLPKPKFTMVKLADNLIFCLEHKDDPVTCLTKES----FESTKGRKWIQISEYVKAWSALVEMEAAVQSVQGGDTFFIEHVPVRFTTQDS---------GSFTFNHSFCSDRDVLGSIHISKDEKEKPIT---------------DFVCIRKEVAQDSDNPFIWVGHGQMVYCCKSEDYMESNELE-VYFELHGTETSSSKMRDVINIGTQDVFTLEIIPRSETDRRLKDVLKKKVIESNPLVKAIVLNSSIPVLDRDHLDLGKKIEKDLPKEELQILKLPGNNIKQHEAIEKSLTSAFTLIQGPPGTGKTYTGIKLVYLFTKINKIIKLEEPAKKGDKTIDGKNQVLYCGPSNKSVDVVARNLIKKLGNRCPKIVRVYGRTVVFCDFPVPGRASPSRAARREGQCPEDLHNVALHHIIRQKGKPYADKICEFDKKFKKEI----QFPESQGITKMM---IKTYHKLVRQAEEEEL--PLYEAILCTTGVGGNKRTMKNLKVFQCIIDECGMCTEPETLLPILVAKPN--QLVLIGDHKQLRPILMCSKAAKLGLEKSLFERYAEK----AIFLNIQYRMHPDICAFPSKQFYEGKLET---------GP--------------------------------STLWEIKQP-LRIIGGK-----------KIMFFHIEGEEEALTVHTDDGHERSKSNIQEVDKVMLSQRKLYDYQALPLVDLFRHMVRNEDINPRSINIMTQYKSQMSLIQKKIKEYNF------DNTVNTVVASQGGEWDYVILSTVRSLPLYK-IEPFPTRGWRTENLGFLADENQTNVALTRARKGLLIIGNKNVLKCDTTWRALLLHYEKQGCIQD 2592          
BLAST of RNB domain-containing protein vs. TrEMBL
Match: A0A2R2MRF9 (helicase with zinc finger domain 2 OS=Lingula unguis OX=7574 GN=LOC106154479 PE=4 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 2.800e-140
Identity = 518/1833 (28.26%), Postives = 789/1833 (43.04%), Query Frame = 2
Query:  842 LYEIYTPEQLSK--RTDLIK---CILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKI-----NDP-KNHT--GKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISL---ICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVV-FTIDSETTKDMDDALSFHKEGS-DIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFP--GRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWL---KQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCG-EWLENLFNLTNMNFAG-----------------QLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENK---HFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGT---------EIDDITLDIGEVCTIANKKLNGNKNFEKICAPFA---------IFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKA--ESCLLKWKKIIYSCNPYFKSTSNRRN-------FVVDNSQFDCHLPFSSY-----KLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSI-----SLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSR---------------YEVLLERGF---------SSVGGDL---------------LCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDF-DIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLL-KEVILG-------INELSPDDENNFI---------------------NSIK-NDIENRR------------IFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYR--IRNKGVVLYCGPSNDCVNLVALEMKKKFS-----------DLCPKLLRIYGEQQELADFPLP---GFFSKTNVPLTGELQQISLHYLIRQQGES-HADILSSHDK---YFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCX-XXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            LY+ ++   L K  R D  K   C L         AIP+    + +   I+L  R   G  AF   IV V++     NDP  +HT  GKV+GV+        S + C +   + +L  P+ ++ PKI +   P   R                 +K  AD+      +   L Y   K+K+         +  D++           +V Y  W P+ ++P G  VG +    S +    L+ +   + +  P  +  R +      K K + +H     L    VV  TID   T+D+DDALS    G     IGVHI DVT ++     I K+A +R  ++YPP  S+   I +L D L T + SL   + R  +SV F F   G ML           +PT ++ V+ S+ KL+YEE    L      N+I N       AL ++  +A K R  RL E        D    M       A + +EEFM+LAN  + R + E +    LLR+QDP  +   +  +  FN    + A                  Q+++   L  +       +K L VS+    Q    L I   +    L Y A++        +  ++  PAR       +I ++   H  LN   YT FTSPIRR+ DIVVHR + ++L+ +         E++DI  ++  +   A KK +G     + C             +    D  F  +    C DI +  +R              ++F  + LN  P SL     A  + C L+WKK +Y      K    +R          V+ +QF   +P   +      + Q+  ++    +K+K K     +   N+ F   I++D+      ++AN     +LK+ +   +R+        G    +  L  +SP   ICL H DDPV  F     +K     + + +TD K YQ    PL+ +E  Q  + +  + T+ +V + W+       K    YG + L D FC+ R I  +  ++ +G                 Y  ++ R           S   GD                +CL     +  + W+GHG +VHV +        K V+F L      +   + SN +  +V+   + + S R + A+ S+    +L + + LG       IN+    D   F                      + +K  D+ +RR            + + N+ Q +A+ +A+    SLI GPPGTGKT  G  L+Y F + N R     +  VLYCGPSN  V++VA   KKKF+            +CPK+LR+YG+     DFP+P         +   T   + I+LH+LIR +G     DIL    K   YF+  +  D +  +           I  Y+  V +A+++ I   Q++++LCT TT  +  ++    I Q I+DE+GMC EP+ L+P+    +  + +VLIGDHKQLRPI+ N++A+ +GLE SLFERY    PK   MLN QYRMHP IC+FPS EFY  QL    SP       D M +                         +++   +  WP  R  P    +K       R V  HV G+E    ++T  G E S+ N  E++ V  IY  ++   +      N I VL+QY+ Q + +E   K+   +        V TV+ SQG + D +IFSTVRSI   + I Q PT GW K  LGFITD +QINVALTR ++ LIIIGNKQLL+ +  +K+LI   EE   VK+
Sbjct:  458 LYDFHSKFMLEKKLREDPSKYKLCTLYIETNQKAHAIPI--GTNEQIPRIELYGRIRSGL-AFNESIVVVEVFNPPENDPIPSHTYRGKVIGVWLEPRVKKFSRFACTIDDYRSNLAKPICRTAPKIELLGFPDNVR-----------------EKDEADVPIYSVEYDGQLKYKK-KMKIEAK------YKDDII----------LLVRYLKWKPFRVFPLGVAVGVLKGSASLEREMRLLMIQHDLVKTFPTHVADRVKALSK--KHKKIPVHEFKKRLDYRGVVTLTIDPADTRDIDDALSVEDIGDYRTRIGVHIADVTHFVKKDDFIDKEARARGVSFYPP--SDQPRIFMLPDELTTSMCSLVEGEDRLALSVFFDFDQNGNMLS----------EPTIKRTVVKSKQKLSYEEAEMILCGTGLENEISN-------ALKQLHHIASKCRAQRLKEGSAFNQFQDNGAPM-------AHVTVEEFMILANVTIGRSLGESF-QHVLLRVQDPPMDLALQMWQKEFNQVAKHSAALKKYRLKYGANAPSGLKQVQQQGQLGTLYVREAVWKKALEVSRKGAGQ--ELLDIFSREHHVPLIYSAHW--------KINELQRPARMAACSSTAIPSQDKGHHGLNMTDYTWFTSPIRRYVDIVVHRFVHAMLDKSVDTPPYSQKELEDICKEMNALHRKA-KKFHGACELIQFCLQLKENKTSTILPVVTALDDSFIQLCLPCCKDIPSRHLR--------------LRFGSMGLNQRP-SLDKGTGAVFQFCPLRWKKRLYDRVAVPKPPGGKRQKQRAQDWHDVNPNQFLTPMPVGVWDGIIEAVSQQNAQALSTLIKMKHKTIANMAQRENELFSANINTDAYRKSDGTIANKESKFQLKVTLGTVVRVLAQAKFHRGSLCPRLSLMSLSPNVHICLKHHDDPVACFCDISPVK----PLDETYTDEKTYQSTLIPLLQIEGAQAAVIDEVSLTVSNVRVSWM------KKNANWYGSVVLGDTFCEDRGIRLSSSQEDDGDAAANPDRIVDTGEYRGYVCIVYRNLPPDSQCVSDSGATGDCPIDHQSTHSEPSSRSICLPQYNSDAESTWLGHGLIVHVRR------RDKRVVFKLLDGIIPETIESKSNPKLATVEFLDRIMPSIRMENAVRSLGEATILARNIALGKADLRDVINDRDWKDVEAFFYLHEEDPKKRMERERKKRREPSRVKPEDLLDRRTRYSKGRYLENYLPRANKRQREAVISAIMKPFSLIQGPPGTGKTLTGIRLAYLFVEWNRRNSPEERKHVLYCGPSNKSVDVVADFFKKKFTPQQYDPNDERPSICPKILRVYGKSLVNRDFPIPKEPDLLRGKDAVSTERHKDIALHHLIRSKGTKISKDILELDAKFKSYFKDPVKNDVSLEI-----------INHYKRLVAQAEEDEI--KQHDVILCTCTTAGSKAVLRSGIIEQSIVDESGMCVEPDCLVPI--VHSKAKQIVLIGDHKQLRPIVLNQLARDMGLERSLFERYATQFPKQTIMLNKQYRMHPDICDFPSSEFYDGQL---YSPPVLRFASDPMFR-------------------------DFTPAAEVLWPRIRQGPMLIEDK-------RFVMCHVEGEEESLVISTPEGGEMSKKNKAEIQEVERIYSILVSKTSLNLSKAN-IMVLSQYRAQVNGIEKALKERHGEGVQ-----VSTVVASQGGEWDIVIFSTVRSIPEYQ-IVQRPTKGWCKVNLGFITDDHQINVALTRPRRFLIIIGNKQLLKCDPTFKKLIAHYEENGRVKD 2125          
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Match: helz2 (helicase with zinc finger domain 2-like [Source:NCBI gene;Acc:103025927])

HSP 1 Score: 312.768 bits (800), Expect = 4.181e-85
Identity = 291/1114 (26.12%), Postives = 504/1114 (45.24%), Query Frame = 2
Query: 2639 HFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVC---TIANKKLNG-NKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYK-------------LFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNN--------------------YWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQN-----------YSVDVYLKSVVSKRQQEAISSIDT-HPLLKEVILGINELSPDDENNFI---NSIKNDIENRRIFKF---NQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRI----------RNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIM-ELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            H+ L    YT  +SPIRR+ D++V RLL SVL    +     ++ + C   T+ N   +   +    +     +  + ++K  +I++ + S   N +I F         ++  I + DL L   P  +   E  +  +L+W++ +YS       T  +++      +F   +P  S+K             +F+E+ +  L  V+ K  +   + + +    D +   +        I++ L++     + +Q       GL     +L +V+P F+ICL H  +P+  F      K    +  + ++   EYQ  + PL  +ES    + E  +  + D ++EW         + + +G  ++P D  K++  I ++ R+                     LC+R++    +                      WI H  V  V      +GE K V    T+  F +  N+  + N           ++V++  K +   R+  AI ++ + + L+K + +G       DE N I   N  + +IEN R   +   N +Q +A+  AMN++ +LI GPPGTGKT +G  + Y F ++N ++            K  +LYCGPSN  V++VA ++ K    L  K LR+Y +Q E+ +FP PG    +N+ ++   Q++       +    H  I  + + Y ++IL  D      + + +     I  Y+D +K+A+K+ ++  Q+ ++LCT T  +  ++ +  N  QIIIDE  M  EPE  IP+ +  +  + +VL+GDHKQL+P++H  + ++LG+ ISLFERY         ML+ QYRM   I                                            C    E   R    + +P+ +   F +I          + P  I+F HV G E+   V+T+ GNENS+GN +E +AV  I + +I++   P++    I +LT Y  Q     +     +       +  V T+++SQGS+  Y+I STVRS    E I   PT  W K+ LGF+ DP+Q+NV +TRAQ+GL +IGNK LLR  ++W++L+   E++ C+
Sbjct: 1822 HYDLELDCYTWASSPIRRYVDVIVQRLLHSVLEDDRVQYTPQEVDQCCVDFTLRNSNQSSCQRASHHLSFASKLSAQNEEKLAYIVEVSPSG-NNFQISFPLNRTSLPDTVG-IMYRDLQLEDQPRYI---EATDCMVLRWRRRVYSLTSPSIHTELKQHEANSRGKFITDVPMESWKRLVSAIRKEEWDVMFEEVEQLSLTDVRRKTTV---QPALIGARMDMLNQREE-----HYIELSLELKKGKMIEVQLGTDTYRGLLVPSVQLLVVNPKFEICLEHTKNPIMCFS-----KYALFSSSESYSSYMEYQRIWKPLCEMESACSAVAENESIVIEDASLEW------DRSKDDLWGSFRMPVDK-KAQWAIESNLRNC-------------------FLCIRMRMQQKDQNPILEDSDSKDMDLVDVPGLIWIAHAVVTKV------TGEEKSVKSTYTKITFRV--NHMPMTNIPEKVFMEGTRFTVELIPKLLPDVRKDNAIENLTSANNLVKNIAMG---KKTQDERNTIQKCNQPRFEIENHRSLGYPQLNNSQCKAIREAMNNEFTLIQGPPGTGKTVVGVHIVYWFFKQNQKLPPCQKLGDEDLKKRCILYCGPSNKSVDVVAGQLLKLKEKL--KPLRVYSDQVEIMEFPYPG----SNLKISRHCQRVEKPNEALRSITLHHKIRMTSNPYHKQILEFDERIKADQYLTD---EEIKCYKDCLKKARKHELL--QHNVILCTCTAASHPVLADALNFQQIIIDECAMATEPEAFIPLVT--HKPKQIVLLGDHKQLQPVVHTDLLQRLGMRISLFERYT----NKALMLDTQYRMQKDI--------------------------------------------CAFPSEEFYRGKLKTGIPE-RMSVFLNI---------YQNPTSILFGHVEGKELSLVVSTERGNENSKGNIEEAKAVVRIARNLIKSGIKPKE----IAILTPYNAQ-----VNEISTVLNTNGIRNVTVNTIMKSQGSEWKYVILSTVRSFPMSE-IEIQPTKAWLKKRLGFVMDPHQVNVGITRAQEGLCLIGNKNLLRCCYLWRKLLTHYEDKGCL 2799          

HSP 2 Score: 119.783 bits (299), Expect = 2.860e-26
Identity = 119/491 (24.24%), Postives = 213/491 (43.38%), Query Frame = 2
Query:  881 TDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNH--TGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQIN---PLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF---EARIVIEEFMLLANEYVARKIY--EKYPDFTLLRMQD 2323
            +D+ KC +      SG A+P+D  A      I +  RHN G  +F  D+V V+I   +     G+V+ V +  H  +   ++C +  +   +M+P++   PK+     P  +       ++     I+N +K  A+      +F          I++N+ + +                +H F+V +  W   F YP G ++  +    S +    ++    Q+    PL +    QKE++  K   +  +    +   D + FTID+  ++D+DDA+S    G    IG+HI DV  ++    ++ K A  +   +Y    S   P ++  D L+T+  SL P   R  +S        ++   D K   I + TF + VI S+ +L+YEE    L+      ND + L   L + F  A+  R+ R    +       CYK  D + +    +++ ++EE M++ N  VA ++   +K    T LR QD
Sbjct: 1300 SDIYKCEIVLERYDSGYAMPLDEPA----LRIDIKGRHNLG-QSFSGDVVSVEILTSETFPPKGRVIEVLK--HSALTKEFVCTIDTNDNQVMTPINICIPKLFT---PFWK-------DKPNHIAIRNPEKRNAE------KF----------IRINEKARR----------------NHLFVVKFLRWGKRFNYPLGMVINVLPKVTSLEEGLKVLDKEYQLERTVPLPV----QKEMESFKTTPLLTNGRKDF--RDLLTFTIDAPKSQDLDDAISVRDLGECYEIGIHIADVASFVDKDSKLDKYARQQGTAFY---VSEREPTYMFPDKLSTNDFSLLPGSDRRCIS--------LMTEVDKKTHRIQKRTFYKSVIRSKKRLSYEEAEEILRSSGN--NDFDTLEGCLVKAFQFAEVHRKCRKQSDW-------CYKSPDEDVVIGRRQSQKLVEELMIMFNHTVADRLLSEKKTTSLTPLRCQD 1715          
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Match: upf1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:103031971])

HSP 1 Score: 161.77 bits (408), Expect = 2.387e-39
Identity = 191/765 (24.97%), Postives = 310/765 (40.52%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS   R           + GD +CLR K D     W G G V+ V  P     E  I +     +  ++        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++       G VL C PSN  V+    ++ +K      K++R+  + +E  D P+                 ++LH  IR     + D +    K  Q++       S S+  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  275 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSGDMRL----------MQGDEICLRYKGD-MAPLWKGIGHVIKV--PDNYGDEIAIELRSSAGAPVEV------PHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQG-----NGPVLVCAPSNIAVD----QLTEKIHQTGLKVVRLCAKSREAIDSPV---------------SFLALHNQIR-----NMDSMPELQK-LQQLKDETGELSSSDEKR---------YRALKRTAERELLMNA--DVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRIKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 880          
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036328.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1303467:1306311:1 gene:ENSAMXG00000040064.1 transcript:ENSAMXT00000036328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 2.318e-29
Identity = 76/182 (41.76%), Postives = 104/182 (57.14%), Query Frame = 2
Query: 5246 PERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQS---PNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            P  I+F HV G+EV   V+T TGNENS  N  E E    +   ++      RQS   P  I +LT Y  Q   ++   +   +K++      V T+++SQGS+  Y+I STVRS    E I      G   + LGFITDPNQ+NVA+TRAQ GL I+GN+QLL  + +WK+L+   E +NCV
Sbjct:   35 PTAILFAHVQGEEVSLIVSTPTGNENSVSNKLEAEQAVRVADLLV------RQSGVKPEDIAILTPYNAQVCTIKQLLEKKSEKREDMQGVTVCTIMKSQGSEWPYVIVSTVRSCPLSE-IKSSKNKGRMGKKLGFITDPNQVNVAITRAQDGLCILGNRQLLESSQLWKKLVSHYERQNCV 209          
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Match: dis3 (DIS3 exosome endoribonuclease and 3'-5' exoribonuclease [Source:ZFIN;Acc:ZDB-GENE-080213-3])

HSP 1 Score: 105.145 bits (261), Expect = 3.767e-22
Identity = 118/475 (24.84%), Postives = 194/475 (40.84%), Query Frame = 2
Query: 1421 FIVCYEYWDPYFMYPNGKIV---GTISSYDS------FKNNFP-------LISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIET----------IFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSL--------LQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNG 2740
             IV  + W     YPNG  V   G     D+       +++ P       ++S + ++ P  IT    K   +++   VC               ++D     D+DDAL     E  ++ +GVHI DV+ +I   + + ++A +R  T Y         I ++ + L++++ SL  N  R   S ++              +EI+   F + +I S+  LTY E    +          +++  +L  +  +AK ++  R+ +     S  +    MD ET          + E   ++EEFMLLAN  VA+KIY+++ +  LLR                                     P N+D   K   S++        L I  D A++L        L+   Y+N     +     M   A Y CS  DS +  H+ L  P+YTHFTSPIRR++DI+VHRLL   ++ 
Sbjct:  374 IIVAIDGWPRNSRYPNGHFVRNLGGAGDKDTETEVLLLEHDVPHQPFSQTVLSFLPKM-PWGITEEDLKVRTDLRHLCVC---------------SVDPPGCTDIDDALHCRDLENGNLEVGVHIADVSHFIRPGNALDQEAANRGTTVYLCG----KRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHN---------AEILNTRFCKSIINSKASLTYAEAQMRIDDAGM----NDDITTSLRGLNKLAKILKAQRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELKETNSMVEEFMLLANISVAQKIYDEFSECALLRKHPSPP-------------------------------PSNYDILIKAAKSRD--------LDIHTDSAKALADSLNEATLEDFPYFNTLLRILATRCMMQ--AVYFCSGMDS-DFHHYGLASPIYTHFTSPIRRYSDIIVHRLLAVAISA 773          
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:103029381])

HSP 1 Score: 102.834 bits (255), Expect = 2.622e-21
Identity = 113/505 (22.38%), Postives = 193/505 (38.22%), Query Frame = 2
Query: 1412 DHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAV--CIHVPGSYLPT------DSVVFTIDSETTKDMDDALSFHK--EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWL-KQPNQIPNDKE-----------NLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARI---------VIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKIC 2833
            DH  IV  + WD   +YPNG  V  +      +     I  I   N + +    + ++ E+   +      + G+ + +        +VF+ID    +D+DD LS      G  + +GVHI DVT ++        +A SR  TYY           +L   L+ D+ SL     R  +SVL+      L        E+ +  + + +I S ++L YE   S L  +  ++P   +            L+ AL  +  +A+ +R  R           +    +D +    A +          + E M+ AN +VARKI E +P   LLR   P +      +  FN           +  +    R    D R    ++ +     +    + +++   ++   A  N  +       +  Y               H+ L    YTHFTSPIRR+ DI+VHRLL + +   + + +           +K L  NK  E++ 
Sbjct:  384 DHRVIVRVDSWDSTSLYPNGHTVRVLGKAGELETE---IQTILIENSIHVPAFSEAQLREMPVNSADQPWQMDGAEVSSRRDLRDTHLVFSIDPLGCEDVDDTLSVQTLPGGKRLELGVHIADVTHFVKEGSLTDLEARSRATTYYLAD----RRYDMLPTVLSADLCSLLGGVDRYAMSVLWELDAESL--------EVCKVWYGRTLIRSSYQLHYELAQSLLNGEEAEVPELAQLESSEQGQKLAELLQALETLTRMARHLRAQRDKGGALELEGVEVRAQLDEDKNIAALVPKQPLEVHETVAECMIYANHWVARKIQESFPHQALLRHHPPPR------QEFFN-----------QLIDCAKTRGFTIDTRSNKTLADSLDHAVDPLDPL-VNRLMRVMATQAMSNALYFSTGSCPEEQY--------------YHYGLALDRYTHFTSPIRRYADIIVHRLLMAAIQSEKQEGL-----------HKTLASNKELEELA 830          
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008666.1 (pep scaffold:Pmarinus_7.0:GL478401:184246:194592:-1 gene:ENSPMAG00000007841.1 transcript:ENSPMAT00000008666.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 270.396 bits (690), Expect = 2.021e-79
Identity = 189/560 (33.75%), Postives = 287/560 (51.25%), Query Frame = 2
Query: 4142 KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQ------KNYRIRNKGVV-LYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPG-----FFSKTNVPLTG-ELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            + N  Q+  +  ++    ++I GPPGTGKT +G  L   F +      +N +   K +  LYCGPSN  V++VA E   K  DL P  LR+YG+Q E  +FP+PG     F     VP     ++ I+LHY IR+    +A  +  +D               +E +++     I+ Y+  +K+AK   + K+   +  C+T  T   +  L +    ++DE  MC EPE LIP++S ++ +  VVL+GDHKQLRP + N+ A KLG+E S+FERY     K   ML+ QYRMHP ICEFP+K+FY    KT  +            K  + + N            SIL  ++  + P                          +F HV+G EV   V+T+ G+ENS+ N  EVE V  +  ++I+  +   +    I +LT Y  Q + ++   +    KK   T     T+ +SQGS+  Y++ STVRS  + ++   +P+ GW+   LGFI D NQ+NVALTRA++GL IIGN+ LL  + +WK LI+   E++C+
Sbjct:    1 QLNIMQTTVIKQSLTSAFTVIQGPPGTGKTVVGIHLVKWFHEVIKTLRENLQADAKHICSLYCGPSNKSVDVVA-EHLVKIEDLKP--LRVYGQQTEEEEFPIPGETDVIFLRSKKVPRVNLTIKSITLHYKIREDTNPYAQQIRKYDD------------GQTEEVKDLTLEEIIEYKKLIKDAKVIELKKSDVVITTCSTAATVILLKNL-DPRVCLVDECAMCTEPECLIPLTSYKD-IAQVVLLGDHKQLRPFVLNRTAAKLGMEKSMFERY----AKRAIMLDTQYRMHPDICEFPAKQFYSETNKTLKTA-----------KEVFGRPN------------SILGYAHKPSCP-------------------------TLFGHVVGKEVTLVVSTEEGSENSKANKAEVEQVVRLVSELIKKGSIAEKD---IAILTPYNAQANEIQKALEKEHIKKVTAT-----TITKSQGSEWRYVLLSTVRSC-SLDEFKANPSRGWQISRLGFIIDENQVNVALTRAKEGLCIIGNQDLLMCSDLWKELIESYHEKDCL 482          
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008661.1 (pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-1 gene:ENSPMAG00000007841.1 transcript:ENSPMAT00000008661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.565 bits (584), Expect = 1.015e-65
Identity = 163/481 (33.89%), Postives = 246/481 (51.14%), Query Frame = 2
Query: 4358 KFSDLCPKLLRIYGEQQELADFPLPG-----FFSKTNVPLTG-ELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            K  DL P  LR+YG+Q E  +FP+PG     F     VP     ++ I+LHY IR+    +A  +  +D+   +IL   R+    +            Y+  +K+AK   + K+   +  C+T  T   +  L +    ++DE  MC EPE LIP++S ++ +  VVL+GDHKQLRP + N+ A KLG+E S+FERY     K   ML+ QYRMHP ICEFP+K+FY    KT  +            K  + + N            SIL  ++  + P                          +F HV+G EV   V+T+ G+ENS+ N  EVE V  +  ++I+  +   +    I +LT Y  Q + ++   +    KK   T     T+ +SQGS+  Y++ STVRS  + ++   +P+ GW+   LGFI D NQ+NVALTRA++GL IIGN+ LL  + +WK LI+   E++C+
Sbjct:   20 KIEDLKP--LRVYGQQTEEEEFPIPGETDVIFLRSKKVPRVNLTIKSITLHYKIREDTNPYAQQIRKYDERI-RILKKFRSMQSKK------------YKKLIKDAKVIELKKSDVVITTCSTAATVILLKNL-DPRVCLVDECAMCTEPECLIPLTSYKD-IAQVVLLGDHKQLRPFVLNRTAAKLGMEKSMFERY----AKRAIMLDTQYRMHPDICEFPAKQFYSETNKTLKTA-----------KEVFGRPN------------SILGYAHKPSCP-------------------------TLFGHVVGKEVTLVVSTEEGSENSKANKAEVEQVVRLVSELIKKGSIAEKD---IAILTPYNAQANEIQKALEKEHIKKVTAT-----TITKSQGSEWRYVLLSTVRSC-SLDEFKANPSRGWQISRLGFIIDENQVNVALTRAKEGLCIIGNQDLLMCSDLWKELIESYHEKDCL 422          
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Match: upf1 (UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-GENE-040426-2836])

HSP 1 Score: 156.762 bits (395), Expect = 1.583e-38
Identity = 193/764 (25.26%), Postives = 311/764 (40.71%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFINS-IKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W VG +     K+R     LP    K+ +   +D R         L++       GD +CLR K +     W G G V+ V         F   I +  +S+  + +  ++  N+ VD   KS    R Q A+ +           +    L  + E+  I   +        +   N +Q  A+   +   LSLI GPPGTGKT     + Y  A++     N G VL C PSN  V+    ++ +K      K++R+  + +E  D P               +  ++LH  IR     + D L    K  Q++       S ++  R         YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P        + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+                       NG+         E + +  +++    DK P F                    FY   G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+  +  + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+   +E+  + E
Sbjct:  280 YEDAYQYQNVFGPLVKLEADYDKKLKE--SQTQDNITVRWDVGLN-----KKRIAFFSLP----KTDSGWLSDMR---------LMQ-------GDEICLRYKGE-LAAPWKGIGHVIKVPD------NFGDEIAIELRSNTGVPAECTH--NFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVLIKCMLPKRFTAPGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLAKQ-----NSGPVLVCAPSNIAVD----QLTEKIHRTGLKVVRLCAKSREAIDSP---------------VSFLALHNQIR-----NMDSLPELQK-LQQLKDETGELSSADEKR---------YRALKRNAERELLMNA--DVICCTCVGAGDPRLAKMQYRSILIDESTQATEPECMVPTVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLCQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQ-----------------------NGVTAA------ERVKKGFDFTWTQPDK-PMF--------------------FYVTQGQEEIASSGTSYLNRTEASN----------VEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHAKLYQEVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE 888          
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:560362])

HSP 1 Score: 105.531 bits (262), Expect = 8.093e-23
Identity = 120/543 (22.10%), Postives = 210/543 (38.67%), Query Frame = 2
Query: 1322 YSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDE--IKKKAVCIHVPGSY------LPTDSVVFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWL-----KQPNQIP-----NDK------ENLIYALNEIFAVAKKIRRARLPESYF----------VCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSID---IDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVL---NGTEIDDITLDIGEVCTIANKKLNGNKNFEK 2827
            + V KI+++ N  + +              D+  +V  + W+    YPNG  V  +      +     ++ +   N + + P  + ++ E  +        + G        L +  ++F++D    +D+DDALS     G ++ +GVHI DVT ++        +A  R  TYY           +L   L+ ++ SL     R  VSV +   G           E+ +  + + VI S +KL+YE   + L      Q   IP     +D         L++AL  +  VA+ +R  R  E             +    D   D+  +   E    + E M+ AN +VAR++ +  P   LLR   P ++               F  +LK     +    D          +K   E  +N +  +   I+K    +   A  N  +     +   + PA          ++ H+ L    YTHFTSPIRR+ D++VHR L +VL      E   +  ++ E+C   N++    +  +K
Sbjct:  372 FRVPKIRISTNQSQALQ-------------DYRVVVRIDSWEATSQYPNGHFVRVLGRAGELETE---VAALLVENAISVLPFSEAQLREMPVDSPETPWRMDGEEVARRCDLRSSHLIFSVDPPGCEDVDDALSVKTVAGGNLELGVHIADVTHFLRPHSHTDLEARVRATTYYLAD----RRFDMLPSVLSGNLCSLLGGVDRYAVSVRWELDG--------DTYEVKRVWYGRTVIRSSYKLSYETAQALLDGGAAAQGVTIPELDAFDDGTRQERLRELVWALGRLTDVARAMRARRTEEGGLELESVEVRVQMSESRDSIADLVPQQPLEVHETVAECMIAANHWVARRVAQALPGRALLRHHPPPRH--------------EFFEELKACAAAMGFHIDTSS-------NKALAESLDNAVDPNDPLINKMLRSMAVHAMSNALY-----FSTGSLPAD---------QHYHYGLALDHYTHFTSPIRRYADVMVHRQLLAVLEAKGAPETTPLNTELQELCEHINERNRAAQQVQK 851          
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003075.1 (pep scaffold:Pmarinus_7.0:GL481740:815:17708:1 gene:ENSPMAG00000002800.1 transcript:ENSPMAT00000003075.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.621e-13
Identity = 94/370 (25.41%), Postives = 150/370 (40.54%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPK-----FSNIHPI--HLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVII--SQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIET----------IFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNN--FLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRF 2695
            + ++D     D+DDAL     +  +  +GVHI DV+ +I   + + ++A  R  T Y  +     F+  H I   L    +  D L LA    R    V+ R                  P F +GV I   Q  LTY E    +    +    K+ +  +L  + ++AK +++ R+     + +  +    MD ET          + E   ++EEFMLLAN  VA +I  ++P+  LLR + P                                 P N+D   K + SKN   Q ++   L+  +D+A ++     Y N     +     M   A Y CS  +  +  H+ L   +YTHFTSPIRR+
Sbjct:  186 ICSVDPPGCTDIDDALHCKPLDNGNTEVGVHIADVSYFIRPGNALDEEASLRGTTVYLCEKNINCFTTRHFILSFLTTSRMNNDNLILAWAWIRRGHCVIAR-----------------TPWFTRGVFIVSPQASLTYAEAQLMMDDAGR----KDPVTSSLCGLNSLAKILKQRRIQNGALILASPEVRFHMDSETHDPIDLQTKELKETNSMVEEFMLLANISVAERIVGEFPECALLR-RHPAPP------------------------------PSNYDILVKAVKSKNIEIQVDSAKALAESLDRA-AVPGAPPYLNTLLRILATRCMMQ--AIYFCSGMEP-DTHHYGLATAIYTHFTSPIRRY 499          
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Match: NAM7 (ATP-dependent RNA helicase of the SFI superfamily; involved in nonsense mediated mRNA decay; required for efficient translation termination at nonsense codons and targeting of NMD substrates to P-bodies; binds to the small ribosomal subunit via an interaction with Rps26; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000004685])

HSP 1 Score: 153.68 bits (387), Expect = 5.937e-38
Identity = 147/551 (26.68%), Postives = 237/551 (43.01%), Query Frame = 2
Query: 4142 KFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWP-AFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + N +QS A+S+ +   LSLI GPPGTGKT     + Y  ++      +K  +L C PSN  V+ +A +++    DL  K++R+  + +E                +   +  ++LH L+ +  +     L                  L + + E   +    +   V++ +  ++  N+ ++V CT        ++      ++IDE+    EPE LIP+       + V+L+GDH+QL P+I  + A   GL+ SLFER   L   +   L  QYRM+P + EFPS  FY   L+  V+                     I  R                 VP+ K+P   R IP              ++F+   G E I    T   N         +EA+ C  ++II  L      P  I V+T Y+ Q+ ++L+    +    K +     V +V   QG + DYII S VR+               E+Q +GF+ DP ++NV LTRA+ GL+I+GN + L  N +W  L+    E+ C+ E
Sbjct:  408 QLNSSQSNAVSHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKI-----HKDRILVCAPSNVAVDHLAAKLR----DLGLKVVRLTAKSRE---------------DVESSVSNLALHNLVGRGAKGELKNL----------------LKLKDEVGELSASDTKRFVKLVRKTEAEIL--NKADVVCCTCVGAGDKRLDT-KFRTVLIDESTQASEPECLIPIVKG---AKQVILVGDHQQLGPVILERKAADAGLKQSLFERLISLG-HVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVT---------------------IEQR----------------TVPNSKFPWPIRGIP--------------MMFWANYGREEISANGTSFLN--------RIEAMNC--ERIITKLFRDGVKPEQIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRAN--------------EQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRSLARNTLWNHLLIHFREKGCLVE 836          
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Match: HCS1 (Hexameric DNA polymerase alpha-associated DNA helicase A; involved in lagging strand DNA synthesis; contains single-stranded DNA stimulated ATPase and dATPase activities; replication protein A stimulates helicase and ATPase activities [Source:SGD;Acc:S000001500])

HSP 1 Score: 109.383 bits (272), Expect = 1.687e-24
Identity = 150/548 (27.37%), Postives = 233/548 (42.52%), Query Frame = 2
Query: 4145 FNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPK--LLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAK----KNLIIKNQYEMV---------LCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKL--GLEISLFERYQELKPK--LVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQ-QHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLR 5728
             N +Q  A++ A+N+ L++I GPPGTGKT     L      KN   R    +L CGPSN  V+ +     ++ + L P   LLRI G    L D                  ++ SL  L  ++     DI    DK  Q+     +NY      R+   N I   R  +K+ +    K+LII+++  +          LC+         +LF+   +IIDE     EP+  IP+ + +N    +VL GD+KQL P I  +  K +   LE +LF+R  ++ PK  +V  LN QYRM+  I EFPS   Y  +L    +                     +  RL       ++      A P +     + IP              +++Y   GDE       +T +E +    +  E    I K+ IENL       N I V++ Y  Q  HL ++     +  +   TD  + TV   QG + D II S VRS               EK  +GF+ +  ++NVA+TR ++ L+++GN ++L+
Sbjct:  208 LNDSQKTAINFAINNDLTIIHGPPGTGKTFTLIELIQQLLIKNPEER----ILICGPSNISVDTIL----ERLTPLVPNNLLLRI-GHPARLLDSN----------------KRHSLDIL-SKKNTIVKDISQEIDKLIQENKKL-KNYKQ----RKENWNEIKLLRKDLKKREFKTIKDLIIQSRIVVTTLHGSSSRELCSLYRDDPN-FQLFDT--LIIDEVSQAMEPQCWIPLIAHQNQFHKLVLAGDNKQLPPTIKTEDDKNVIHNLETTLFDRIIKIFPKRDMVKFLNVQYRMNQKIMEFPSHSMYNGKLLADAT---------------------VANRL-------LIDLPTVDATPSEDDDDTK-IP--------------LIWYDTQGDEF-----QETADEATILGSKYNEGEIAIVKEHIENLRSFNVPENSIGVISPYNAQVSHLKKL-----IHDELKLTDIEISTVDGFQGREKDVIILSLVRS--------------NEKFEVGFLKEERRLNVAMTRPRRQLVVVGNIEVLQ 654          
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Match: DIS3 (Exosome core complex catalytic subunit; has both endonuclease and 3'-5' exonuclease activity; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; role in degradation of tRNAs; similar to E. coli RNase R and to human DIS3, which partially complements dis3-81 heat sensitivity; mutations in Dis3p analogous to human mutations implicated in multiple myeloma impair exosome function; protein abundance increases under to DNA replication stress [Source:SGD;Acc:S000005381])

HSP 1 Score: 100.138 bits (248), Expect = 2.306e-21
Identity = 99/377 (26.26%), Postives = 162/377 (42.97%), Query Frame = 2
Query: 1643 DSVVFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIET----------IFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQD-PVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLN 2737
            D ++ +ID     D+DDAL   K    +  +GVHI DVT ++     +  +  +R  + Y         I +L   L TD+ SL P   R   SV++              + I+   F + VI S+   +YE+  + L+  ++  ND+  L   +  +  ++ K+++ RL       +  +    MD ET          +     ++EEFMLLAN  VARKIY+ +P   +LR    P     E L  + N T  N +  L+    L        D+  + +  ++ Y  FN  + I   +     QY  +Y+  +         +YP           + +H+ L   +YTHFTSPIRR+ D+V HR L   + 
Sbjct:  536 DKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVD----KRIDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDS---------ANIVNVNFMKSVIRSREAFSYEQ--AQLRIDDKTQNDE--LTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLN-TRKNMSISLESSKALA-------DSLDRCVDPEDPY--FNTLVRIMSTRCMMAAQY--FYSGAY---------SYP-----------DFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 863          
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Match: SSD1 (Translational repressor with a role in polar growth and wall integrity; regulated by Cbk1p phosphorylation to effect bud-specific translational control and localization of specific mRNAs; interacts with TOR pathway components; contains a functional N-terminal nuclear localization sequence and nucleocytoplasmic shuttling appears to be critical to Ssd1p function [Source:SGD;Acc:S000002701])

HSP 1 Score: 84.3445 bits (207), Expect = 1.468e-16
Identity = 126/479 (26.30%), Postives = 196/479 (40.92%), Query Frame = 2
Query: 1376 PKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIV---GTISSYDS------FKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSV-VFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRF-CTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIIS----QFKLTYEEVSSWLKQPNQIPNDKENLIYA--LNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFE--ARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQ-DPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYP-ARYECSVK-DSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGT 2743
            PKD V    +  +  F+   + W    ++P G +V   G I   D+        NNF     + Q NP    P +Q     +   A  +    ++  T+   +F I SE     + AL     G+  + +G H+ DVT +I     + ++A  R    + P K  N+ P    D+      LSLAP K  A +SV++      L     K + + + T     I+S      KL+    +S+L    +I        YA  +N+  A         LP    + S++D    +D+  +      +VI E     N  VA KIY K  D  LLR Q  P+                  A ++  F             RKK+   +NF   F+   + ++ K    ++ D    D  V I        P ARY  + K D  +  H++LN P+YTHFT+P+RR+ D VVHR LK+V++ T
Sbjct:  602 PKDFVENADKYSEKLFVASIKRWPITSLHPFGILVSELGDIHDPDTEIDSILRDNNFLSNEYLDQKNPQKEKPSFQP----LPLTAESLEYRRNFTDTNEYNIFAI-SELGWVSEFALHVRNNGNGTLELGCHVVDVTSHIEEGSSVDRRARKRSSAVFMPQKLVNLLPQSFNDE------LSLAPGKESATLSVVYTLDSSTL---RIKSTWVGESTISPSNILSLEQLDEKLSTGSPTSYLSTVQEIARS----FYARRINDPEATL-------LPTLSLLESLDDEKVKVDLNILDRTLGFVVINEIKRKVNSTVAEKIYTKLGDLALLRRQMQPI------------------ATKMASF-------------RKKI---QNFGYNFDTNTADELIKGVLKIKDD----DVRVGIEILLFKTMPRARYFIAGKVDPDQYGHYALNLPIYTHFTAPMRRYADHVVHRQLKAVIHDT 1017          
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Match: SEN1 (ATP-dependent 5' to 3' RNA/DNA and DNA helicase; subunit of the exosome-associated Nrd1p complex that mediates 3' end formation of snRNAs, snoRNAs, CUTs and some mRNAs; helicase-independent role in transcription-coupled repair; coordinates replication with transcription, associating with moving forks and preventing errors that occur when forks encounter transcribed regions; homolog of Senataxin, implicated in Ataxia-Oculomotor Apraxia 2 and a dominant form of juvenile ALS [Source:SGD;Acc:S000004422])

HSP 1 Score: 80.8777 bits (198), Expect = 2.232e-15
Identity = 94/346 (27.17%), Postives = 150/346 (43.35%), Query Frame = 2
Query: 4154 NQSQAMSNAMNHK-LSLIWGPPGTGKTH-IGCILSYAFAQKNYRIRN------------------KGVVLYCGPSNDCVNLVALEMKKKFSD-----LCPKLLRIYGEQQ----ELADFPLPGFFSKT------NVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIRE--AIHNSILSYRDAVKEAK------KNLIIKNQYEMVLCXX-------XXXXXXIMELFNI--TQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLK 5035
            +Q++A+ N+++ +  SLI GPPGTGKT  I  I+ Y  + KN    N                  K  +L C PSN  V+ + L +K    D       P+L+R+ G        + D  L     K        +    EL++   +  + ++ E     L S     +  ++T+    L   IRE   I N +   RD ++E        ++L  +N    +L  +       + +A  ++    I    +IIDEA  C E  ++IP+       +  +++GD  QL P + +  A       SLF R +  K     +L+ QYRMHPSI +FPS EFY  +LK
Sbjct: 1338 SQAEAIVNSVSKEGFSLIQGPPGTGKTKTILGIIGYFLSTKNASSSNVIKVPLEKNSSNTEQLLKKQKILICAPSNAAVDEICLRLKSGVYDKQGHQFKPQLVRV-GRSDVVNVAIKDLTLEELVDKRIGERNYEIRTDPELER-KFNNAVTKRRELRGK-LDSESGNPESPMSTEDISKLQLKIRELSKIINELGRDRDEMREKNSVNYRNRDLDRRNAQAHILAVSDIICSTLSGSAHDVLATMGIKFDTVIIDEACQCTELSSIIPLRYGG---KRCIMVGDPNQLPPTVLSGAASNFKYNQSLFVRME--KNSSPYLLDVQYRMHPSISKFPSSEFYQGRLK 1675          

HSP 2 Score: 51.2174 bits (121), Expect = 2.111e-6
Identity = 26/83 (31.33%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 5534 QGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            QG + + I+ S VR+    +D          K  +GF+ D  ++NVALTRA+  + ++G+++ L  + +W+ LI+D ++R+C+
Sbjct: 1784 QGQEKEIILISCVRA----DDT---------KSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIEDAKDRSCL 1853          
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Match: EDO45137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS2])

HSP 1 Score: 245.743 bits (626), Expect = 5.164e-65
Identity = 333/1440 (23.12%), Postives = 586/1440 (40.69%), Query Frame = 2
Query:  869 LSKRTDLIKCILKFTNAHSGR-AIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKIND---PKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVP----GSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRF--PGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWL-KQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYE--KYPDFTLLRMQDPVKN------------CGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNY---PARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKIC--APFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIK-EIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKD--KLHQL------KSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQI------CLIHRDDPVPFF-IPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLI-DVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSID-THPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKI---LTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELF-NITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQEL---KPKLVTMLNYQYRMHPSICEFPSKEFY 5020
            L K + L+ C+L+   +  G  A+    + D+    I+  ++ N    AF  D+V V++ D   P+   GKV+ + E  H      Y+C       ++M+P++   P++ V                 ++KN Q                     ++VF++K  ++  +          F  E     F+V    W   F YP G +        S +   P+ +     N L + P      +E         +P    GS L   S   TID   T ++DDALS     + ++ +GVH+ DV+ +IS      + A ++  + YP   S I  +++L + L   + SL P K R  +SV+F F   GR L     +L E+     R+ ++ S++ LT+++  + L  Q +++P   +  I+ L    ++++K+   R  +      ++     +   T  ++  ++E+ M+ AN  VA K+ +  +  D T LR Q P K+             G   E+   L  +      +   + ++V+ D        I +K+      +    D D  R+L   +A+     +  R  Y ++    PA Y           HF+L    YTHFTSP+RR+ DIVV R+L +V+   E+     ++ ++C+           FE+ C     A    +  ++  ++      +T ++IR   P    +  +   I+  DL  +    S+      E  +L W    +SC P      +R +    +S   C      ++L   +  S++ AV  +D  ++  L      +   +N+   T     S S   P       I   + +R+      V G   +K  L  V    Q+      C +H   P   F  P     L        ++  +EY+    PL+ +E     L + S  TL+  VT+ +     +++ R +    M+LP      R ++      S G R+            GD LC+R ++ N          V H     +E     + I         I + N       ++V  +S   ++  +A+ S+      LKEV+LG   L+   E N           R +   + +Q+ A+  A+ H L++++G PGTGK+     ++  F  +N R    G VL C P+   +++V+ E+  +   +  + +RIY +Q E            T V        ++LH  +R     H+  L S +    ++   LT+  + +  E  +  + +    Y   +  A+   + +   ++++CT     +  M    NI Q I+DE+  C EPE L+P  +A       VL+GDHKQL P++ +K A KLGL  SLFE   E           LN Q+RMHPS+ +F S  FY
Sbjct: 1382 LLKGSALLLCVLEINGSTGGTTALAKVNNPDIPDVLIRTRAKMN---RAFHGDLVAVRVMDSSVPEMPIGKVVSIVEEIHP---RQYLCIADSLDTNIMTPINSVNPRVVV----------------LQSKNPQGRTG-----------------FAVFELKDGESQLRD---------FVTEAQGKLFLVQVMEWGASFRYPLGIVRQCFQEVTSLETALPVFA---ADNGLQLVPARMGGFNEDWT------IPDTEWGSRLHF-SEALTIDCGKTMELDDALSVKAGANGVVSVGVHVADVSYFISKDSSFDQAAFAQGTSAYPTDGSGI-AVNMLPEQL-RRLCSLLPGKHRLAISVIFTFNTQGRSL-----RLPEV-----RRSIVSSKYSLTFDQCDAVLNGQASELPESVKRYIHVLG---SMSRKLYSLRTRQGCLAGLLDA----VRATTFSKSSQIVEQLMIFANTAVAEKLLKSGRTKDLTPLRTQSPPKSHILQSWSLACERAGILPESSLTLRRVASNPSSQNTPSTVSVKVDLLGKISTAINAKDITLLTESLAEFDTD-GRAL---EAHCRLSSLQERSQYVLSSKVGPAGY----------GHFTLGLDAYTHFTSPLRRYFDIVVQRMLVAVMLDEELPYTADELEQICSRCQTSKVQADTFERSCKLTNLAAGLSSSPQWTEVV---VHRVTPDKIRVSLPSASHSKKLSLTIRTQDLKPSDTDASMD-----EELVLSWDVQEFSCGPSSWPPHSRSH----SSTERC------FELPATLWCSFVSAVAREDVNRIQALWNKIPNEGHILNEKPPTSPEMTSRS-GQPFKRFTKHIKAGDRLRV------VMGSTVLKSVLQPVIQGVQVLEDVYRCTVHMHVPAKCFGFPRASPTLTS------YSSAEEYRGVMQPLLELEEATCCLSDGSRSTLLRGVTLSF---GRVVSDRVD--STMRLP------RRVL------SPGGRH---------VQAGDYLCIRPRRPNRRGQRSSGSSVFHARVHHVEGASIHVDIPRAGLPSVLIEAGNCECD---IEVTPRSENHRQMIKAVCSLSRISKALKEVVLGRKILARQCETNM----------RVVPGLDDDQAHAVRTALTHPLTMVYGQPGTGKSWTAVAIACHFVNQN-RADAAGHVLLCAPTERALDVVS-ELLLQVPGI--RAVRIYSKQAE------------TTVIDGSGHSNLALHMRVRHASNPHSKALLSCEAEISRLTQELTSCTDPTKQERTQHKLDSKRQKYNTILATAEGFELGETPVDIIICTCAEAGSQRMRTHANIAQCIVDESNYCLEPEVLVPAVTAGPRCSRFVLVGDHKQLVPVLQSKEAWKLGLGRSLFEDLWEAHREGSSACCTLNTQHRMHPSLGKFSSSFFY 2644          

HSP 2 Score: 67.3958 bits (163), Expect = 6.703e-11
Identity = 37/85 (43.53%), Postives = 53/85 (62.35%), Query Frame = 2
Query: 5534 QGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            QG+Q D ++ STVR  R R+ +   P  G+     G + D +Q+NV LTRA+KGL+I+GN+  L  N +W RL+ D E  +CV E
Sbjct: 2755 QGAQCDVLVLSTVRG-RPRDQLTG-PHGGF-----GCLGDKHQMNVVLTRARKGLVIVGNRYYLSGNPMWNRLLHDYEVLDCVVE 2832          

HSP 3 Score: 59.6918 bits (143), Expect = 1.474e-8
Identity = 38/96 (39.58%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 4748 TQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKP-----KLVTMLNYQYRMHPSICEFPSKEFY 5020
            + + IDEA    E ETLIP+   + +   +VL GDH Q+   + + VA++L L+ SL  R  EL P     KL+ + N  YR +  I E PSK FY
Sbjct:  603 SHVFIDEAAQAMEAETLIPLCLTQQSTR-IVLAGDHLQMGAHVFSPVARRLCLDRSLLVRLYELYPRESDSKLLLLEN--YRAYNDIVEIPSKLFY 695          
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Match: EDO31024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ41])

HSP 1 Score: 186.037 bits (471), Expect = 2.507e-52
Identity = 127/350 (36.29%), Postives = 176/350 (50.29%), Query Frame = 2
Query: 4742 NITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKED 5791
            NI Q+I+DE GMC EPETL+P++ A    + VVLIGDHKQL+PII +  AK+LGLEIS+FERY     K   ML  QYRMH  IC FPS++FY   L T  +                                  LR  +    P D WPA        +     R     VF HV G E    + TQ  N+ S+ N +E +    + K ++            + +LT Y+ QQ L++              D  V T+I+SQGS+ DY+I S VRS+  +++I   P+  W    LGF+ D +QINVALTRA++GL IIGNK L+ ++  W  L+   E+   + ++
Sbjct:    1 NIQQVIVDECGMCFEPETLVPITCAR--AKQVVLIGDHKQLQPIIKDNDAKRLGLEISMFERY----AKKAIMLKEQYRMHAEICHFPSEQFYDKLLLTSAT--------------------------------VALRTPS----PVDFWPA-----QVLYGNDVPR-----VFCHVEGCEKSSVIKTQYSNQQSKSNEKEAKKAVHVAKVLVNKYAVNHGD---VVILTPYRQQQVLIK------EGLHAPYDDIQVSTIIKSQGSEWDYVILSLVRSL-PKDEIEAEPSSKWLGDNLGFLRDEHQINVALTRARRGLCIIGNKNLVELDPTWSALLSHYEQSETIVDE 288          
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Match: EDO31025 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ42])

HSP 1 Score: 186.422 bits (472), Expect = 3.437e-52
Identity = 134/363 (36.91%), Postives = 183/363 (50.41%), Query Frame = 2
Query: 4688 EMVLCX-XXXXXXXIMELF-NITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEE 5770
            E++LCT +   A  I++L  NI Q+I+DE GMC EPETL+P++ A    + VVLIGDHKQL+PII +  AK+LGLEIS+FERY     K   ML  QYRMH  IC FPS++FY   L T  +                                  LR  +    P D WPA          +   R     VF HV G E    + TQ  N  S+ N +E      + K ++            + +LT Y+ QQ L++              D  V T+I+SQGS+ DY+I S VRS+  +++I   P+  W    LGF+ D +QINVALTRA++GL IIGNK L+ ++  W  L+   E+
Sbjct:    1 EIILCTCSASGADRIVDLCDNIQQVIVDECGMCFEPETLVPITCAR--AKQVVLIGDHKQLQPIIKDNDAKRLGLEISMFERY----AKKAIMLKEQYRMHAEICHFPSEQFYDKLLLTSAT--------------------------------VALRTPS----PVDFWPA----------QVLHRKDVPRVFCHVEGCEKSSVIKTQYSNHGSKSNEKEANKAVHVAKVLVNKYAVNHGD---VVILTPYRQQQVLIK------EGLHAPYDDIQVSTIIKSQGSEWDYVILSLVRSL-PKDEIEAEPSSKWLGDNLGFLRDEHQINVALTRARRGLCIIGNKNLVELDPTWSALLSHYEQ 301          
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Match: EDO42429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B6])

HSP 1 Score: 127.487 bits (319), Expect = 1.309e-29
Identity = 119/429 (27.74%), Postives = 193/429 (44.99%), Query Frame = 2
Query: 1643 DSVVFTIDSETTKDMDDALSFHKEGSDII-IGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKE-----------NLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIF----------EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECS-VKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTE-IDDITLDIGEVCTIANKKLNGNKNFEKICAP--FAIF 2851
            D  VFTID  T +D+DDAL   +    +I +GVHI DV+ ++ +   +   A+ R  + Y      + P  +L   L  ++ SL P++ R   SV++    +  I  D+K          +G+I S+ K+ YE     + +PN+  +D E            ++  +N +  +A+++RR R               D+D ET            E+  +IEEFMLLAN  VA  IY+ +PD  LLR     K   + +E+L             E C  L ++   ++A              N+  SI +    SL Q+ +      + ++   +    A Y C+   +  E  H++L+ PLYTHFTSPIRR+ D++VHRLL + L   E +D   +D+  +    N      K   ++ +   FAIF
Sbjct:  293 DECVFTIDPLTARDLDDALHCKRLSDGLIEVGVHIADVSFFVKTGTPLDDIAQERATSTY--MVQTVVP--MLPRRLCEELCSLNPDEDRLTFSVVWIMTDQGEIKSDWK---------GRGIIRSRVKMAYEHAQEMIDKPNKKWSDSELPPIAEGTDVSEIVKRVNLLAKIARQLRRNRFENGALRLDQVKLQFDLDKETGMPIGYHVYQQRESNKLIEEFMLLANMTVAHHIYKAFPDMALLRRHP--KPHEKQMEDLL------------ELCRNLGIK---YNA--------------NSSKSIQV----SLAQFPSGSAQHEILVQLTMKPMKNALYFCAGTVEEEEYGHYALSVPLYTHFTSPIRRYADVIVHRLLAASLELAEPLDKDAVDVDSIAGHCNDCKLAAKTAGELSSELFFAIF 673          
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Match: EDO45106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX4])

HSP 1 Score: 98.2117 bits (243), Expect = 4.925e-21
Identity = 99/391 (25.32%), Postives = 160/391 (40.92%), Query Frame = 2
Query: 4664 NLIIKNQYEMVLCXXXXXXXXIMELFNI-------TQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQE----------------LKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQ--SNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQY-LGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQ 5758
            +L +   Y +++CT +       +LF++       T + +DEAG   EPE LIP+  A      ++L GD  QL P++ + VA   GL +SL ER                     P LVT L   YR HPS+   PS  FY  +L                             R+C    E  +R+  S +  +P    P                    +VF+ + G+++      + GN  S  NP E   V    + +  + T P +  + + ++T YK Q   + +    +   +       V +V   QG +   II STVRS            +G++  + +GF+ +P + NVA+TRAQ  L+++GN  +L  +  W  L+Q
Sbjct:  120 SLQLAAHYRIIVCTCSTAG----QLFSLGLKPGHFTHVFVDEAGQATEPECLIPIGLAAGEDGQIILAGDPFQLGPVLRSPVAISYGLNVSLLERLMSGLLYARDETRFVDHGCYDPLLVTKLVNNYRSHPSLLRLPSALFYHSEL-----------------------------RVCA---ERTMREQLSQWEMLPTQGTP--------------------LVFHGLKGEDM------REGNSPSWFNPVEAVQVVRYVQALKNSATCPIKLAD-LGIITPYKKQVEKIRLLLSRVGIDEVK-----VGSVEEFQGQERPAIIISTVRS--------TEAMVGFDVAHTIGFLDNPKRFNVAVTRAQSLLVVVGNPHVLCRDPYWCSLLQ 434          
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000013379.2 (helicase with zinc finger 2 [Source:NCBI gene;Acc:101162116])

HSP 1 Score: 286.574 bits (732), Expect = 4.474e-77
Identity = 334/1293 (25.83%), Postives = 569/1293 (44.01%), Query Frame = 2
Query: 1403 ETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDS--FKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYE--KYPDFTLLRMQ---DPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYY-------NDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIF----DETDKKFCFILDCACSDITNEEIRFVHPM-LQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFV---NQTFD------------TVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNG--LPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQN-----------YSVDVYLKSVVSKRQQEAISSIDTH-PLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRI-----------RNKG-VVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPG----FFSKT--NVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXX-XIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERY-QELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPD 5074
            E  D  F+V    W     YP G++   +   D    K  F +   +      ++T   +K+V E +                ++ FT+D    +D+DDA+S    G+   + +HI+DV  ++ +  ++   AE R  TYY        P H+  + L+T   SL   +   V+S++FR             S + +PTF   +I S  +L+YEE    + +     +  + +   L   +  AK  RR RL +  +  S +D      +    +A ++IEE  +L N++ +  + +  K    T LR Q   DP K   E+ E   +L  ++F  + K   +    R + F    K+        + N     D+DK   L+  D  +       N F     + Y +   +  E +V       H+SLN   YT  +SPIRR+ DI++ RLL  V+   +       I  +C+   + L   + +E+     A       ++  K   I+    +D   +      P  +        I +ADL L   PL    +E   +  L WKK IY      +S++ + N    N+  DC       K+   + R  + A++ +D L   KS  +    Q ++            T   S    L+    +++L++   + +++Q    K  G  +P I  +L  +   F+IC+ H   PV  F      K +++  +  + +I +Y++ + PL  +ES    + +  +  + D+ I +       T+  +  G   LP+ +  +R   F     S    +  + +R            ++    +   W+ HG   +V +   E  + K+       S  D F N+  ++N           ++V++  K +   R++ A+ +++    L+K +IL     +P  + + +   +K       + + N +QSQA++ A+N   +LI GPPGTGKT +G  + + F + N +            RNK  V+LYCGPSN  V++VA  + +    L  +LLR+Y    E+ D+P P     F  KT        EL+ I+LH+ +R+    HAD +   D+  +      RN   ++         I  Y+D +K+A+ + +   Q++++LCT T ++T ++    +  QI+IDE  M  EP+ LIP+    N  E VVLIGDHKQLRPI+ N+  KKLG+  SLFE Y  +L  K   ML+ QYRMH  ICEFPS++FY  +LKT V P  S L  D
Sbjct: 1517 EVRDRIFVVQVLGWKKQCFYPIGRVTDILPESDDELLKKEFGVA--VPSYESFELT---EKDVTERRDDL-----------RSTITFTVDPPDAQDLDDAISVKDLGNIYELEIHISDVASFVGANSDLDSYAEKRGSTYYN---RGKKPTHMFPEDLSTGCFSLLSGQDCRVISLMFRVEKETH-------SILEKPTFHLSLINSDKQLSYEEAEKIITERYTERSRFDTVEDCLTAAYCFAKTQRRTRLKDWAYSQSDDD-----RLPGRRKAHLMIEELSVLYNKHASEYLTDSMKTRLCTPLRCQKEPDPDK-VEEFKEKCKHLIPLSFHVKPKVPIDEPTQRLEGFQVLTKVWTCIQAAAREN-----DLDKMVDLVAADDIHPLLQPVINQFKRCSNKSYVIRSSSCKEATVG------HYSLNIKYYTQASSPIRRYMDIILQRLLHCVMCDKDCQYTRNQITAMCSQFQESLTKARAYEQKAEELAFTVSTRHQSSPKLALIVH---TDKEGDGFEVTFPFNMSVFHRTMSIMYADLQLEDQPLF---NEVNHAVTLTWKKRIY----IAESSNVQLNL---NTILDCG---PCVKIPLAVWRDAMEAIENQD-LDCAKSLLLQVNTQPWENPMLQPPTPLSKTSACSTEKKLSESWTNVDLQLQPGDRLQVQMTSEKRRGYHMPTI--QLVHIKKHFEICIDHVHRPVVCFS-----KPSNDPSRYFYNNINQYKEIWKPLCEMESASTAVDDCESVIIEDLEISFSQ-----TQCDKLTGTFFLPELW--TREFEF-----SLRHCFLCIRKRNLELTAASEFSTQVDPTQFT--WVAHGVTSYVEEK--EKDQKKV------GSKVDFFINHLPMENIPKCIFQSNTCFTVEIIPKLLPDIRKEGAVVNLEKACDLVKSIILRKRIKTPVVQYSMLRFQVKRKKLPGDLPELNDSQSQAVTTAINEPFTLIQGPPGTGKTVVGVYIVHWFLEMNSKTPRIFDDPYDEHRNKKEVILYCGPSNKSVDVVAEYLMRLKDSL--RLLRVYSHHVEMLDYPYPDSTLQFSPKTLRQDRSKPELRSITLHHRMRENPNPHADDIRKFDERIR------RNEDFTQK-------EIEEYKDLLKKARVHEL--EQHDIILCTCTQSSTPSLSRSVSARQILIDECAMATEPQALIPLVC--NKPEKVVLIGDHKQLRPIVKNESVKKLGMSRSLFESYFNQLSEKKAVMLDTQYRMHEDICEFPSEKFYEGKLKTAVEPAASVLRVD 2701          
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Match: UPF1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:101168695])

HSP 1 Score: 156.377 bits (394), Expect = 1.064e-37
Identity = 192/769 (24.97%), Postives = 312/769 (40.57%), Query Frame = 2
Query: 3506 FTDIKEYQDYFSPLVHVES-LQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN-SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSK----TNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVI-GDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQ-HLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKE 5788
            + D  +YQ+ F PLV +E+   + L E  + T  ++T+ W +G +     K+R     LP             + DS+              + GD +CLR K D     W G G V+ V  P     E  I +     +  +I        N+ VD   KS    R Q A+ +           +    L  + E+  I   +      + +   N +Q  A+   +   LSLI GPPGTGKT     + Y  +++       G VL C PSN  V+    ++ +K      K++R+  + +E  + P+  F +     +N+    ELQ+  L  L  + GE     LSS D+                            YR   + A++ L++    +++ CT        +       I+IDE+    EPE ++P+       + ++L+GDH QL P++  K A K GL  SLFER   L  + +  L  QYRMHP++  FPS  FY   L+  V+        D ++K       G ++                      +WP                 P++ +F++V  G E I    T   N     N           +KI   L      P+ I ++T Y+ Q+ +L++          K+     + +V   QG + D+II S VR+       N+H       Q +GF+ DP ++NVALTRA+ G+II+GN + L    +W  L+ + +E+  + E
Sbjct:  277 YEDAYQYQNIFGPLVKLEADYDKKLKE--SQTQDNITVRWDLGLN-----KKRIAYFTLP-------------KTDSD-----------MRLMQGDEICLRYKGD-LAPLWKGIGHVIKV--PDNYGDEIAIELRSSVGAPVEI------PHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVTIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLSRQ-----GNGPVLVCAPSNIAVD----QLTEKIDKTGLKVVRLCAKSREAIESPV-SFLALHNQISNMDSMPELQK--LQQLKDETGE-----LSSADEK--------------------------RYRALKRTAERELLMN--ADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLG---AKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIR-LQVQYRMHPALSAFPSNIFYEGSLQNGVT------AADRIKK-------GFDF----------------------QWPQ----------------PDKPMFFYVTQGQEEIASSGTSYLNRTEAAN----------VEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQQVEIASVDAFQGREKDFIILSCVRA-------NEH-------QGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQPLWNNLLNNYKEQKVLVE 881          
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Match: dis3l2 (DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gene;Acc:101169734])

HSP 1 Score: 129.798 bits (325), Expect = 1.231e-29
Identity = 116/387 (29.97%), Postives = 178/387 (45.99%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALS--FHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQI--PNDKE--NLIYALNEIF-------AVAKKIRRARLPESYFVCSVNDCYKDMDIETIF----------EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHI-REWYQMNYPARYECS--VKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVL 2734
            +FTID  T +D+DDALS     +G +  +GVHI DV+ ++     + + A  R  + Y      + P  +L   L  ++ SL P+  R   SV+++      + P+ K   I+   F + VI S  KL+Y+   S ++ P ++  PN+ +  N  + ++EI        ++A+ +RR R+              +++ E++           ++  ++EEFMLLAN   A  I+ K+PD  LLR   P K                   +LKE C+ L +  D       L       E  NN    D        +Y A       H+     QM   A Y CS  +K+    KH++LN PLYTHFTSPIRR+ DI+VHRLL S L
Sbjct:  547 IFTIDPATARDLDDALSCKLLPDG-NFEVGVHIADVSYFVKEDTALDEAASQRATSVY--LVQQVVP--MLPRLLCEELCSLNPDFDRLTFSVIWK------LTPEGK---ILSEWFGRSVIRSCAKLSYDHAQSMIEAPEKLFSPNELQLDNPEHPIDEIHEAVLRLHSIAQNLRRQRISTGTLKLDQVKLSFNINKESMMPNSCSVYEYKDSNRLVEEFMLLANIATAHHIHRKFPDLALLRRHPPPKT--------------KMMEELKEMCSQLGIDID-------LSSPGALQESLNNLTGKD--------EYSAARKAVLTHLCSRPMQM---ALYFCSGMLKNEQLFKHYALNIPLYTHFTSPIRRYADIIVHRLLASSL 887          
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Match: dis3l2 (DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gene;Acc:101169734])

HSP 1 Score: 129.028 bits (323), Expect = 1.533e-29
Identity = 116/391 (29.67%), Postives = 181/391 (46.29%), Query Frame = 2
Query: 1652 VFTIDSETTKDMDDALS--FHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQI--PNDKE--NLIYALNEIF-------AVAKKIRRARLPESYFVCSVNDCYKDMDIETIF----------EARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHI-REWYQMNYPARYECS--VKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTE 2746
            +FTID  T +D+DDALS     +G +  +GVHI DV+ ++     + + A  R  + Y      + P  +L   L  ++ SL P+  R   SV+++      + P+ K   I+   F + VI S  KL+Y+   S ++ P ++  PN+ +  N  + ++EI        ++A+ +RR R+              +++ E++           ++  ++EEFMLLAN   A  I+ K+PD  LLR   P K                   +LKE C+ L +  D       L       E  NN    D        +Y A       H+     QM   A Y CS  +K+    KH++LN PLYTHFTSPIRR+ DI+VHRLL S L+ ++
Sbjct:  313 IFTIDPATARDLDDALSCKLLPDG-NFEVGVHIADVSYFVKEDTALDEAASQRATSVY--LVQQVVP--MLPRLLCEELCSLNPDFDRLTFSVIWK------LTPEGK---ILSEWFGRSVIRSCAKLSYDHAQSMIEAPEKLFSPNELQLDNPEHPIDEIHEAVLRLHSIAQNLRRQRISTGTLKLDQVKLSFNINKESMMPNSCSVYEYKDSNRLVEEFMLLANIATAHHIHRKFPDLALLRRHPPPKT--------------KMMEELKEMCSQLGIDID-------LSSPGALQESLNNLTGKD--------EYSAARKAVLTHLCSRPMQM---ALYFCSGMLKNEQLFKHYALNIPLYTHFTSPIRRYADIIVHRLLASSLSMSQ 657          
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Match: dis3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:NCBI gene;Acc:101166822])

HSP 1 Score: 122.865 bits (307), Expect = 1.372e-27
Identity = 124/474 (26.16%), Postives = 207/474 (43.67%), Query Frame = 2
Query: 1421 FIVCYEYWDPYFMYPNGKIVGTISS------------------YDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSV--------NDCYKDMDIET--IFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKN--FYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEI 2749
             +V  + W     YPNG  V ++ S                  + +F  N  ++S + ++ P  ITP    +  +++   VC               ++D     D+DDAL   + E  ++ +GVHI DV+ +I   + + K+A +R  T Y         I ++ + L++++ SL  N  R   S ++              +EI++  F + VI S+  LTY E    +   N+    K+++  +L  +  +AK ++R R+       S         ++ +  +D++T  + E   ++EEFMLLAN  VA+KIY+++PD  LLR + P                                 P N+D   K   S N   +      L+  +D A+  +   +Y+N     +     M   A Y CS  DS +  H+ L  P+YTHFTSPIRR+ DI+VHRLL +V  G +I
Sbjct:  391 IMVAIDGWPKNSRYPNGHFVRSLGSAGEKGTEEAVLLLEHDVPHQAFSQN--VLSFLPKM-PWGITPEDMVKRQDLRHLTVC---------------SVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDKEAANRGTTVYLCG----KRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHN---------AEILKTQFTKSVINSKASLTYAEAQMRIDDTNK----KDDITESLRGLNKLAKILKRKRIENGALTLSSLEVRFHIDSETHDPIDLQTKELMETNSMVEEFMLLANISVAQKIYDEFPDCALLR-KHPAPP------------------------------PSNYDILLKAAKSMNVEIHTDSAKALADSLDVAK--VDGFSYFNTLLRILATRCMMQ--AVYFCSGMDS-DFHHYGLASPIYTHFTSPIRRYADIIVHRLL-AVAIGADI 792          
BLAST of RNB domain-containing protein vs. Planmine SMEST
Match: SMESG000026073.1 (SMESG000026073.1)

HSP 1 Score: 3834.65 bits (9943), Expect = 0.000e+0
Identity = 1877/1884 (99.63%), Postives = 1880/1884 (99.79%), Query Frame = 2
Query:  149 HTRPNLRENLVVETNHVNSARFDRKKN---NRENDSSLDISLWMKCIVDDNNENSIMEKMKSLKKVPNGKISELWDCLFKQLKILYDNLPLKESYELRKFIYQMDKDSNENRNENALTNMCQYYKCQVRVSSFDNNFKEIIYGSNLQRCIHLLHIGMQYFLPLQSGILTNTFTFSKEETKLISDLKQLNANSTVDQYAVDQERKRLNDIRKMLMGMEKQETYVPMVNPNSRKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKED 5791
            HTRPNLRENLVVETNHVNSARFDRKKN   N+ENDSSLDISLWMKCIVDDNNENSIMEKMKSLKKVPNGKISELWDCLFKQLKILYDNLPLKESYELRKFIYQMDKDSNENRNENALTNMCQYYKCQVRVSSFDNNFKEIIYGSNLQRCIHLLHIGMQYFLPLQSGILTNTFTFSKEETKLISDLKQLNANSTVDQYAVDQERKRLNDIRKMLMGMEKQETYVPMVNPNSRKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVC+HVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYIS THEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHD+YFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCTTTVTATTIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMKCKDILQKKKIKTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKED
Sbjct:   66 HTRPNLRENLVVETNHVNSARFDRKKNKKDNKENDSSLDISLWMKCIVDDNNENSIMEKMKSLKKVPNGKISELWDCLFKQLKILYDNLPLKESYELRKFIYQMDKDSNENRNENALTNMCQYYKCQVRVSSFDNNFKEIIYGSNLQRCIHLLHIGMQYFLPLQSGILTNTFTFSKEETKLISDLKQLNANSTVDQYAVDQERKRLNDIRKMLMGMEKQETYVPMVNPNSRKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCVHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISPTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDRYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCTTTVTATTIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMKCKDILQKKKIKTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCVKED 1949          
BLAST of RNB domain-containing protein vs. Planmine SMEST
Match: SMESG000026051.1 (SMESG000026051.1)

HSP 1 Score: 1851.64 bits (4795), Expect = 0.000e+0
Identity = 972/1859 (52.29%), Postives = 1310/1859 (70.47%), Query Frame = 2
Query:  254 DISLWMKCIVDDNNENSIMEKMKSLKKVPNGKISELWDCLFKQLKILYD-NLPLKESYELRKFIYQ--MDKDSNENRNENALTNMCQYYKCQVRVSSFDNNFKEIIYGSNLQRCIHLLHIGMQYFLPLQSGILTNTFTFSKEETKLISDLKQLNANSTVDQYAVDQERKRLNDIRKMLMGMEKQETYVPMVNPNSRKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFP-KDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIP-NDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRN-------FVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDM--EKCSY-SQWNGIN-YRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHLLEMXXXXXXXXXXXXTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQHPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLIQDLEERNCV 5782
            +IS WM  I+D N  N I EK+ SL +   G I  LWDCLF QL  + D          L++++Y+        EN+N  AL    + YK +V+ +S D N  EIIY                 FLPL++      +  + E+ + I    Q +     +  +V Q+  RL ++RK+L G+E  ++ VP+     + KL Y+ YTP++L K  DLI C LK   AHSG AIP+ ++  +KY+EIKL++R NCGYNAF  DIV VKINDPK  TGKV+ VYES HKP+NSIY+CKV+RDQGSLM+PLD +FPKIHVDN+ G R+YE +++++++   +++EQKSV +  +E  ++ADNLYYS+F + VN+N    ++F  K V  F+P TCD++FIVCYE WDP +MYP GK+VG ++  D+ + NF LIS IC I  +++T +Y+KEV EI  K   ++    Y+P+D+VVFTIDS+ TKD+DDA+S+HKEG+D +IG+HI+DVTKYISSTHEIY QA+ RFCT YPP      PIHL+D+ L+TD LSL PN PRAVVSV FRFP    +  DFK++++    FR+GVI+S+ KLTYEEVS WLKQ NQ+P N   NL  AL   F ++K +R+ARLP+SYFV S N   KD+ ++  FEA  ++ EFMLLANE VA+K+Y KYPD TLLR+Q+ V+N   WL++L   TNMNF G+L ++C+LL V+  +F  +K ++VS+ F+E+F + +  D D A++LL YD YYN+F VHI +WY++N PARYECS K+S+ NKHFSLNK LYT+FTSPIRRF+DIVVHRLLKSV+NG  IDD +LDI  VC+IAN+K   N  FE+ICA + +F E +K FCFILDC CS+I  + I   H +LQK+ S+K +KF+ L+L+ +P     +EK ++C LKW++IIYSC     STSN  N       FV+D   ++  L   + K F  IRRS      LK+KL   KS F+   ++T+ISSD  S+ NPIIDI+L++F+K+TMRIQF K KV+GLP I PEL+IV+PTFQICLIH+DDPV FF+  GKLKL +N  K  FT I EY++YF PL+H ESL+ETL    +FTL+ V I+W++       +K RYGV+ LP+ FC+ +NI F+DE+    +RYE L++   S +G DLLCLR K  +WNNYWIGHGEVVH +K + E+  +KI+IF+LT SDFD FS   +   YSVDVY KSVV++RQQ  + S++ + L+ ++I+G  +LS D      N     +   ++F FN++Q QAM  A+ HK SLIWGPPGTGKT IGC LS+ + Q+N    N  VVLYCGPSNDCV+LVA  ++K+F++ CPKLLRIY +QQEL DFP+PG+F +   PL+ E++  SLH+LIR++G +  D+L   D+ F+ IL + +      N  E +H+ I +Y+  + +AK++ + K +Y++VLCTT+VTAT IM+ FNITQ+I+DEAGMCKEPETLIP+S  EN+++N+VLIGDHKQLRPII +++A+  GL+ISLFERYQ L   +VT+LN+QYRMHPSICEFPSKEFY  +LKTQ S LWSGL  +D+  E+  Y ++WNG++ + L    ++ + R+SNY  + D+KWP     PY CF++ F  YPER +F  +IG EV Q VTT TGNENS+GN  EVE  G IY+++IE+    R     I++LTQYKLQQHLL++ C+DIL+ KKI +DPIVKTVIRSQGS+NDYIIFSTVRS+ N+ DIN HPT GWE+QYLGFITDP+QINVALTRA+KGLII+GN+QLL+VN  WK++I +  ERNC+
Sbjct:   53 NISTWMCYIIDGNIVNLIKEKLSSLNENVCGDILNLWDCLFYQLNRIIDITNGFDNPLLLKQYVYESLCGGSCLENQNHEALEAFSEEYKIKVKFTSIDKNSTEIIY---------------DLFLPLEASGSRKEYKPNLEDQRKIKMAIQCDKKVNSNLKSV-QDNNRLKELRKLLKGLETVQSPVPI--NKLQAKLEYDTYTPDELEKMDDLILCELKIIGAHSGIAIPI-KTQSVKYEEIKLLNRRNCGYNAFDGDIVRVKINDPKIPTGKVVDVYESYHKPINSIYVCKVNRDQGSLMTPLDSTFPKIHVDNQHGHRQYE-SEIQKREKSFLKDEQKSVVERGKESFKYADNLYYSLFDVSVNENK---LHFQFKSVEKFDPHTCDNYFIVCYERWDPQYMYPYGKVVGILNGRDTLEENFELISSICNIESVNLTAQYEKEVQEIIGKVKLLNESEDYIPSDAVVFTIDSKNTKDIDDAISYHKEGNDTVIGIHISDVTKYISSTHEIYYQAQRRFCTIYPPY---KKPIHLIDERLSTDALSLIPNVPRAVVSVFFRFPSN--VTTDFKITDL---KFREGVIVSKHKLTYEEVSKWLKQ-NQVPENVDPNLFEALKNSFEISKNLRQARLPKSYFVRSTNKFVKDLYVDNQFEAETLVNEFMLLANENVAKKVYYKYPDSTLLRIQNSVRNYENWLDSLLQSTNMNFEGELNDYCSLLEVKNADFPVKKNILVSRKFFERFISLIKKDADSAKNLLLYDIYYNEFMVHIIDWYKINCPARYECSYKNSVNNKHFSLNKDLYTNFTSPIRRFSDIVVHRLLKSVINGKMIDDSSLDIHYVCSIANQKYKSNDRFEEICASYTVF-EDNKTFCFILDCTCSEINEDGIVVAHHLLQKSLSLKTMKFSYLTLSDLPFF--KEEKTDNCTLKWRRIIYSC-----STSNIENNTDSTGTFVIDKDLYNVSLSSEASKEFGAIRRSCTHGQTLKEKLQNFKSKFIVSKYNTLISSDLYSIFNPIIDIQLQVFVKSTMRIQFSKNKVHGLPKITPELYIVTPTFQICLIHQDDPVRFFVQDGKLKLKYNINKTRFTTIAEYKEYFEPLIHAESLEETLSGDISFTLLSVQIKWILKVYSPNGKKVRYGVIMLPEKFCQEKNIHFSDEKSDIINRYEHLIDEELSPIGSDLLCLRFKCASWNNYWIGHGEVVHASKFQQENTIYKIIIFLLTHSDFDAFSTIQDKNTYSVDVYNKSVVTRRQQLLMKSLEENELVCDIIMG-KDLSID------NIDCGTLVTEKMFSFNKSQKQAMIRALKHKFSLIWGPPGTGKTFIGCCLSFEYTQRNLSTEN--VVLYCGPSNDCVDLVANYLRKQFNESCPKLLRIYSKQQELTDFPVPGYFVRNCQPLSDEMKPFSLHFLIRKEG-NFVDLLRVCDEKFRSILQSKKC-----NPEERLHDLIQNYKGLLLKAKRDYVSKVKYDIVLCTTSVTATKIMKSFNITQVIVDEAGMCKEPETLIPISKMENSIKNIVLIGDHKQLRPIILSRLAESHGLQISLFERYQNLPNGVVTLLNFQYRMHPSICEFPSKEFYSSKLKTQASILWSGLTANDLRVEQDYYDNEWNGLDSFNLAGFEFDELRRKSNYLVIKDEKWPRRDDKPYNCFDRKFSWYPERTIFIDIIGTEVAQSVTTSTGNENSKGNKTEVEVCGYIYRRLIESGAQARS----ISILTQYKLQQHLLKLNCQDILKSKKIMSDPIVKTVIRSQGSENDYIIFSTVRSLTNKNDINTHPTQGWERQYLGFITDPHQINVALTRAKKGLIIVGNRQLLQVNETWKKIINNYSERNCI 1852          
BLAST of RNB domain-containing protein vs. Planmine SMEST
Match: SMESG000026061.1 (SMESG000026061.1)

HSP 1 Score: 1677.14 bits (4342), Expect = 0.000e+0
Identity = 841/1527 (55.08%), Postives = 1113/1527 (72.89%), Query Frame = 2
Query:  830 RKKLLYEIYTPEQLSKRTD-LIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIK-VNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFL-SIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRN-FVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILG--INELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQ------------WNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAV 5356
            R+ L Y++YTP+QL +  D LI C LK   + SG AIP++  A+ K+KEI L SR NCG+N F NDIVYVKI + K H+GKVMGVY+S HKPVN +Y+CKVS+DQG+LM PLDKSFPKIHV+N  GR  Y+  +  + + K I  EQ+S  D E+  + +ADN Y+S+F I  +N+ ++ PI+     + F+P+TC++ F+V Y+ W+P+FMYP G+IVGT+SS DS +++ PLI  IC +N L+I+P+Y+KEV  I++K + +  P   LP+ ++VFTID++TTKDMDDA+S+H+E + I+IGVHI+DVTKY+S T E+YKQA+  FCT YPPK+ NI P H+ D+ LATD LSL P KPRAVVSVLF+F   M+ + +FKLS+I+QP FR+ VIIS++KL YEEVS WLKQ +   N   +L  AL  ++ +A+KIR ARLP SYFV SV +CY ++  E  FEA ++IEEFMLLANEYVAR IYEKYP+ TLLRMQ PVKN  EWLENL   TN+NFAGQLKE+CNLL V   N ++R+K IVS+ F+E FN F+   D DKA+ LLQYD Y+N+F+VHI +WY ++ P+ Y CS KDS+   HFSLNK LYTHFTSPIRRFTD+VVHRLLKSV++  +IDD +LDI E+C  AN K   NKNFEK+C P+AI +ET+K+FC ILDC CS+I +EEI   HP+LQ ASS   IKFA+LSL+ VP+  K++E    C LKW+KII+SC PY  S+S+  N F +D+  FD +LP+S  KLFQEIRRSYL    L++KL+QL + FV+  +  +ISSDS S   PI+DIEL + +KNTMRIQFCKYK +GL  I PEL +V+P+F ICLIH+++P  FFI GGKL L HN +K+ F+ IKEY+DYF PL+  ESL E L + SAFTL  V I+W++G+S+ TK+ ERYGV+ L  DFC  R+ IF+ E     ++YE L+  G SSVGGDLLCLR +K++WNNYW+GHG VV + K  + + + K++IF LTQS+FD+  +  N+ N+++D+Y KS+VS RQQ  ++ ID   LLKEVILG   N+   +     I  I N++  +   KFN+NQ+ A+ NA+N KLSLIWGPPGTGKT +GC LS+A+   N +     VVLYCGPSNDC+NLVA  M +KF++ CPKLLRI+G++QE++DFP+PG F K N  L  ++Q++SLH+LIR+ G  +AD L   D  F+ I   D    +  +    ++N+IL+Y++ VK+AKK  I+ N+++M+LCTT+VT   ++  FNI Q+IIDEAGMCKEPETLIP+++A  +V+NVVLIGDHKQLRP+I +++A K GL+ISLFERYQ+LKP+LVTMLN QYRMHPSIC+FPS EFY  +L T VSPLW GL  D M+   +S             WNGI+Y     HY+  L+ SNY+A+PD KWP  R  P++CF+K F  YPERI+F  VIG+E+ Q VTT TGNE S+GN  EVE V
Sbjct:    3 RRGLQYDVYTPKQLDEMKDKLILCKLKINKSQSGLAIPIENLANKKFKEIILTSRQNCGFNVFLNDIVYVKIINEKFHSGKVMGVYQSFHKPVNKLYVCKVSKDQGNLMVPLDKSFPKIHVENTAGRNLYK--NKIKNENKTISTEQESFLDKEKNRNSYADNTYFSLFDITGINQLTNMPIFGNCRCIEFSPDTCEYLFVVLYQKWNPHFMYPYGRIVGTLSSQDSLQDSLPLIRAICNLNLLEISPKYEKEVKTIREKHMILDKPHITLPSGAIVFTIDNKTTKDMDDAISYHREMNQIVIGVHISDVTKYVSPTSEMYKQAKDCFCTSYPPKYLNIPPYHIFDEKLATDFLSLVPGKPRAVVSVLFKFSENMINDKNFKLSDIVQPEFREDVIISKYKLNYEEVSLWLKQSDDPANVDADLYMALESVYKIARKIRHARLPYSYFVRSVKNCYTNLQTENRFEAELLIEEFMLLANEYVARIIYEKYPNSTLLRMQSPVKNREEWLENLHESTNLNFAGQLKEYCNLLGVLNFNRNSRQKFIVSRKFFELFNEFIKQSDFDKAKCLLQYDEYFNEFYVHITDWYHISNPSYYNCSEKDSVNMGHFSLNKSLYTHFTSPIRRFTDVVVHRLLKSVIHKIDIDDCSLDIDEICVNANTKSKYNKNFEKLCEPYAIVEETNKRFCLILDCVCSEINDEEIICAHPLLQVASSDNRIKFANLSLDEVPVLSKSNENFGKCNLKWRKIIFSCPPYLNSSSSNDNKFKIDSHLFDSYLPYSDSKLFQEIRRSYLSGEALENKLNQLCTKFVSYNYSNIISSDSFSFVEPIVDIELDMCVKNTMRIQFCKYKASGLMQINPELFVVTPSFHICLIHQNNPSKFFISGGKLDLLHNNVKESFSSIKEYKDYFEPLIEDESLMEALSDRSAFTLEKVLIKWILGKSIKTKKTERYGVITLSSDFCNLRSDIFHKEIYKIFNKYEYLIASGISSVGGDLLCLRCRKEDWNNYWVGHGHVVTINKCMINNQKMKLIIFRLTQSNFDLPKSAENV-NFTLDIYQKSIVSIRQQVIMNKIDKIELLKEVILGTETNKKINNPTEKIIAQIDNELNWK---KFNRNQNNAVKNALNQKLSLIWGPPGTGKTMVGCYLSFAYTFVNRKENKNSVVLYCGPSNDCINLVASTMMEKFNEKCPKLLRIFGKEQEVSDFPIPGHFFK-NKTLPIDIQEVSLHFLIRKNG-GYADELKKFDNIFKCIRNKD---PIPPDFN--VYNAILTYKNLVKKAKKEYIVNNKFDMILCTTSVTLKQVVTFFNIAQVIIDEAGMCKEPETLIPIAAAAKSVKNVVLIGDHKQLRPMIRSRLADKHGLQISLFERYQKLKPELVTMLNLQYRMHPSICDFPSMEFYSGKLITHVSPLWCGLKSDHMKVFCHSSDSSKKKEEVYINWNGIDYEKSVDHYKVFLKTSNYNAIPDAKWPGKRKRPFQCFHKRFEEYPERIIFIDVIGEEISQSVTTTTGNEKSKGNKVEVEVV 1516          
BLAST of RNB domain-containing protein vs. Planmine SMEST
Match: SMESG000026061.1 (SMESG000026061.1)

HSP 1 Score: 1676.37 bits (4340), Expect = 0.000e+0
Identity = 841/1527 (55.08%), Postives = 1113/1527 (72.89%), Query Frame = 2
Query:  830 RKKLLYEIYTPEQLSKRTD-LIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIK-VNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFL-SIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRN-FVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILG--INELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQ------------WNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQEVEAV 5356
            R+ L Y++YTP+QL +  D LI C LK   + SG AIP++  A+ K+KEI L SR NCG+N F NDIVYVKI + K H+GKVMGVY+S HKPVN +Y+CKVS+DQG+LM PLDKSFPKIHV+N  GR  Y+  +  + + K I  EQ+S  D E+  + +ADN Y+S+F I  +N+ ++ PI+     + F+P+TC++ F+V Y+ W+P+FMYP G+IVGT+SS DS +++ PLI  IC +N L+I+P+Y+KEV  I++K + +  P   LP+ ++VFTID++TTKDMDDA+S+H+E + I+IGVHI+DVTKY+S T E+YKQA+  FCT YPPK+ NI P H+ D+ LATD LSL P KPRAVVSVLF+F   M+ + +FKLS+I+QP FR+ VIIS++KL YEEVS WLKQ +   N   +L  AL  ++ +A+KIR ARLP SYFV SV +CY ++  E  FEA ++IEEFMLLANEYVAR IYEKYP+ TLLRMQ PVKN  EWLENL   TN+NFAGQLKE+CNLL V   N ++R+K IVS+ F+E FN F+   D DKA+ LLQYD Y+N+F+VHI +WY ++ P+ Y CS KDS+   HFSLNK LYTHFTSPIRRFTD+VVHRLLKSV++  +IDD +LDI E+C  AN K   NKNFEK+C P+AI +ET+K+FC ILDC CS+I +EEI   HP+LQ ASS   IKFA+LSL+ VP+  K++E    C LKW+KII+SC PY  S+S+  N F +D+  FD +LP+S  KLFQEIRRSYL    L++KL+QL + FV+  +  +ISSDS S   PI+DIEL + +KNTMRIQFCKYK +GL  I PEL +V+P+F ICLIH+++P  FFI GGKL L HN +K+ F+ IKEY+DYF PL+  ESL E L + SAFTL  V I+W++G+S+ TK+ ERYGV+ L  DFC  R+ IF+ E     ++YE L+  G SSVGGDLLCLR +K++WNNYW+GHG VV + K  + + + K++IF LTQS+FD+  +  N+ N+++D+Y KS+VS RQQ  ++ ID   LLKEVILG   N+   +     I  I N++  +   KFN+NQ+ A+ NA+N KLSLIWGPPGTGKT +GC LS+A+   N +     VVLYCGPSNDC+NLVA  M +KF++ CPKLLRI+G++QE++DFP+PG F K N  L  ++Q++SLH+LIR+ G  +AD L   D  F+ I   D    +  +    ++N+IL+Y++ VK+AKK  I+ N+++M+LCTT+VT   ++  FNI Q+IIDEAGMCKEPETLIP+++A  +V+NVVLIGDHKQLRP+I +++A K GL+ISLFERYQ+LKP+LVTMLN QYRMHPSIC+FPS EFY  +L T VSPLW GL  D M+   +S             WNGI+Y     HY+  L+ SNY+A+PD KWP  R  P++CF+K F  YPERI+F  VIG+E+ Q VTT TGNE S+GN  EVE V
Sbjct:    3 RRGLQYDVYTPKQLDEMKDKLILCKLKINKSQSGLAIPIENLANKKFKEIILTSRQNCGFNVFLNDIVYVKIINEKFHSGKVMGVYQSFHKPVNKLYVCKVSKDQGNLMVPLDKSFPKIHVENTAGRNLYK--NKIKNENKTISTEQESFLDKEKNRNSYADNTYFSLFDITGINQLTNMPIFGNCRCIEFSPDTCEYLFVVLYQKWNPHFMYPYGRIVGTLSSQDSLQDSLPLIRAICNLNLLEISPKYEKEVKTIREKHMILDKPHITLPSGAIVFTIDNKTTKDMDDAISYHREMNQIVIGVHISDVTKYVSPTSEMYKQAKDCFCTSYPPKYLNIPPYHIFDEKLATDFLSLVPGKPRAVVSVLFKFSENMINDKNFKLSDIVQPEFREDVIISKYKLNYEEVSLWLKQSDDPANVDADLYMALESVYKIARKIRHARLPYSYFVRSVKNCYTNLQTENRFEAELLIEEFMLLANEYVARIIYEKYPNSTLLRMQSPVKNREEWLENLHESTNLNFAGQLKEYCNLLGVLNFNRNSRQKFIVSRKFFELFNEFIKQSDFDKAKCLLQYDEYFNEFYVHITDWYHISNPSYYNCSEKDSVNMGHFSLNKSLYTHFTSPIRRFTDVVVHRLLKSVIHKIDIDDCSLDIDEICVNANTKSKYNKNFEKLCEPYAIVEETNKRFCLILDCVCSEINDEEIICAHPLLQVASSDNRIKFANLSLDEVPVLSKSNENFGKCNLKWRKIIFSCPPYLNSSSSNDNKFKIDSHLFDSYLPYSDSKLFQEIRRSYLSGEALENKLNQLCTKFVSYNYSNIISSDSFSFVEPIVDIELDMCVKNTMRIQFCKYKASGLMQINPELFVVTPSFHICLIHQNNPSKFFISGGKLDLLHNNVKESFSSIKEYKDYFEPLIEDESLMEALSDRSAFTLEKVLIKWILGKSIKTKKTERYGVITLSSDFCNLRSDIFHKEIYKIFNKYEYLIASGISSVGGDLLCLRCRKEDWNNYWVGHGHVVTINKCMINNQKMKLIIFRLTQSNFDLPKSAENV-NFTLDIYQKSIVSIRQQVIMNKIDKIELLKEVILGTETNKKINNPTEKIIAQIDNELNWK---KFNRNQNNAVKNALNQKLSLIWGPPGTGKTMVGCYLSFAYTFVNRKENKNSVVLYCGPSNDCINLVASTMMEKFNEKCPKLLRIFGKEQEVSDFPIPGHFFK-NKTLPIDIQEVSLHFLIRKNG-GYADELKKFDNIFKCIRNKD---PIPPDFN--VYNAILTYKNLVKKAKKEYIVNNKFDMILCTTSVTLKQVVTFFNIAQVIIDEAGMCKEPETLIPIAAAAKSVKNVVLIGDHKQLRPMIRSRLADKHGLQISLFERYQKLKPELVTMLNLQYRMHPSICDFPSMEFYSGKLITHVSPLWCGLKSDHMKVFCHSSDSSKKKEEVYINWNGIDYEKSVDHYKVFLKTSNYNAIPDAKWPGKRKRPFQCFHKRFEEYPERIIFIDVIGEEISQSVTTTTGNEKSKGNKVEVEVV 1516          
BLAST of RNB domain-containing protein vs. Planmine SMEST
Match: SMESG000026061.1 (SMESG000026061.1)

HSP 1 Score: 1671.75 bits (4328), Expect = 0.000e+0
Identity = 838/1523 (55.02%), Postives = 1110/1523 (72.88%), Query Frame = 2
Query:  830 RKKLLYEIYTPEQLSKRTD-LIKCILKFTNAHSGRAIPVDRSADMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPVNSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNIQNEQKSVADLEQELSRFADNLYYSVFKIK-VNKNSDKPIYFPKDVVPFNPETCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPLDITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSFHKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFL-SIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDITNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKKIIYSCNPYFKSTSNRRN-FVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKLKDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCKYKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKVFTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRKERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLRLKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNIQNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILG--INELSPDDENNFINSIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSYAFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQQELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYFQKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCXXXXXXXXIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDHKQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFPSKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQ------------WNGINYRLCKLHYESILRQSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTTQTGNENSRGNPQE 5344
            R+ L Y++YTP+QL +  D LI C LK   + SG AIP++  A+ K+KEI L SR NCG+N F NDIVYVKI + K H+GKVMGVY+S HKPVN +Y+CKVS+DQG+LM PLDKSFPKIHV+N  GR  Y+  +  + + K I  EQ+S  D E+  + +ADN Y+S+F I  +N+ ++ PI+     + F+P+TC++ F+V Y+ W+P+FMYP G+IVGT+SS DS +++ PLI  IC +N L+I+P+Y+KEV  I++K + +  P   LP+ ++VFTID++TTKDMDDA+S+H+E + I+IGVHI+DVTKY+S T E+YKQA+  FCT YPPK+ NI P H+ D+ LATD LSL P KPRAVVSVLF+F   M+ + +FKLS+I+QP FR+ VIIS++KL YEEVS WLKQ +   N   +L  AL  ++ +A+KIR ARLP SYFV SV +CY ++  E  FEA ++IEEFMLLANEYVAR IYEKYP+ TLLRMQ PVKN  EWLENL   TN+NFAGQLKE+CNLL V   N ++R+K IVS+ F+E FN F+   D DKA+ LLQYD Y+N+F+VHI +WY ++ P+ Y CS KDS+   HFSLNK LYTHFTSPIRRFTD+VVHRLLKSV++  +IDD +LDI E+C  AN K   NKNFEK+C P+AI +ET+K+FC ILDC CS+I +EEI   HP+LQ ASS   IKFA+LSL+ VP+  K++E    C LKW+KII+SC PY  S+S+  N F +D+  FD +LP+S  KLFQEIRRSYL    L++KL+QL + FV+  +  +ISSDS S   PI+DIEL + +KNTMRIQFCKYK +GL  I PEL +V+P+F ICLIH+++P  FFI GGKL L HN +K+ F+ IKEY+DYF PL+  ESL E L + SAFTL  V I+W++G+S+ TK+ ERYGV+ L  DFC  R+ IF+ E     ++YE L+  G SSVGGDLLCLR +K++WNNYW+GHG VV + K  + + + K++IF LTQS+FD+  +  N+ N+++D+Y KS+VS RQQ  ++ ID   LLKEVILG   N+   +     I  I N++  +   KFN+NQ+ A+ NA+N KLSLIWGPPGTGKT +GC LS+A+   N +     VVLYCGPSNDC+NLVA  M +KF++ CPKLLRI+G++QE++DFP+PG F K N  L  ++Q++SLH+LIR+ G  +AD L   D  F+ I   D    +  +    ++N+IL+Y++ VK+AKK  I+ N+++M+LCTT+VT   ++  FNI Q+IIDEAGMCKEPETLIP+++A  +V+NVVLIGDHKQLRP+I +++A K GL+ISLFERYQ+LKP+LVTMLN QYRMHPSIC+FPS EFY  +L T VSPLW GL  D M+   +S             WNGI+Y     HY+  L+ SNY+A+PD KWP  R  P++CF+K F  YPERI+F  VIG+E+ Q VTT TGNE S+GN  E
Sbjct:    3 RRGLQYDVYTPKQLDEMKDKLILCKLKINKSQSGLAIPIENLANKKFKEIILTSRQNCGFNVFLNDIVYVKIINEKFHSGKVMGVYQSFHKPVNKLYVCKVSKDQGNLMVPLDKSFPKIHVENTAGRNLYK--NKIKNENKTISTEQESFLDKEKNRNSYADNTYFSLFDITGINQLTNMPIFGNCRCIEFSPDTCEYLFVVLYQKWNPHFMYPYGRIVGTLSSQDSLQDSLPLIRAICNLNLLEISPKYEKEVKTIREKHMILDKPHITLPSGAIVFTIDNKTTKDMDDAISYHREMNQIVIGVHISDVTKYVSPTSEMYKQAKDCFCTSYPPKYLNIPPYHIFDEKLATDFLSLVPGKPRAVVSVLFKFSENMINDKNFKLSDIVQPEFREDVIISKYKLNYEEVSLWLKQSDDPANVDADLYMALESVYKIARKIRHARLPYSYFVRSVKNCYTNLQTENRFEAELLIEEFMLLANEYVARIIYEKYPNSTLLRMQSPVKNREEWLENLHESTNLNFAGQLKEYCNLLGVLNFNRNSRQKFIVSRKFFELFNEFIKQSDFDKAKCLLQYDEYFNEFYVHITDWYHISNPSYYNCSEKDSVNMGHFSLNKSLYTHFTSPIRRFTDVVVHRLLKSVIHKIDIDDCSLDIDEICVNANTKSKYNKNFEKLCEPYAIVEETNKRFCLILDCVCSEINDEEIICAHPLLQVASSDNRIKFANLSLDEVPVLSKSNENFGKCNLKWRKIIFSCPPYLNSSSSNDNKFKIDSHLFDSYLPYSDSKLFQEIRRSYLSGEALENKLNQLCTKFVSYNYSNIISSDSFSFVEPIVDIELDMCVKNTMRIQFCKYKASGLMQINPELFVVTPSFHICLIHQNNPSKFFISGGKLDLLHNNVKESFSSIKEYKDYFEPLIEDESLMEALSDRSAFTLEKVLIKWILGKSIKTKKTERYGVITLSSDFCNLRSDIFHKEIYKIFNKYEYLIASGISSVGGDLLCLRCRKEDWNNYWVGHGHVVTINKCMINNQKMKLIIFRLTQSNFDLPKSAENV-NFTLDIYQKSIVSIRQQVIMNKIDKIELLKEVILGTETNKKINNPTEKIIAQIDNELNWK---KFNRNQNNAVKNALNQKLSLIWGPPGTGKTMVGCYLSFAYTFVNRKENKNSVVLYCGPSNDCINLVASTMMEKFNEKCPKLLRIFGKEQEVSDFPIPGHFFK-NKTLPIDIQEVSLHFLIRKNG-GYADELKKFDNIFKCIRNKD---PIPPDFN--VYNAILTYKNLVKKAKKEYIVNNKFDMILCTTSVTLKQVVTFFNIAQVIIDEAGMCKEPETLIPIAAAAKSVKNVVLIGDHKQLRPMIRSRLADKHGLQISLFERYQKLKPELVTMLNLQYRMHPSICDFPSMEFYSGKLITHVSPLWCGLKSDHMKVFCHSSDSSKKKEEVYINWNGIDYEKSVDHYKVFLKTSNYNAIPDAKWPGKRKRPFQCFHKRFEEYPERIIFIDVIGEEISQSVTTTTGNEKSKGNKVE 1512          
The following BLAST results are available for this feature:
BLAST of RNB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HELZ21.303e-7828.62helicase with zinc finger 2 [Source:HGNC Symbol;Ac... [more]
HELZ22.213e-7628.78helicase with zinc finger 2 [Source:HGNC Symbol;Ac... [more]
UPF11.957e-4024.84UPF1 RNA helicase and ATPase [Source:HGNC Symbol;A... [more]
UPF12.654e-3824.71UPF1 RNA helicase and ATPase [Source:HGNC Symbol;A... [more]
DIS3L26.335e-3129.80DIS3 like 3'-5' exoribonuclease 2 [Source:HGNC Sym... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smg-24.186e-3425.53Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-24.186e-3425.53Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-24.186e-3425.53Regulator of nonsense transcripts 1 [Source:UniPr... [more]
disl-22.002e-2427.91DIS3-like exonuclease 2 [Source:UniProtKB/Swiss-P... [more]
dis-32.246e-2224.09Probable exosome complex exonuclease RRP44 [Sourc... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Upf11.946e-3526.57gene:FBgn0030354 transcript:FBtr0342744[more]
Upf11.946e-3526.57gene:FBgn0030354 transcript:FBtr0073596[more]
Dis3l23.125e-2428.68gene:FBgn0035111 transcript:FBtr0072487[more]
Dis3l23.295e-2428.68gene:FBgn0035111 transcript:FBtr0072486[more]
armi1.426e-2027.32gene:FBgn0041164 transcript:FBtr0309840[more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helz25.828e-11326.66helicase with zinc finger 2, transcriptional coact... [more]
zgc:1130579.068e-9125.66zgc:113057 [Source:ZFIN;Acc:ZDB-GENE-050508-3][more]
si:dkey-97a13.61.796e-8624.88si:dkey-97a13.6 [Source:ZFIN;Acc:ZDB-GENE-070912-6... [more]
upf12.478e-3924.97UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-... [more]
upf12.478e-3924.97UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx215.786e-4523.05T-box 21 [Source:Xenbase;Acc:XB-GENE-479103][more]
UPF11.434e-3824.71UPF1 regulator of nonsense transcripts homolog [So... [more]
UPF11.447e-3824.71UPF1 regulator of nonsense transcripts homolog [So... [more]
UPF11.452e-3824.71UPF1 regulator of nonsense transcripts homolog [So... [more]
UPF11.732e-3824.71UPF1 regulator of nonsense transcripts homolog [So... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Helz21.799e-7734.51helicase with zinc finger 2, transcriptional coact... [more]
Helz21.810e-7734.51helicase with zinc finger 2, transcriptional coact... [more]
Helz23.051e-7034.26helicase with zinc finger 2, transcriptional coact... [more]
Upf17.906e-4124.84UPF1 regulator of nonsense transcripts homolog (ye... [more]
Upf19.689e-3924.71UPF1 regulator of nonsense transcripts homolog (ye... [more]
back to top
BLAST of RNB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9QAM5|HELZ2_MOUSE1.258e-7634.51Helicase with zinc finger domain 2 OS=Mus musculus... [more]
sp|Q9BYK8|HELZ2_HUMAN1.063e-7528.78Helicase with zinc finger domain 2 OS=Homo sapiens... [more]
sp|Q9FJR0|RENT1_ARATH1.331e-4225.78Regulator of nonsense transcripts 1 homolog OS=Ara... [more]
sp|Q9EPU0|RENT1_MOUSE5.530e-4024.84Regulator of nonsense transcripts 1 OS=Mus musculu... [more]
sp|Q92900|RENT1_HUMAN9.400e-4024.84Regulator of nonsense transcripts 1 OS=Homo sapien... [more]
back to top
BLAST of RNB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QEW89.232e-14827.68Helicase with zinc finger domain 2 OS=Mizuhopecten... [more]
A0A210QEY47.933e-14728.39Helicase with zinc finger domain 2 OS=Mizuhopecten... [more]
A0A1S3IYB34.863e-14327.98helicase with zinc finger domain 2 OS=Lingula ungu... [more]
V4A0375.213e-14227.43RNB domain-containing protein OS=Lottia gigantea O... [more]
A0A2R2MRF92.800e-14028.26helicase with zinc finger domain 2 OS=Lingula ungu... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helz24.181e-8526.12helicase with zinc finger domain 2-like [Source:NC... [more]
upf12.387e-3924.97UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
ENSAMXT00000036328.12.318e-2941.76pep primary_assembly:Astyanax_mexicanus-2.0:5:1303... [more]
dis33.767e-2224.84DIS3 exosome endoribonuclease and 3'-5' exoribonuc... [more]
dis3l2.622e-2122.38DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008666.12.021e-7933.75pep scaffold:Pmarinus_7.0:GL478401:184246:194592:-... [more]
ENSPMAT00000008661.11.015e-6533.89pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-... [more]
upf11.583e-3825.26UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-... [more]
dis3l8.093e-2322.10DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
ENSPMAT00000003075.12.621e-1325.41pep scaffold:Pmarinus_7.0:GL481740:815:17708:1 gen... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAM75.937e-3826.68ATP-dependent RNA helicase of the SFI superfamily;... [more]
HCS11.687e-2427.37Hexameric DNA polymerase alpha-associated DNA heli... [more]
DIS32.306e-2126.26Exosome core complex catalytic subunit; has both e... [more]
SSD11.468e-1626.30Translational repressor with a role in polar growt... [more]
SEN12.232e-1527.17ATP-dependent 5' to 3' RNA/DNA and DNA helicase; s... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451375.164e-6523.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310242.507e-5236.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310253.437e-5236.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424291.309e-2927.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451064.925e-2125.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013379.24.474e-7725.83helicase with zinc finger 2 [Source:NCBI gene;Acc:... [more]
UPF11.064e-3724.97UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
dis3l21.231e-2929.97DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gen... [more]
dis3l21.533e-2929.67DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gen... [more]
dis31.372e-2726.16DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
back to top
BLAST of RNB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026073.10.000e+099.63SMESG000026073.1[more]
SMESG000026051.10.000e+052.29SMESG000026051.1[more]
SMESG000026061.10.000e+055.08SMESG000026061.1[more]
SMESG000026061.10.000e+055.08SMESG000026061.1[more]
SMESG000026061.10.000e+055.02SMESG000026061.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030278 ID=SMED30030278|Name=RNB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5964bp
TTGAATTCTGAGGTCAAATATTGTTCTTGGAATTTTGATTTTCCCTAAAT
TAAATATGGATGATCATGAATGGAAAGAACAAAAATCCAAGAAAAAAAGA
CAAAACAACAGTAGCTCGAACGCTTCAGCTTCATTTTCAACTAATAACCA
TACAAGACCAAATTTACGCGAAAACTTGGTTGTTGAAACTAATCATGTAA
ATTCTGCGAGATTTGATCGCAAAAAAAATAATAGGGAAAATGATAGTTCA
TTGGACATATCCTTATGGATGAAGTGTATCGTTGATGATAATAATGAAAA
TTCAATTATGGAGAAAATGAAAAGTCTTAAAAAAGTTCCCAATGGAAAAA
TATCTGAATTATGGGATTGCTTATTTAAGCAACTTAAGATACTATATGAT
AATTTACCTCTCAAGGAAAGTTACGAATTAAGAAAATTTATTTATCAAAT
GGACAAAGATAGTAATGAGAATCGAAATGAAAATGCGCTTACAAACATGT
GTCAATATTACAAATGCCAAGTTCGGGTGTCATCATTTGACAACAATTTT
AAAGAAATCATCTATGGTAGTAACCTTCAAAGGTGTATCCACCTATTACA
CATTGGAATGCAATATTTCTTACCGTTACAATCCGGGATACTTACTAACA
CATTTACGTTCAGTAAGGAAGAAACAAAACTGATTTCTGATTTGAAACAG
TTAAATGCAAATTCCACAGTTGATCAATACGCAGTAGATCAGGAAAGGAA
GAGACTAAATGACATTCGAAAAATGCTCATGGGAATGGAAAAGCAAGAAA
CCTATGTTCCAATGGTTAATCCAAACTCCAGAAAAAAGTTGCTCTATGAA
ATTTATACTCCTGAACAATTAAGCAAAAGAACAGATCTCATAAAATGTAT
CTTGAAGTTTACCAATGCTCACTCTGGGAGAGCGATTCCAGTTGATAGAT
CTGCTGACATGAAATATAAAGAGATAAAATTAATCAGTCGACATAATTGT
GGCTATAATGCATTTCAAAACGATATTGTTTATGTTAAAATAAATGATCC
AAAAAATCATACGGGCAAAGTGATGGGTGTATATGAATCAAATCATAAAC
CGGTAAATAGTATTTATATTTGTAAAGTATCCCGCGATCAAGGTAGTTTA
ATGAGTCCTTTGGATAAATCTTTCCCAAAAATACATGTTGATAATGAACC
AGGCAGAAGAAGATATGAAGTAAATGATATGGAACGAAAGAAAACAAAAA
ATATCCAAAATGAACAAAAATCAGTGGCTGATTTGGAGCAAGAATTATCT
AGATTTGCTGATAATTTATACTATTCAGTATTCAAAATAAAAGTCAACAA
AAACAGTGATAAACCAATATATTTTCCAAAAGATGTTGTCCCATTTAACC
CCGAGACATGTGATCATTTCTTTATTGTTTGCTATGAATATTGGGATCCA
TATTTTATGTATCCGAATGGAAAAATCGTGGGAACGATCTCAAGCTATGA
TTCATTTAAAAATAATTTTCCTTTGATCTCATTAATATGTCAGATAAATC
CACTTGATATTACTCCACGTTATCAAAAAGAAGTCGACGAAATAAAGAAA
AAGGCCGTGTGTATTCACGTACCAGGTTCCTACTTACCCACAGATAGTGT
AGTTTTCACAATCGATAGTGAAACGACAAAAGATATGGACGATGCTCTGA
GTTTTCACAAAGAAGGCAGTGACATAATAATTGGTGTTCACATTACCGAT
GTTACTAAATATATTTCATCAACTCATGAAATTTATAAACAAGCTGAAAG
TCGTTTCTGTACTTACTATCCTCCTAAATTTTCAAATATTCACCCTATTC
ATCTTCTCGACGACACCCTTGCCACTGATGTGCTTAGTTTAGCTCCAAAT
AAACCGCGAGCCGTTGTTAGTGTTCTTTTCAGATTTCCCGGAAGAATGTT
GATTAATCCTGATTTTAAACTTTCAGAAATTATCCAACCAACTTTTCGAC
AAGGCGTAATTATTTCTCAATTCAAACTCACATATGAAGAAGTATCGTCA
TGGTTAAAGCAACCGAACCAAATTCCAAATGATAAAGAAAACTTAATTTA
TGCTCTAAACGAAATTTTTGCTGTAGCCAAAAAAATACGACGTGCTCGAT
TGCCGGAATCATATTTCGTTTGTTCAGTCAACGACTGTTACAAAGATATG
GATATCGAAACGATTTTTGAAGCTCGAATTGTCATCGAAGAATTTATGTT
GCTTGCGAATGAATATGTTGCTAGAAAAATCTATGAAAAATATCCAGATT
TCACATTGTTAAGAATGCAAGATCCTGTGAAAAACTGTGGAGAATGGTTA
GAAAATCTTTTCAACTTGACTAATATGAATTTCGCTGGTCAGTTAAAAGA
GTTTTGTAACCTATTAAATGTGAGACCGGATAATTTTGATGCGAGAAAAA
AACTCATAGTCAGTAAAAATTTCTATGAACAATTTAATAATTTTTTAAGC
ATAGATATTGATAAAGCCAGGAGTCTTTTACAATATGATGCTTATTACAA
TGATTTTTTTGTTCACATAAGAGAATGGTATCAAATGAATTACCCGGCTC
GATACGAATGCAGTGTTAAAGATTCTATCGAAAACAAACATTTTTCTCTA
AACAAGCCGCTTTATACTCATTTTACAAGTCCTATTCGACGATTTACAGA
TATCGTGGTGCACAGGCTTCTGAAATCTGTTCTGAATGGTACCGAAATCG
ATGATATAACACTAGACATTGGTGAGGTCTGTACCATCGCGAATAAGAAG
CTTAATGGAAATAAAAATTTTGAAAAAATCTGTGCTCCGTTTGCTATATT
TGATGAAACCGATAAAAAGTTTTGTTTCATTCTTGATTGTGCCTGTTCAG
ATATAACCAACGAGGAAATACGATTTGTTCATCCAATGTTACAAAAAGCT
TCTAGTATAAAAGAAATCAAATTCGCTGACTTATCATTGAATGCTGTTCC
GTTGTCATTGAAAAATGATGAAAAAGCTGAAAGTTGTCTGTTGAAATGGA
AAAAAATTATATACTCATGCAATCCTTATTTCAAAAGCACTTCCAATCGG
CGGAACTTCGTCGTAGACAATTCCCAATTTGACTGTCATTTACCGTTTTC
ATCTTATAAATTATTTCAAGAAATCCGTCGGTCATATCTTCCAGCTGTAA
AATTAAAAGACAAACTACATCAACTCAAATCATCATTTGTCAACCAAACA
TTCGACACTGTCATATCATCTGATTCTATTTCCTTAGCGAATCCGATTAT
TGATATCGAATTGAAGATCTTTATTAAAAACACCATGCGCATTCAATTTT
GTAAATATAAAGTAAACGGTTTACCCGCAATCAAACCAGAACTACATATC
GTTTCTCCAACATTTCAAATTTGCTTGATACATCGCGACGATCCTGTACC
ATTCTTTATTCCAGGTGGCAAATTGAAATTAAACCATAACACCATTAAAA
AAGTTTTCACTGATATCAAAGAATACCAAGATTACTTCTCACCTCTTGTC
CACGTGGAATCATTGCAAGAAACATTAGGCGAGCCCTCAGCATTTACTTT
GATTGATGTAACCATTGAGTGGCTTGTAGGTGAATCACTGATTACTAAAC
GCAAAGAACGATATGGAGTAATGAAGTTACCTGATGATTTTTGCAAATCT
AGAAATATTATTTTTAATGATGAAAGGGATTCGAATGGTTCAAGATATGA
AGTTTTACTTGAACGAGGATTTTCATCTGTTGGTGGTGATTTGTTGTGTT
TGAGATTGAAAAAAGACAATTGGAATAATTACTGGATAGGACACGGTGAA
GTCGTTCACGTCGCAAAACCTAAATTGGAATCTGGTGAATTTAAAATCGT
CATTTTCATGCTTACTCAGTCGGATTTTGATATATTTTCCAATAATTCAA
ATATTCAGAACTATTCAGTTGATGTCTACCTGAAATCAGTGGTTTCAAAG
CGTCAACAAGAAGCGATTTCATCAATTGATACTCATCCTCTTTTAAAAGA
AGTGATACTCGGAATTAATGAATTATCCCCGGATGACGAGAATAACTTTA
TAAATTCAATTAAAAACGATATTGAAAACAGAAGAATTTTCAAATTCAAC
CAGAATCAATCTCAAGCTATGAGCAATGCAATGAATCATAAACTTAGTTT
AATTTGGGGTCCACCGGGCACTGGCAAAACACACATAGGATGCATTTTGT
CATACGCTTTTGCTCAGAAAAATTATAGAATTAGAAACAAAGGTGTTGTG
CTATATTGTGGACCATCAAATGATTGTGTCAATTTGGTTGCCCTTGAAAT
GAAAAAAAAATTTTCGGACTTATGTCCAAAATTACTGAGAATATATGGTG
AGCAGCAAGAGCTGGCAGACTTTCCACTGCCTGGTTTTTTCTCAAAAACT
AATGTTCCACTCACTGGTGAATTGCAGCAAATCAGTTTGCATTACCTGAT
AAGACAACAAGGAGAATCCCATGCTGATATTTTGAGCAGCCATGATAAAT
ATTTTCAAAAAATACTTACGACTGATAGAAATTATTCTTTGTCGGAGAAT
ATTCGTGAAGCGATTCACAATTCCATTTTGTCATACCGAGATGCTGTAAA
AGAGGCTAAGAAAAATTTAATTATTAAAAATCAATATGAAATGGTTCTCT
GTACAACAACAGTAACAGCGACAACAATAATGGAATTGTTTAACATTACC
CAGATTATAATCGACGAGGCGGGTATGTGCAAAGAACCTGAAACATTAAT
TCCGATGTCAAGTGCAGAAAACACTGTTGAGAATGTTGTATTGATCGGGG
ATCACAAGCAGCTTCGCCCTATCATTCATAATAAAGTTGCCAAGAAACTC
GGGCTAGAAATTTCTTTATTCGAGAGGTATCAAGAATTGAAACCGAAACT
TGTTACGATGTTGAATTACCAATATCGAATGCATCCTTCAATTTGTGAAT
TTCCCAGTAAAGAATTCTATTTTCATCAATTGAAAACTCAAGTATCACCT
TTGTGGAGTGGTTTAGGTCCCGATGATATGGAAAAATGTTCCTACTCGCA
ATGGAACGGAATTAATTATCGTTTGTGCAAACTGCATTATGAAAGTATAT
TAAGGCAATCAAACTACAGTGCTGTACCCGATGATAAGTGGCCTGCATTT
AGACACATCCCTTATAAGTGTTTTAATAAAGGATTTATTCGATATCCGGA
AAGAATCGTTTTCTACCATGTTATTGGTGATGAAGTTATTCAGCCAGTTA
CTACTCAAACTGGAAATGAAAATTCGCGTGGAAATCCACAAGAAGTGGAA
GCAGTTGGCTGCATTTATAAAAAGATTATAGAGAACCTTACTCCTCCTCG
GCAATCACCTAATTTCATCACGGTTCTTACACAATACAAATTACAGCAAC
ATTTATTAGAAATGAAATGCAAAGATATTTTACAAAAAAAAAAAATCAAA
ACTGACCCAATAGTAAAAACAGTTATTCGTAGTCAAGGATCACAAAATGA
TTATATAATATTTTCTACGGTCCGATCTATTAGAAACAGAGAAGATATCA
ACCAACACCCAACAATAGGCTGGGAGAAACAATATCTGGGCTTCATCACA
GATCCGAACCAAATCAATGTTGCTCTGACCAGAGCGCAAAAGGGACTCAT
TATTATAGGAAATAAGCAACTGCTGAGAGTGAACCACATATGGAAACGAC
TGATACAAGATCTCGAAGAGCGAAACTGTGTAAAGGAAGATTATTTGAAT
TTTCTTGACTGATTTTGATATCTATTGCAATATTTTCACATTATTTTTTA
ATATTATTTAACAAGATTTCTATATTGATTGTTGATCATTTATTGATATT
TACTGTGCATTTCTTAAATAAATGTCAAATATGCGCAAAATTATCTAATT
ATTGTTACTTGTAC
back to top

protein sequence of SMED30030278-orf-1

>SMED30030278-orf-1 ID=SMED30030278-orf-1|Name=SMED30030278-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1919bp
MDDHEWKEQKSKKKRQNNSSSNASASFSTNNHTRPNLRENLVVETNHVNS
ARFDRKKNNRENDSSLDISLWMKCIVDDNNENSIMEKMKSLKKVPNGKIS
ELWDCLFKQLKILYDNLPLKESYELRKFIYQMDKDSNENRNENALTNMCQ
YYKCQVRVSSFDNNFKEIIYGSNLQRCIHLLHIGMQYFLPLQSGILTNTF
TFSKEETKLISDLKQLNANSTVDQYAVDQERKRLNDIRKMLMGMEKQETY
VPMVNPNSRKKLLYEIYTPEQLSKRTDLIKCILKFTNAHSGRAIPVDRSA
DMKYKEIKLISRHNCGYNAFQNDIVYVKINDPKNHTGKVMGVYESNHKPV
NSIYICKVSRDQGSLMSPLDKSFPKIHVDNEPGRRRYEVNDMERKKTKNI
QNEQKSVADLEQELSRFADNLYYSVFKIKVNKNSDKPIYFPKDVVPFNPE
TCDHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKNNFPLISLICQINPL
DITPRYQKEVDEIKKKAVCIHVPGSYLPTDSVVFTIDSETTKDMDDALSF
HKEGSDIIIGVHITDVTKYISSTHEIYKQAESRFCTYYPPKFSNIHPIHL
LDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQG
VIISQFKLTYEEVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLP
ESYFVCSVNDCYKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFT
LLRMQDPVKNCGEWLENLFNLTNMNFAGQLKEFCNLLNVRPDNFDARKKL
IVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARY
ECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDD
ITLDIGEVCTIANKKLNGNKNFEKICAPFAIFDETDKKFCFILDCACSDI
TNEEIRFVHPMLQKASSIKEIKFADLSLNAVPLSLKNDEKAESCLLKWKK
IIYSCNPYFKSTSNRRNFVVDNSQFDCHLPFSSYKLFQEIRRSYLPAVKL
KDKLHQLKSSFVNQTFDTVISSDSISLANPIIDIELKIFIKNTMRIQFCK
YKVNGLPAIKPELHIVSPTFQICLIHRDDPVPFFIPGGKLKLNHNTIKKV
FTDIKEYQDYFSPLVHVESLQETLGEPSAFTLIDVTIEWLVGESLITKRK
ERYGVMKLPDDFCKSRNIIFNDERDSNGSRYEVLLERGFSSVGGDLLCLR
LKKDNWNNYWIGHGEVVHVAKPKLESGEFKIVIFMLTQSDFDIFSNNSNI
QNYSVDVYLKSVVSKRQQEAISSIDTHPLLKEVILGINELSPDDENNFIN
SIKNDIENRRIFKFNQNQSQAMSNAMNHKLSLIWGPPGTGKTHIGCILSY
AFAQKNYRIRNKGVVLYCGPSNDCVNLVALEMKKKFSDLCPKLLRIYGEQ
QELADFPLPGFFSKTNVPLTGELQQISLHYLIRQQGESHADILSSHDKYF
QKILTTDRNYSLSENIREAIHNSILSYRDAVKEAKKNLIIKNQYEMVLCT
TTVTATTIMELFNITQIIIDEAGMCKEPETLIPMSSAENTVENVVLIGDH
KQLRPIIHNKVAKKLGLEISLFERYQELKPKLVTMLNYQYRMHPSICEFP
SKEFYFHQLKTQVSPLWSGLGPDDMEKCSYSQWNGINYRLCKLHYESILR
QSNYSAVPDDKWPAFRHIPYKCFNKGFIRYPERIVFYHVIGDEVIQPVTT
QTGNENSRGNPQEVEAVGCIYKKIIENLTPPRQSPNFITVLTQYKLQQHL
LEMKCKDILQKKKIKTDPIVKTVIRSQGSQNDYIIFSTVRSIRNREDINQ
HPTIGWEKQYLGFITDPNQINVALTRAQKGLIIIGNKQLLRVNHIWKRLI
QDLEERNCVKEDYLNFLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0004540ribonuclease activity
GO:0004386helicase activity
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0090501RNA phosphodiester bond hydrolysis
GO:1903506regulation of nucleic acid-templated transcription
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001900RNase_II/R
IPR041677DNA2/NAM7_AAA_11
IPR041679DNA2/NAM7-like_AAA
IPR027417P-loop_NTPase
IPR022966RNase_II/R_CS
IPR012340NA-bd_OB-fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 227..247
NoneNo IPR availableCOILSCoilCoilcoord: 1886..1906
NoneNo IPR availableCOILSCoilCoilcoord: 393..420
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1282..1639
e-value: 4.1E-53
score: 182.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..40
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..40
NoneNo IPR availablePANTHERPTHR43788FAMILY NOT NAMEDcoord: 290..739
coord: 1734..1910
NoneNo IPR availablePANTHERPTHR43788:SF10HELICASE WITH ZINC FINGER 2, TRANSCRIPTIONAL COACTIVATOR-RELATEDcoord: 290..739
coord: 862..1189
coord: 1361..1661
NoneNo IPR availablePANTHERPTHR43788FAMILY NOT NAMEDcoord: 862..1189
coord: 1361..1661
NoneNo IPR availablePANTHERPTHR43788:SF10HELICASE WITH ZINC FINGER 2, TRANSCRIPTIONAL COACTIVATOR-RELATEDcoord: 1734..1910
NoneNo IPR availableCDDcd18808SF1_C_Upf1coord: 1642..1904
e-value: 4.59563E-39
score: 142.373
NoneNo IPR availableCDDcd18040DEXXc_HELZ2-Ccoord: 1363..1641
e-value: 8.70566E-66
score: 222.4
IPR001900Ribonuclease II/RSMARTSM00955RNB_2coord: 526..895
e-value: 2.9E-46
score: 169.7
IPR001900Ribonuclease II/RPFAMPF00773RNBcoord: 530..894
e-value: 2.0E-54
score: 185.1
IPR041677DNA2/NAM7 helicase, AAA domainPFAMPF13086AAA_11coord: 1363..1609
e-value: 9.3E-38
score: 130.5
IPR041679DNA2/NAM7 helicase-like, AAA domainPFAMPF13087AAA_12coord: 1618..1887
e-value: 6.7E-42
score: 143.4
IPR022966Ribonuclease II/R, conserved sitePROSITEPS01175RIBONUCLEASE_IIcoord: 862..886
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1361..1901
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 271..478
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 501..912