Ribosome biogenesis protein WDR12 homolog

Overview
NameRibosome biogenesis protein WDR12 homolog
Smed IDSMED30030268
Length (bp)1284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosome biogenesis protein WDR12 homolog (SMED30030268) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosome biogenesis protein WDR12 homolog (SMED30030268) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosome biogenesis protein WDR12 homolog (SMED30030268) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosome biogenesis protein WDR12 homolog (SMED30030268) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030268

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030268SMESG000035645.1 SmedASXL_000245SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30030268SMESG000035645.1 dd_Smed_v6_10263_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030268SMESG000035645.1 dd_Smed_v4_10263_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: WDR31 (WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:21421])

HSP 1 Score: 172.555 bits (436), Expect = 3.851e-49
Identity = 109/359 (30.36%), Postives = 177/359 (49.30%), Query Frame = 1
Query:  100 MGGKVSKKKNYMTKKIELNSITEPEVNN---FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
            MG + SK K+   K    + I E  +       Y P   + ++ ++  NS++   G  + ++   N+    +    KGHE E+T++  + KS Q  + SRD+ + +W         ++L         H ++++GL +S D + + TGSRDNT+ LWD+          +SRN+VT + + P   +I+ T EDK +R++D   L V   FP K++IQT C+VS D    IS SNGF G GCE TLWD+R  +  + E  GH  TV  C+F+       + +  P I +   D  + +WN         L    +  SG +TS+   +   L   ++N GI +L  + ++G  L  VA+ 
Sbjct:   24 MGKQQSKLKHSTYKYGRPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKTVVAYNWKTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQL-------CGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTGQSVERASVSRNVVTHLCWVPREPYILQTSEDKTLRLWDSRGLQVAHMFPAKQHIQTYCEVSVDGHKCISCSNGFGGEGCEATLWDLRQTRNRICEYKGHFQTVASCVFLPR-----ALALMPLIATSSHDCKVKIWN---QDTGACLFTLSLDGSGPLTSLAVGDAISLLCASFNRGIHLLRMDHSQGLELQEVAAF 367          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: WDR31 (WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:21421])

HSP 1 Score: 172.17 bits (435), Expect = 5.427e-49
Identity = 108/357 (30.25%), Postives = 175/357 (49.02%), Query Frame = 1
Query:  106 GKVSKKKNYMTKKIELNSITEPEVNN---FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
            GK   K  + T K   + I E  +       Y P   + ++ ++  NS++   G  + ++   N+    +    KGHE E+T++  + KS Q  + SRD+ + +W         ++L         H ++++GL +S D + + TGSRDNT+ LWD+          +SRN+VT + + P   +I+ T EDK +R++D   L V   FP K++IQT C+VS D    IS SNGF G GCE TLWD+R  +  + E  GH  TV  C+F+       + +  P I +   D  + +WN         L    +  SG +TS+   +   L   ++N GI +L  + ++G  L  VA+ 
Sbjct:   25 GKQQSKLKHSTYKYGPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKTVVAYNWKTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQL-------CGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTGQSVERASVSRNVVTHLCWVPREPYILQTSEDKTLRLWDSRGLQVAHMFPAKQHIQTYCEVSVDGHKCISCSNGFGGEGCEATLWDLRQTRNRICEYKGHFQTVASCVFLPR-----ALALMPLIATSSHDCKVKIWN---QDTGACLFTLSLDGSGPLTSLAVGDAISLLCASFNRGIHLLRMDHSQGLELQEVAAF 366          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: WDR31 (WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:21421])

HSP 1 Score: 172.17 bits (435), Expect = 5.427e-49
Identity = 108/357 (30.25%), Postives = 175/357 (49.02%), Query Frame = 1
Query:  106 GKVSKKKNYMTKKIELNSITEPEVNN---FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
            GK   K  + T K   + I E  +       Y P   + ++ ++  NS++   G  + ++   N+    +    KGHE E+T++  + KS Q  + SRD+ + +W         ++L         H ++++GL +S D + + TGSRDNT+ LWD+          +SRN+VT + + P   +I+ T EDK +R++D   L V   FP K++IQT C+VS D    IS SNGF G GCE TLWD+R  +  + E  GH  TV  C+F+       + +  P I +   D  + +WN         L    +  SG +TS+   +   L   ++N GI +L  + ++G  L  VA+ 
Sbjct:   25 GKQQSKLKHSTYKYGPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKTVVAYNWKTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQL-------CGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTGQSVERASVSRNVVTHLCWVPREPYILQTSEDKTLRLWDSRGLQVAHMFPAKQHIQTYCEVSVDGHKCISCSNGFGGEGCEATLWDLRQTRNRICEYKGHFQTVASCVFLPR-----ALALMPLIATSSHDCKVKIWN---QDTGACLFTLSLDGSGPLTSLAVGDAISLLCASFNRGIHLLRMDHSQGLELQEVAAF 366          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: WDR31 (WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:21421])

HSP 1 Score: 78.5666 bits (192), Expect = 6.399e-17
Identity = 41/133 (30.83%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  271 SISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGED 669
            ++   N+    +    KGHE E+T++  + KS Q  + SRD+ + +W         ++L C       H ++++GL +S D + + TGSRDNT+ LWD+          +SRN+VT + + P   +I+ T ED
Sbjct:   16 TVVAYNWKTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQL-C------GHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTGQSVERASVSRNVVTHLCWVPREPYILQTSED 141          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: POC1B (POC1 centriolar protein B [Source:HGNC Symbol;Acc:HGNC:30836])

HSP 1 Score: 82.0333 bits (201), Expect = 2.945e-16
Identity = 68/282 (24.11%), Postives = 119/282 (42.20%), Query Frame = 1
Query:  286 NFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISR--NLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            NF      +   GH+  VT +++      L + SRD++++LW          + R  F+   AH   +  +D S+D   + T S D +IK+W +  + Q+    + R  + V C K+SP    IV+  EDK I+I+D ++      F          D +     + SA     G+   + +WDVR+ K+L     H   VNC  F  +  +         + +  SD +L + + +E +    L  H  P   + T       +  A G  +T +++   N
Sbjct:    4 NFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWI--------PDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSM--YRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASA-----GSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNY---------LITASSDGTLKILDLLEGRLIYTLQGHTGP---VFTVSFSKGGELFASGGADTQVLLWRTN 258          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: T05A8.5 (pep chromosome:WBcel235:II:2731319:2735250:-1 gene:WBGene00020231.1 transcript:T05A8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05A8.5)

HSP 1 Score: 110.153 bits (274), Expect = 1.821e-26
Identity = 71/227 (31.28%), Postives = 114/227 (50.22%), Query Frame = 1
Query:  469 NAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYH 1149
            + H   ++G+ +S +E   ++GSRD ++K+WDL          I+RNLVT + Y+   + +  T EDK +R++DP + +V  EFP+KR+IQ  C+     ++  S SNGFN +GCE+T +DVR  +   E  GH+  V     +        D     + S  +D  + LW  +E     +L         I    +PLE   L V +Y  G +I+  +  +G L H
Sbjct:  140 DGHKFGVTGV-VSINENQFMSGSRDCSVKIWDLESAKCVRTQTINRNLVTHMAYN--GNLVAQTSEDKSVRLWDPRNASVVTEFPRKRHIQMFCEFDGANRF-FSCSNGFNNDGCEITSYDVRNPRQSREARGHEGNVTSLSIVQ------MDQTKRLLASVSADRQIRLWK-IEEDGQAVL-------KPIWNEDVPLEADNLQVCSYPDGHIIV--SGGKGRLIH 346          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: snrp-40.1 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q19211])

HSP 1 Score: 65.4698 bits (158), Expect = 1.682e-11
Identity = 64/267 (23.97%), Postives = 107/267 (40.07%), Query Frame = 1
Query:  310 FST-KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDI---SSDETT--------------------------------ILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFD-----PSSLNVTMEFPKKRYIQT---CCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLIL 978
            FST KGH   V  +K+ T S  L +   DKS+++W  ++ G      R      NA      G+ +   +SD+ T                                +++G  DN +K+WD+ +          R+ +T +  SP+  FI++   D  +R +D     P   +V +        +     C  S  E+++ + S+        L +W+   KKI+Y+L GH  +VNC  F   +         P + SCGSD  + L
Sbjct:   74 FSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVW-DMETGTCARRFRTHTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQVISGGIDNVLKVWDMRRDEITYTLTGHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFVPGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRF-----LYVWETLSKKIVYKLPGHMGSVNCTDFHPKE---------PIMLSCGSDKRVFL 325          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 61.2326 bits (147), Expect = 4.373e-10
Identity = 45/190 (23.68%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  295 NSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELI 864
            N ++  + +GH K ++  K+      L T S DK++K+W+        + + C+ TL+  H L ++ +  SSD   +++ S D T+K++++         K   N V C  ++P +S +V+   D+ +RI+D  +       P   +      VSF+    + AS  ++G    + +WD    + +  L+
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNM-------DHMICERTLT-GHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPA--HSDPVSAVSFNRDGSLIASGSYDG---LVRIWDTANGQCIKTLV 252          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 61.2326 bits (147), Expect = 4.373e-10
Identity = 45/190 (23.68%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  295 NSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELI 864
            N ++  + +GH K ++  K+      L T S DK++K+W+        + + C+ TL+  H L ++ +  SSD   +++ S D T+K++++         K   N V C  ++P +S +V+   D+ +RI+D  +       P   +      VSF+    + AS  ++G    + +WD    + +  L+
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNM-------DHMICERTLT-GHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPA--HSDPVSAVSFNRDGSLIASGSYDG---LVRIWDTANGQCIKTLV 252          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 60.8474 bits (146), Expect = 1.096e-9
Identity = 47/241 (19.50%), Postives = 94/241 (39.00%), Query Frame = 1
Query:  289 FNNSRIKFST--KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAH------DLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGED--KIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILW 981
            +N +   F T  + H+  +  +K+ +    L +  +   +K W                 ++NAH      D  I GL  +  +    T S D T ++WD  ++T++   +     V C+ + PT   I     D  + ++I+DP S +      + +      + + +  ++++      G    + ++D+RM K +     H+  V     IS  W    +       S G D S++ W
Sbjct:  171 WNGTAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQP--------------NMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTG-----GRDHLVKMYDIRMMKEMRTYRAHKKEV-----ISLAWHPIHEGL---FVSGGGDGSIVYW 384          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 70.8626 bits (172), Expect = 4.066e-13
Identity = 62/231 (26.84%), Postives = 103/231 (44.59%), Query Frame = 1
Query:  295 NSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQ-ATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            N  +KF+  GH K V+ +K+      L + S DK IK+W   D G  ++ +       + H L IS +  SSD   +++GS D T+K+W+L         K   N V C  ++P ++ IV+   D+ +RI+D  +       P      +    + D   ++S+S  ++G  C   +WD    + L  LI      V+   F  N  +         I +   DN+L LW+
Sbjct:   61 NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYD-GKFEKTI-------SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGL-CR--IWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY---------ILAATLDNTLKLWD 269          

HSP 2 Score: 50.8322 bits (120), Expect = 1.421e-6
Identity = 49/219 (22.37%), Postives = 99/219 (45.21%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKIS-----RNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFD---EKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNC 888
            G ++ ++ V   +  +   + KGH   V    +  +S  + + S D+S+++W  +  G      +C  TL  AH   +S +  + D + I++ S D   ++WD    T    C  +        V+ VK+SP   +I+A   D  ++++D S       +   +  + C   +F     K+++S S         + +W+++ K+++ +L GH  TV C
Sbjct:  132 GSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIW-DVRTG------KCLKTLP-AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD----TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED-----NMVYIWNLQSKEVVQKLQGHTDTVLC 333          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 70.8626 bits (172), Expect = 4.066e-13
Identity = 62/231 (26.84%), Postives = 103/231 (44.59%), Query Frame = 1
Query:  295 NSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQ-ATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            N  +KF+  GH K V+ +K+      L + S DK IK+W   D G  ++ +       + H L IS +  SSD   +++GS D T+K+W+L         K   N V C  ++P ++ IV+   D+ +RI+D  +       P      +    + D   ++S+S  ++G  C   +WD    + L  LI      V+   F  N  +         I +   DN+L LW+
Sbjct:   61 NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYD-GKFEKTI-------SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGL-CR--IWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY---------ILAATLDNTLKLWD 269          

HSP 2 Score: 50.8322 bits (120), Expect = 1.421e-6
Identity = 49/219 (22.37%), Postives = 99/219 (45.21%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKIS-----RNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFD---EKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNC 888
            G ++ ++ V   +  +   + KGH   V    +  +S  + + S D+S+++W  +  G      +C  TL  AH   +S +  + D + I++ S D   ++WD    T    C  +        V+ VK+SP   +I+A   D  ++++D S       +   +  + C   +F     K+++S S         + +W+++ K+++ +L GH  TV C
Sbjct:  132 GSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIW-DVRTG------KCLKTLP-AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD----TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED-----NMVYIWNLQSKEVVQKLQGHTDTVLC 333          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: CG6724 (gene:FBgn0032298 transcript:FBtr0333491)

HSP 1 Score: 62.3882 bits (150), Expect = 2.563e-10
Identity = 65/229 (28.38%), Postives = 103/229 (44.98%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWS-QIDEG--GIDEELRCDFTLS---NAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDP----SSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSL 972
            KGHE+ V  +       +  T S D  +K+WS ++D+   G  + ++   T       H   +S +    D TT+LTGS D+T+K+WDL     K +   ++++     YS  N  I+    DK +R++DP     S+          ++QT    S  E+++  +    N N     LWD R  K  LY+L+GH   V     +  DW     S    I S G DN++
Sbjct:  191 KGHERGVDSVSVSPDGLRFATGSWDTMLKVWSAELDDAVEGSSKRMKESGTPKITLQGHRESVSAVQWM-DATTLLTGSWDHTLKVWDLSLEGIKTEISTNKSIFDA-SYSKLNRLILTASADKNLRLYDPRTNQGSVVRNTYLGHNAWVQTVM-WSTTEEFLFVSGAYDNQN----KLWDCRSPKAPLYDLLGHGEKV-----LDIDW-----SNPKYIVSGGVDNTV 402          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: CG6724 (gene:FBgn0032298 transcript:FBtr0080191)

HSP 1 Score: 62.003 bits (149), Expect = 4.131e-10
Identity = 65/235 (27.66%), Postives = 100/235 (42.55%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWS------------QIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDP----SSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSL 972
            KGHE+ V  +       +  T S D  +K+WS            ++ E G+    R        H   +S +    D TT+LTGS D+T+K+WDL     K +   ++++     YS  N  I+    DK +R++DP     S+          ++QT    S  E+++  +    N N     LWD R  K  LY+L+GH   V     +  DW     S    I S G DN++
Sbjct:  191 KGHERGVDSVSVSPDGLRFATGSWDTMLKVWSAELDDAVEGSSKRMKESGV----RTPKITLQGHRESVSAVQWM-DATTLLTGSWDHTLKVWDLSLEGIKTEISTNKSIFDA-SYSKLNRLILTASADKNLRLYDPRTNQGSVVRNTYLGHNAWVQTVM-WSTTEEFLFVSGAYDNQN----KLWDCRSPKAPLYDLLGHGEKV-----LDIDW-----SNPKYIVSGGVDNTV 404          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: Gbeta76C (gene:FBgn0004623 transcript:FBtr0074949)

HSP 1 Score: 59.6918 bits (143), Expect = 1.734e-9
Identity = 61/226 (26.99%), Postives = 95/226 (42.04%), Query Frame = 1
Query:  235 NSNVGYCGFNNGSISVINFNNSRIKFSTK------GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEF--PKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNC 888
            + N   CG  +   +V + NN       K      G+E  ++  ++L     L T S D  I  W    E G+      DF   N H   I+GL +S D  T +TGS D T KLWD+ +   K         V+ V Y P+     +  ED+  R++D  +     ++  P+K    T C +S   +Y++    G  GN   +  WD   ++    L GH+  + C
Sbjct:  112 SGNFVACGGMDNQCTVYDVNNRDASGVAKMVKELMGYEGFLSSCRFLDDG-HLITGSGDMKICHWDL--EKGVKT---MDF---NGHAGDIAGLSLSPDMKTYITGSVDKTAKLWDVREEGHKQMFFGHDMDVSSVCYHPSGFGFASCSEDQTARMYDLRADQQIAQYEPPQKNTGFTSCALSTSGRYLMCG--GIEGN---VHSWDTMKQRHTGTLSGHENRITC 323          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: WDR31 (si:ch73-266o15.4 [Source:NCBI gene;Acc:568862])

HSP 1 Score: 179.489 bits (454), Expect = 3.076e-52
Identity = 114/354 (32.20%), Postives = 187/354 (52.82%), Query Frame = 1
Query:  106 GKVSKKKNYMTKKIELNSITEPEVNN--FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN-TARGSLYHVA 1155
            GK+  K    +   +     EP   +    Y P  T+ I C+    S++   G ++ ++ V ++   R+  S +GH +E+T++     S  + + SRDK++ +W    + G D E   +F+    H+L+++G+ +S D + + TGSRDN++ LWD+          ISRNLVT V + P ++ IV T EDK IR++D  +  VT  FP K+YIQT CDV+ +  +++S+SNGF G GCE TLWD+R     + E  GH  T  CC+F+      T   C   + S   D+S+ +W   +   +  L    +  SG + S+ P ++  L   ++NTG+  L  + +A  S+  VA
Sbjct:    2 GKLQSKFRRRSDLYKAKEGAEPAPVHQVVQYEPAHTDAINCVVSLTSDLCVSGGHDQAVVVYDWRAGRLCKSFQGHNREITKLCCFKGSSLIFSASRDKTVLMW----DLGRDTEAIQEFS---GHELVVNGVAVSPDGSKLCTGSRDNSMCLWDIESGECLQRNTISRNLVTHVCWVPGSTSIVQTSEDKTIRVWDSRTWQVTNTFPAKQYIQTHCDVNANCYHLLSSSNGFGGQGCEATLWDLRQPGCKVAEYRGHLQTTACCVFV-----PTRPGCPALVASSSYDSSVKIW---DQNTAACLYTLTLDGSGPLVSLAPCDSSSLLCASFNTGLHQLHLDQSAVPSITEVA 340          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: si:ch73-266o15.4 (si:ch73-266o15.4 [Source:NCBI gene;Acc:568862])

HSP 1 Score: 178.718 bits (452), Expect = 5.081e-52
Identity = 106/320 (33.12%), Postives = 173/320 (54.06%), Query Frame = 1
Query:  169 PEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            P      Y P  T+ I C+    S++   G ++ ++ V ++   R+  S +GH +E+T++     S  + + SRDK++ +W    + G D E   +F+    H+L+++G+ +S D + + TGSRDN++ LWD+          ISRNLVT V + P ++ IV T EDK IR++D  +  VT  FP K+YIQT CDV+ +  +++S+SNGF G GCE TLWD+R     + E  GH  T  CC+F+      T   C   + S   D+S+ +W   +   +  L    +  SG + S+ P ++  L   ++NTG+  L  +
Sbjct:   24 PVHQVVQYEPAHTDAINCVVSLTSDLCVSGGHDQAVVVYDWRAGRLCKSFQGHNREITKLCCFKGSSLIFSASRDKTVLMW----DLGRDTEAIQEFS---GHELVVNGVAVSPDGSKLCTGSRDNSMCLWDIESGECLQRNTISRNLVTHVCWVPGSTSIVQTSEDKTIRVWDSRTWQVTNTFPAKQYIQTHCDVNANCYHLLSSSNGFGGQGCEATLWDLRQPGCKVAEYRGHLQTTACCVFV-----PTRPGCPALVASSSYDSSVKIW---DQNTAACLYTLTLDGSGPLVSLAPCDSSSLLCASFNTGLHQLHLD 328          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: si:ch73-266o15.4 (si:ch73-266o15.4 [Source:NCBI gene;Acc:568862])

HSP 1 Score: 176.792 bits (447), Expect = 3.115e-51
Identity = 109/331 (32.93%), Postives = 178/331 (53.78%), Query Frame = 1
Query:  169 PEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN-TARGSLYHVA 1155
            P      Y P  T+ I C+    S++   G ++ ++ V ++   R+  S +GH +E+T++     S  + + SRDK++ +W    + G D E   +F+    H+L+++G+ +S D + + TGSRDN++ LWD+          ISRNLVT V + P ++ IV T EDK IR++D  +  VT  FP K+YIQT CDV+ +  +++S+SNGF G GCE TLWD+R     + E  GH  T  CC+F+          C   + S   D+S+ +W   +   +  L    +  SG + S+ P ++  L   ++NTG+  L  + +A  S+  VA
Sbjct:   24 PVHQVVQYEPAHTDAINCVVSLTSDLCVSGGHDQAVVVYDWRAGRLCKSFQGHNREITKLCCFKGSSLIFSASRDKTVLMW----DLGRDTEAIQEFS---GHELVVNGVAVSPDGSKLCTGSRDNSMCLWDIESGECLQRNTISRNLVTHVCWVPGSTSIVQTSEDKTIRVWDSRTWQVTNTFPAKQYIQTHCDVNANCYHLLSSSNGFGGQGCEATLWDLRQPGCKVAEYRGHLQTTACCVFV-----PPRPGCPALVASSSYDSSVKIW---DQNTAACLYTLTLDGSGPLVSLAPCDSSSLLCASFNTGLHQLHLDQSAVPSITEVA 339          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 78.1814 bits (191), Expect = 3.577e-15
Identity = 61/285 (21.40%), Postives = 122/285 (42.81%), Query Frame = 1
Query:  271 SISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            S+ + N       F   GH   +T + +      + + SRD++++LW+          ++ + T+  AH   +  +  S D   ++T S D ++K+W + +           N V C ++SP    I + G+D+ +R++D SS      F    Y  +   V F+      AS+G +     + +WD+R  K++     H A VNC  F  +  +         + S  SD+++ + + +E +    L  H  P   ++T     +    A G  ++ +++ + N
Sbjct:   41 SLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWT--------PSIKGESTVFKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTD--YGGSATFVDFNSSGTCIASSGADNT---IKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNY---------LISGSSDSTIKILDLLEGRLIYTLHGHKGP---VLTVTFSRDGDLFASGGADSQVLMWKTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 78.1814 bits (191), Expect = 4.206e-15
Identity = 61/285 (21.40%), Postives = 122/285 (42.81%), Query Frame = 1
Query:  271 SISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            S+ + N       F   GH   +T + +      + + SRD++++LW+          ++ + T+  AH   +  +  S D   ++T S D ++K+W + +           N V C ++SP    I + G+D+ +R++D SS      F    Y  +   V F+      AS+G +     + +WD+R  K++     H A VNC  F  +  +         + S  SD+++ + + +E +    L  H  P   ++T     +    A G  ++ +++ + N
Sbjct:   41 SLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWT--------PSIKGESTVFKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTD--YGGSATFVDFNSSGTCIASSGADNT---IKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNY---------LISGSSDSTIKILDLLEGRLIYTLHGHKGP---VLTVTFSRDGDLFASGGADSQVLMWKTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 73.9442 bits (180), Expect = 7.329e-14
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS---LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            + + NF      +   GH++ VT +++      + + S+D++++LW+          ++ + ++  AH  ++  ++ SSD  T +T S D +IK W+L +           N V C ++SP    I +  +DK +RI+D ++   +N  +++           V F+      AS G +     + +WD+R  K+L     H A VN   F
Sbjct:   42 VMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWA--------PNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNY-----VDFNPMGTCVASAGVDST---VKVWDIRTNKLLQHYQVHNAGVNSLSF 236          

HSP 2 Score: 59.3066 bits (142), Expect = 4.641e-9
Identity = 35/171 (20.47%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
             H   ++ +D S D   + + S D  + +W+    ++       +  VTCV++SP+   + ++ +D+ +R++ P+    +        +  C + S D    I+AS+  +     +  W++  ++ LY L  H   V C  F  +            I SC  D ++ +W+
Sbjct:   16 GHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKS-----IKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL---------IASCSDDKTVRIWD 172          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 73.9442 bits (180), Expect = 1.134e-13
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS---LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            + + NF      +   GH++ VT +++      + + S+D++++LW+          ++ + ++  AH  ++  ++ SSD  T +T S D +IK W+L +           N V C ++SP    I +  +DK +RI+D ++   +N  +++           V F+      AS G +     + +WD+R  K+L     H A VN   F
Sbjct:   27 VMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWA--------PNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNY-----VDFNPMGTCVASAGVDST---VKVWDIRTNKLLQHYQVHNAGVNSLSF 221          

HSP 2 Score: 58.5362 bits (140), Expect = 9.021e-9
Identity = 34/166 (20.48%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  487 ISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            ++ +D S D   + + S D  + +W+    ++       +  VTCV++SP+   + ++ +D+ +R++ P+    +        +  C + S D    I+AS+  +     +  W++  ++ LY L  H   V C  F  +            I SC  D ++ +W+
Sbjct:    6 VTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKS-----IKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL---------IASCSDDKTVRIWD 157          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 73.559 bits (179), Expect = 1.202e-13
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS---LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            + + NF      +   GH++ VT +++      + + S+D++++LW+          ++ + ++  AH  ++  ++ SSD  T +T S D +IK W+L +           N V C ++SP    I +  +DK +RI+D ++   +N  +++           V F+      AS G +     + +WD+R  K+L     H A VN   F
Sbjct:   39 VMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWA--------PNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNY-----VDFNPMGTCVASAGVDST---VKVWDIRTNKLLQHYQVHNAGVNSLSF 233          

HSP 2 Score: 59.3066 bits (142), Expect = 4.839e-9
Identity = 35/171 (20.47%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
             H   ++ +D S D   + + S D  + +W+    ++       +  VTCV++SP+   + ++ +D+ +R++ P+    +        +  C + S D    I+AS+  +     +  W++  ++ LY L  H   V C  F  +            I SC  D ++ +W+
Sbjct:   13 GHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKS-----IKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL---------IASCSDDKTVRIWD 169          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 73.9442 bits (180), Expect = 1.231e-13
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS---LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            + + NF      +   GH++ VT +++      + + S+D++++LW+          ++ + ++  AH  ++  ++ SSD  T +T S D +IK W+L +           N V C ++SP    I +  +DK +RI+D ++   +N  +++           V F+      AS G +     + +WD+R  K+L     H A VN   F
Sbjct:   42 VMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWA--------PNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNY-----VDFNPMGTCVASAGVDST---VKVWDIRTNKLLQHYQVHNAGVNSLSF 236          

HSP 2 Score: 59.6918 bits (143), Expect = 3.747e-9
Identity = 35/171 (20.47%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
             H   ++ +D S D   + + S D  + +W+    ++       +  VTCV++SP+   + ++ +D+ +R++ P+    +        +  C + S D    I+AS+  +     +  W++  ++ LY L  H   V C  F  +            I SC  D ++ +W+
Sbjct:   16 GHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKS-----IKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL---------IASCSDDKTVRIWD 172          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 73.9442 bits (180), Expect = 1.386e-13
Identity = 50/211 (23.70%), Postives = 97/211 (45.97%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS---LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            + + NF      +   GH++ VT +++      + + S+D++++LW+          ++ + ++  AH  ++  ++ SSD  T +T S D +IK W+L +           N V C ++SP    I +  +DK +RI+D ++   +N  +++           V F+      AS G +     + +WD+R  K+L     H A VN   F
Sbjct:   42 VMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWA--------PNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNY-----VDFNPMGTCVASAGVDST---VKVWDIRTNKLLQHYQVHNAGVNSLSF 236          

HSP 2 Score: 59.6918 bits (143), Expect = 4.584e-9
Identity = 35/171 (20.47%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
             H   ++ +D S D   + + S D  + +W+    ++       +  VTCV++SP+   + ++ +D+ +R++ P+    +        +  C + S D    I+AS+  +     +  W++  ++ LY L  H   V C  F  +            I SC  D ++ +W+
Sbjct:   16 GHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKS-----IKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL---------IASCSDDKTVRIWD 172          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr31 (WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:1918604])

HSP 1 Score: 175.637 bits (444), Expect = 1.534e-50
Identity = 108/361 (29.92%), Postives = 182/361 (50.42%), Query Frame = 1
Query:   94 YCMGGKVSKKKNYMTKKIELNSITEPEVNN---FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
            + + GK+  K  + T     + I E  V       Y P+  + ++ ++  NS++   G  + +    N+   R+     GHE+E+T++  + K+ Q  + SRDK++ +W         ++L       + H ++++GL +S D + + TGSRDN++ LWD+          +SRNLVT + + P+  +IV T EDK IR++D   L +   FP K++IQT C+VS D    IS S+GF G GCE TLWD+R  +  + E  GH  TV  C+F+       S +  P I +   D+ + +WN         LS   +  SG +TS+   +   L   ++  G+ +L  + ++G  L  VA+ 
Sbjct:   21 WAVMGKLQSKLRHSTYLYRPDGIIEERVQTKAPQEYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHEREITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQL-------SGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPK-----STALMPMIATSAHDSKVKIWN---QDTGACLSTLSLDGSGPLTSLAVGDISSLLCASFYRGVHLLRVDHSQGLELQEVAAF 366          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr31 (WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:1918604])

HSP 1 Score: 172.555 bits (436), Expect = 2.644e-49
Identity = 101/327 (30.89%), Postives = 170/327 (51.99%), Query Frame = 1
Query:  187 NYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
             Y P+  + ++ ++  NS++   G  + +    N+   R+     GHE+E+T++  + K+ Q  + SRDK++ +W         ++L       + H ++++GL +S D + + TGSRDN++ LWD+          +SRNLVT + + P+  +IV T EDK IR++D   L +   FP K++IQT C+VS D    IS S+GF G GCE TLWD+R  +  + E  GH  TV  C+F+       S +  P I +   D+ + +WN         LS   +  SG +TS+   +   L   ++  G+ +L  + ++G  L  VA+ 
Sbjct:   56 EYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHEREITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQL-------SGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPK-----STALMPMIATSAHDSKVKIWN---QDTGACLSTLSLDGSGPLTSLAVGDISSLLCASFYRGVHLLRVDHSQGLELQEVAAF 367          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr31 (WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:1918604])

HSP 1 Score: 172.555 bits (436), Expect = 2.644e-49
Identity = 101/327 (30.89%), Postives = 170/327 (51.99%), Query Frame = 1
Query:  187 NYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
             Y P+  + ++ ++  NS++   G  + +    N+   R+     GHE+E+T++  + K+ Q  + SRDK++ +W         ++L       + H ++++GL +S D + + TGSRDN++ LWD+          +SRNLVT + + P+  +IV T EDK IR++D   L +   FP K++IQT C+VS D    IS S+GF G GCE TLWD+R  +  + E  GH  TV  C+F+       S +  P I +   D+ + +WN         LS   +  SG +TS+   +   L   ++  G+ +L  + ++G  L  VA+ 
Sbjct:   56 EYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHEREITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQL-------SGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPK-----STALMPMIATSAHDSKVKIWN---QDTGACLSTLSLDGSGPLTSLAVGDISSLLCASFYRGVHLLRVDHSQGLELQEVAAF 367          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr31 (WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:1918604])

HSP 1 Score: 91.2781 bits (225), Expect = 5.686e-22
Identity = 47/99 (47.47%), Postives = 62/99 (62.63%), Query Frame = 1
Query:  529 TGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTL 825
            TGSRDN++ LWD+          +SRNLVT + + P+  +IV T EDK IR++D   L +   FP K++IQT C+VS D    IS S+GF G GCE TL
Sbjct:    2 TGSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATL 100          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Poc1b (POC1 centriolar protein B [Source:MGI Symbol;Acc:MGI:1918511])

HSP 1 Score: 85.1149 bits (209), Expect = 1.714e-17
Identity = 56/194 (28.87%), Postives = 93/194 (47.94%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISR--NLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            GH+  VT +++  +   L + SRD++++LW  +D  G   E +       AH   +  +D S+D   ++T S D +IK+W +  F Q+    + R  + V C K+SP    IV+  EDK I+I+D ++      F          D + +   + SA     G+   + +WD+RM K+L     H   VNC  F
Sbjct:   16 GHKDVVTSLQFSPQGNLLASASRDRTVRLWV-LDRKGKSSEFK-------AHTAPVRSVDFSADGQLLVTASEDKSIKVWSM--FRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPNGTCIASA-----GSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSF 194          

HSP 2 Score: 50.0618 bits (118), Expect = 4.003e-6
Identity = 54/229 (23.58%), Postives = 89/229 (38.86%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVS------FDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            K H   V  + +      L T S DKSIK+WS   +       R  ++L   H   +     S D   I++ S D TIK+WD        +   S      V ++P  + I + G D  ++I+D     + M    + Y    C V+           V ++S+G       + + D+   +++Y L GH   V    F  +    TS          G+D  +++W T
Sbjct:   57 KAHTAPVRSVDFSADGQLLVTASEDKSIKVWSMFRQ-------RFLYSLYR-HTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPNGTCIASAGSDHAVKIWD-----IRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDG------TVKMLDLIEGRLIYTLQGHTGPVFTVSFSKDGELLTSG---------GADAQVLIWRT 257          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q9JHB4|WDR31_MOUSE (WD repeat-containing protein 31 OS=Mus musculus OX=10090 GN=Wdr31 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.850e-48
Identity = 101/327 (30.89%), Postives = 170/327 (51.99%), Query Frame = 1
Query:  187 NYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
             Y P+  + ++ ++  NS++   G  + +    N+   R+     GHE+E+T++  + K+ Q  + SRDK++ +W         ++L       + H ++++GL +S D + + TGSRDN++ LWD+          +SRNLVT + + P+  +IV T EDK IR++D   L +   FP K++IQT C+VS D    IS S+GF G GCE TLWD+R  +  + E  GH  TV  C+F+       S +  P I +   D+ + +WN         LS   +  SG +TS+   +   L   ++  G+ +L  + ++G  L  VA+ 
Sbjct:   56 EYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHEREITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQL-------SGHAMVVTGLAVSPDSSQLCTGSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMAHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVASCVFLPK-----STALMPMIATSAHDSKVKIWN---QDTGACLSTLSLDGSGPLTSLAVGDISSLLCASFYRGVHLLRVDHSQGLELQEVAAF 367          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q8NA23|WDR31_HUMAN (WD repeat-containing protein 31 OS=Homo sapiens OX=9606 GN=WDR31 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.850e-48
Identity = 109/359 (30.36%), Postives = 177/359 (49.30%), Query Frame = 1
Query:  100 MGGKVSKKKNYMTKKIELNSITEPEVNN---FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRM-KKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARG-SLYHVASI 1161
            MG + SK K+   K    + I E  +       Y P   + ++ ++  NS++   G  + ++   N+    +    KGHE E+T++  + KS Q  + SRD+ + +W         ++L         H ++++GL +S D + + TGSRDNT+ LWD+          +SRN+VT + + P   +I+ T EDK +R++D   L V   FP K++IQT C+VS D    IS SNGF G GCE TLWD+R  +  + E  GH  TV  C+F+       + +  P I +   D  + +WN         L    +  SG +TS+   +   L   ++N GI +L  + ++G  L  VA+ 
Sbjct:   24 MGKQQSKLKHSTYKYGRPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKTVVAYNWKTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQL-------CGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTGQSVERASVSRNVVTHLCWVPREPYILQTSEDKTLRLWDSRGLQVAHMFPAKQHIQTYCEVSVDGHKCISCSNGFGGEGCEATLWDLRQTRNRICEYKGHFQTVASCVFLPR-----ALALMPLIATSSHDCKVKIWN---QDTGACLFTLSLDGSGPLTSLAVGDAISLLCASFNRGIHLLRMDHSQGLELQEVAAF 367          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|D3ZW91|POC1B_RAT (POC1 centriolar protein homolog B OS=Rattus norvegicus OX=10116 GN=Poc1b PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.727e-17
Identity = 57/194 (29.38%), Postives = 93/194 (47.94%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRN--LVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            GH+  VT +++  +   L + SRDK+++LW  +D  G   E +       AH   +  +D S+D   ++T S D +IK+W +  + Q+    + R+   V C K+SP    IV+  EDK I+I+D +S      F          D S +   + SA     G+   + +WD+RM ++L     H   VNC  F
Sbjct:   58 GHKDVVTSLQFSPQGNLLASASRDKTVRLWV-LDRKGKSSEFK-------AHTAPVRSVDFSADGQFLVTASEDKSIKVWSM--YRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTSKQCVNNFSDSVGFANFVDFSPNGTCIASA-----GSDHAVRIWDIRMNRLLQHYQVHSCGVNCLSF 236          

HSP 2 Score: 60.8474 bits (146), Expect = 1.072e-8
Identity = 55/242 (22.73%), Postives = 101/242 (41.74%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGI 1044
            KGH+  +T   +     Q+ T S D  + LWS      +    R    +   H  +++ L  S     + + SRD T++LW L +  + ++ K     V  V +S    F+V   EDK I+++            +  +   C   S D + ++S S         + +WD   K+ +        +V    F+    FS + +C   I S GSD+++ +W+    +   +L ++ V S G+
Sbjct:   15 KGHKAAITSADFSPNCKQIATASWDTFLMLWS------LKPHARAYRYV--GHKDVVTSLQFSPQGNLLASASRDKTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQFLVTASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKT-----IKIWDTTSKQCVNNF---SDSVGFANFVD---FSPNGTC---IASAGSDHAVRIWDIRMNR---LLQHYQVHSCGV 231          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q5RD06|POC1B_PONAB (POC1 centriolar protein homolog B OS=Pongo abelii OX=9601 GN=POC1B PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.859e-16
Identity = 69/282 (24.47%), Postives = 120/282 (42.55%), Query Frame = 1
Query:  286 NFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISR--NLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            NF      +   GH+  VT +++      L + SRD++++LW          + R  F+   AH   +  +D S+D   + T S D +IK+W +  + Q+    + R  + V C K+SP    IV+  EDK I+I+D ++      F          D +     + SA     G+   + +WDVR+ K+L     H   VNC  F  +D +         + +  SD +L + + +E +    L  H  P   + T       +  A G  +T +++   N
Sbjct:   46 NFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWI--------PDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSM--YRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASA-----GSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSDNY---------LVTASSDGTLKILDLLEGRLIYTLQGHTGP---VFTVSFSKGGELFASGGADTQVLLWRTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q8TC44|POC1B_HUMAN (POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.791e-15
Identity = 68/282 (24.11%), Postives = 119/282 (42.20%), Query Frame = 1
Query:  286 NFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISR--NLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            NF      +   GH+  VT +++      L + SRD++++LW          + R  F+   AH   +  +D S+D   + T S D +IK+W +  + Q+    + R  + V C K+SP    IV+  EDK I+I+D ++      F          D +     + SA     G+   + +WDVR+ K+L     H   VNC  F  +  +         + +  SD +L + + +E +    L  H  P   + T       +  A G  +T +++   N
Sbjct:   46 NFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWI--------PDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSM--YRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASA-----GSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNY---------LITASSDGTLKILDLLEGRLIYTLQGHTGP---VFTVSFSKGGELFASGGADTQVLLWRTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A210QBM0 (WD repeat-containing protein 31 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04324 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.792e-56
Identity = 117/322 (36.34%), Postives = 188/322 (58.39%), Query Frame = 1
Query:  190 YPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYHVA 1155
            Y PI +E +  L+   S +   G  + S+++ +++N R++    GHE+EVT++ Y      L + SRDKS+++W +     +       FT    HDL+++ LD+S+D   + TGSRDNT++LWD+ K     +  I RNLVT VK+ P  S +V TGEDK +RIF+  +L VT  FPKK+YIQ CCDVS D  Y ++ SNGF GNGCE TL+D+R   I++E  GH+  +  C+F+    F+  +     I +   D S+ +W   +      +++  +  SG +TS++  ++  + V +++ GI  L+ + A G+L+ VA
Sbjct:   39 YGPIHSEAVVSLAAIQSGLCLSGSKDRSVALYDYHNHRLEDKWTGHEREVTKVCYGRNCGGLFSASRDKSVRMWHRGSPSPVQT-----FT---GHDLVVTALDLSNDNLLLCTGSRDNTVRLWDVEKGECLLENNIHRNLVTDVKFIPQLSSLVQTGEDKQVRIFETKNLLVTHTFPKKQYIQMCCDVSKDGNYCLTCSNGFGGNGCEATLYDLRTMSIVHEYKGHREAIESCIFLP---FNGQN----LIATASRDCSVRIW---DRDTKECVADTSISGSGPLTSLICYDDSSICVSSFHMGIFQLQLSLANGTLWPVA 342          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A3S0ZNK7 (WD_REPEATS_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_013153 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.995e-56
Identity = 115/329 (34.95%), Postives = 184/329 (55.93%), Query Frame = 1
Query:  196 PITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGS-DNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYHVASI**KLHF 1179
            P+ ++ +  +     ++   G  +G + + NFN+  +  S  GH+  +T++ Y      + + SRDK+IKLW Q +   I  E R        H L++S +  ++D +++ +GSRDNT++LWD+          I +NLVT VK+ P +  +  TGEDK +RIFD  SL     FPKK+YIQ CCDVS D +Y+ S+SNGF+GNGCE T+WD+R +++L EL GH   V  C+F+       + S  P + +  S D S+ LW   + Q+   LS+  +  +G +TS+    + ++ VG++N G+ +L  +   GSL  +      LHF
Sbjct:   64 PVHSDAVASVGVVPPDLCLSGSKDGVVRLFNFNSQSLVASWSGHDSAITKVCYGASCSGIFSASRDKTIKLWHQGNPRCI-REFR-------GHTLVVSAIHTNADSSSLCSGSRDNTVRLWDVESGACTRINTIPQNLVTDVKFVPDSFLLAQTGEDKELRIFDLRSLEPVFSFPKKQYIQMCCDVSQDGRYICSSSNGFSGNGCEATVWDLRGRRLLQELRGHHEAVEACVFLPG-----AGSERPLLVATASRDCSVKLW---DGQSGDCLSDCPLSGAGPLTSLAVCSDGRILVGSFNQGVHVLGKDI--GSLQSL------LHF 368          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: R7UKK1 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_168654 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.388e-55
Identity = 109/326 (33.44%), Postives = 176/326 (53.99%), Query Frame = 1
Query:  190 YPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVI--LEYNTARGSLYHVASI 1161
            +P    EPIT +   + +V      + + S  +F N +++    GH  EVT   Y  +S    + SRD+ I +W++     +             H+L+++ L ++ D + +++GSRDN + LWD+ +        ISRNL+T + ++P ++ I  TGEDK +RI+D  +L V+  FP+K++IQ CC +S D  Y +++SNGF+GNGCE TLWD+R   I+ E  GH  +V  C FI     ST  +    + +C SD S+ +W   + Q +  ++   VP SG +TS+    +  L VG++N G+    LE    R  L+ VAS 
Sbjct:   20 WPKTHEEPITSVFAVSPSVCLSSSKDNTFSQFDFKNGKLQKRWHGHSAEVTEAVYGHQSQMYFSASRDRVIHVWNKDSVSPVKSLA--------GHELVVTALSLNQDNSMLVSGSRDNALILWDVQQGVSVLKNSISRNLITHIHWAPHSNMIAQTGEDKDVRIWDARTLKVSQTFPRKQHIQLCCQISDDRNYCLTSSNGFSGNGCEATLWDLRQSGIVREFKGHMESVGGCCFIP----STLSNGQNLLATCSSDCSVRVW---DEQTAECVAVETVPGSGPLTSMAVFPDSCLCVGSFNVGVSTFQLEKQLERWILFQVASF 330          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: V4B3D6 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_156088 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.589e-55
Identity = 107/308 (34.74%), Postives = 172/308 (55.84%), Query Frame = 1
Query:  196 PITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILE 1119
            P+ +E +  LS     +   G  + S+ + ++ N R +    GHE+E+T++ Y +    + + SRDK+IK+W +     + E +         HDL+++ +  +SD T + +GSRDNT+K+WD+          I +NLVT VK+ P    I+ TGEDK +RIFD  +++V   F KK+YIQ  CD++ D  Y ++ SNGF GNGCE +LWD+R KK+L+E  GH   +  C+F+ N            + +   D S+ +WN  +TQ    ++      SG +TS++  E+  + VGT+N GI +LE
Sbjct:   27 PVHSEAVVSLSSVQPGLCLSGSKDKSVILYDYLNKRQEDKWTGHEREITKVCYGSSCLGVFSASRDKTIKMWQRGSSHVVREFI--------GHDLVVTAIHANSDTTRLCSGSRDNTVKIWDVETAKCLVQSNIPQNLVTDVKWIPNTEQILQTGEDKEVRIFDSRNMDVVYNFIKKQYIQMACDITTDGTYCLTCSNGFTGNGCEASLWDLRNKKLLHEFNGHLEAIESCIFLPNQ---------SLVATASRDCSVKVWN-RDTQ--ECITEWCFDGSGPLTSVIAYEDNSILVGTFNQGIQVLE 314          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A2B4SGD2 (WD repeat-containing protein 31 OS=Stylophora pistillata OX=50429 GN=Wdr31 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.300e-51
Identity = 110/358 (30.73%), Postives = 193/358 (53.91%), Query Frame = 1
Query:   97 CMGGKVSKKKNYMTKKIELNSITEPEVNN------FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSP-TNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGI--VILEYNTARGSL 1143
            CMG K SK + +     E + ++   V +        +  I  + +TC++         G  +  + + N+          GH ++VT++KY+ ++  + + SRDK+IK+W Q  + G +  L  +      H L+++ +D++ D T + +GSRDN ++LWD  K T  ++ ++SRNLV+CVK+ P T + +  TGEDK++RI+D  ++  +  FP ++Y QTCCD S D +++++ SNGFNG GCE TLWDVR K ++    GHQ T + C+F+ +    +S      I +   D+++ +W   E  ++  L+      +G +T +   ++  L V T N G+   +LE    +  L
Sbjct:   13 CMGLKKSKPRRFQ----EYDGVSSSGVESKTVQSVVEFESIHRDAVTCINAYAPGTCLTGGKDNLVVLFNWKQGVTLCQWSGHSRDVTKVKYVGET--IYSSSRDKTIKVW-QTSKAGNEPILTFE-----GHRLVVTAIDLNEDGTLLFSGSRDNCVRLWDTTKNTSISEKEVSRNLVSCVKWIPGTQAQVAQTGEDKMVRIWDTRNMQPSFTFPAQQYFQTCCDCSRDGQFILTCSNGFNGKGCEATLWDVRAKGMVCRYFGHQQTTSACIFLPHLEHVSSKY---LIATASHDSTVKIW---EKDSTECLATLDFSGAGPLTDLCAWDDGSLCVSTTNMGVYQCVLESREGKPEL 352          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: si:ch73-266o15.4 (WD repeat domain 31 [Source:NCBI gene;Acc:103044577])

HSP 1 Score: 178.333 bits (451), Expect = 8.058e-52
Identity = 112/345 (32.46%), Postives = 179/345 (51.88%), Query Frame = 1
Query:  109 KVSKKKNYMTKKIELNSITEPEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGS 1140
            K  ++ +    K    S   P+V  F   P  ++ + C++   S++   G  + ++ V ++   +   S  GH KEVT++     S  + + SRDKS+ +W   D  G  E ++        H+L+I+G+ +  D + + TGSRDN++ LWD+          ISRNLVT V + P  + IV T EDK IR++D  S  VT  FP K+YIQT CD+S +  +++S+SNGF G GCE TLWD+R     + E  GH  T  CC+F+       S    P + S   D+S+ +W   +   +  L    +  SG + S+ P ++  L   ++NTG  + + N +RG+
Sbjct:    7 KFRRRSDLYKAKEGAESAPVPQVVQFE--PAHSDAVNCVTCLTSDLCVSGGIDQAVVVYDWRAGKPCRSFHGHNKEVTKLACFGGSTWIFSASRDKSVMMW---DFAGGSEPIQ----TFRGHELVINGVAVGPDGSRLCTGSRDNSMCLWDIETGACLQKNTISRNLVTHVCWVPGGTSIVQTSEDKTIRVWDSRSWQVTNTFPAKQYIQTHCDISPNCNHLLSSSNGFQGQGCEATLWDLRQPGCKVVEYRGHLQTTACCVFL-----PPSIGSPPLVASASFDSSIKIW---DQNTAACLCTLSLDGSGPLVSLAPCDSSSLLCASFNTG--LHQLNLSRGA 332          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 92.8189 bits (229), Expect = 2.327e-20
Identity = 68/290 (23.45%), Postives = 129/290 (44.48%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            G ++ ++ V N N     F  +GH+  VT + +      L + SRDK+++LW+          ++ D T+  AH   +  ++ SSD   ++T S D ++K+W + +           N V C ++SP    + + G+D+ +R++D SS      F    Y      V F+      AS+G +     L +WD+R  K++     H A+VNC  F  +  +         + S  SD+++ + + +E +    L  H  P   ++  +   E    A G  +  +++ + N
Sbjct:   36 GSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWT--------PNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTD--YGGPATFVDFNASGTCIASSGADNT---LKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNY---------LISGSSDSTVKILDLLEGRLIYTLYGHKGP---VLAVVFSREGDLFASGGADLQVLMWKTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 92.4337 bits (228), Expect = 6.188e-20
Identity = 68/290 (23.45%), Postives = 129/290 (44.48%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            G ++ ++ V N N     F  +GH+  VT + +      L + SRDK+++LW+          ++ D T+  AH   +  ++ SSD   ++T S D ++K+W + +           N V C ++SP    + + G+D+ +R++D SS      F    Y      V F+      AS+G +     L +WD+R  K++     H A+VNC  F  +  +         + S  SD+++ + + +E +    L  H  P   ++  +   E    A G  +  +++ + N
Sbjct:   36 GSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWT--------PNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTD--YGGPATFVDFNASGTCIASSGADNT---LKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNY---------LISGSSDSTVKILDLLEGRLIYTLYGHKGP---VLAVVFSREGDLFASGGADLQVLMWKTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 92.4337 bits (228), Expect = 7.537e-20
Identity = 76/330 (23.03%), Postives = 141/330 (42.73%), Query Frame = 1
Query:  166 EPEVNNFNYPPITTE----------PITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
            EP+VN ++    T E          P    S     +   G ++ ++ V N N     F  +GH+  VT + +      L + SRDK+++LW+          ++ D T+  AH   +  ++ SSD   ++T S D ++K+W + +           N V C ++SP    + + G+D+ +R++D SS      F    Y      V F+      AS+G +     L +WD+R  K++     H A+VNC  F  +  +         + S  SD+++ + + +E +    L  H  P   ++  +   E    A G  +  +++ + N
Sbjct:   10 EPDVNLYDLEDPTLERCFKGHRDAVPCADFSPSKKQLA-TGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWT--------PNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTD--YGGPATFVDFNASGTCIASSGADNT---LKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNY---------LISGSSDSTVKILDLLEGRLIYTLYGHKGP---VLAVVFSREGDLFASGGADLQVLMWKTN 313          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 77.0258 bits (188), Expect = 3.912e-15
Identity = 60/246 (24.39%), Postives = 111/246 (45.12%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISR--NLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTS 1053
            GH+  V  +++      + + SRDK+++LW    +G        + T+  AH   +  ++ SSD  +++T S D T+K+W + +  QK    + +  N V C K+SP    IV+  +D+ ++I+D +S      F +      C D  F       A+ G +     + +WD+R  K+L     H A VN   F          S    + +  +D++L + + +E +    L  H  P++ +  S
Sbjct:   54 GHKDAVMSVQFSPSGRLVASASRDKTVRLWVPGVKG--------ESTVFRAHTGTVRSINFSSDGQSLVTASDDKTVKVWTVHR--QKFLFSLCQHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCEHSGFVNCAD--FHPSGTCIAAGGTDNT---VKVWDIRTNKLLQHYQVHSAVVNSLSF---------HSSGNYLITASNDSTLKILDLVEGRLLYTLHGHQGPATCVAFS 275          

HSP 2 Score: 49.6766 bits (117), Expect = 2.959e-6
Identity = 30/142 (21.13%), Postives = 63/142 (44.37%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
             H   ++ +D + +   I+TG+ D+ + +W+L    +       ++ V  V++SP+   + +   DK +R++ P     +  F          + S D + +++AS+        + +W V  +K L+ L  H   V C  F
Sbjct:   12 GHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSPSGRLVASASRDKTVRLWVPGVKGESTVFRAHTGTVRSINFSSDGQSLVTASDDKT-----VKVWTVHRQKFLFSLCQHINWVRCAKF 148          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 75.0998 bits (183), Expect = 5.307e-15
Identity = 57/266 (21.43%), Postives = 111/266 (41.73%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTS 1053
            G  +  + V NF      +   GH+  V  +++      + + SRDK+++LW           ++ + T+  AH   +  +  S+D  +++T S D +IK+W + +           N V   K+SP    IV+  +D+ +R++D +S      F +        D       + +A     G    + +WD+RM K+L     H A VN   F     +         + +  +D++L + + +E +    L  H  P++ +  S
Sbjct:   36 GSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWV--------PSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAA-----GTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNY---------LITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFS 279          

HSP 2 Score: 53.1434 bits (126), Expect = 6.115e-8
Identity = 42/175 (24.00%), Postives = 79/175 (45.14%), Query Frame = 1
Query:  472 AHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSF--DEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLI-LWNT 987
             H   I+ +D + +   + +GS D  + +W+    T+       ++ V  V++SP+   +V+   DK +R++ PS    +  F  K +  T   VSF  D + +++AS+  +     + +W V  +K LY L  H   V    F          S   R+   GSD+  + +W++
Sbjct:   16 GHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVF--KAHTATVRSVSFSADGQSLVTASDDKS-----IKVWTVHRQKFLYSLNQHSNWVRSAKF----------SPDGRLIVSGSDDRTVRVWDS 173          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 67.3958 bits (163), Expect = 1.254e-12
Identity = 63/235 (26.81%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  301 RIKFSTKGHEKEVTRMKYLTKSCQL-CTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTC-CDVSFDEKYVISASNGFNGNGCE-------LTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLIL 978
            RIK   KGH   V       +  Q+ CT S D ++KLW    +G +        +  N +  +    + +SD+  IL+G  DN IK+WDL +       K   + VT +  SP  S++++   D  +RI+D     +    P +R ++    +V   EK ++  S   +G+          + +WD   ++ILY+L GH  +VN   F   +         P + SC +D  L L
Sbjct:  134 RIK-RLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSV-------HSFQNTYQCLSVTFNDTSDQ--ILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWD-----IRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEE---------PIVLSCANDKRLYL 344          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:321652])

HSP 1 Score: 65.0846 bits (157), Expect = 1.056e-11
Identity = 62/263 (23.57%), Postives = 112/263 (42.59%), Query Frame = 1
Query:  283 INFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQI--DEGGIDEE-----------------LRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTM-EFPKKRYIQTCCDVSF----DEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMET 996
            +  N ++ +   +GH   V  +       + C+ S DK IK+WS +  D+  + EE                  R      + H+  +S + + S++  I + S D+TI+LWD     QKA    ++ +V  + YSP    I +   D+ IRI+DP S   ++ +     +      V +    D++ +  A +        + LWD R  K  LY++  H+  + C  +  N+           + S G+DN L+ +N  +T
Sbjct:  174 VRRNKAKPRHCCRGHAGSVEAVAVNNTYTKFCSGSWDKMIKIWSAVPNDQEDVVEEGSSARPKKKQKMEKLGLTRTPIMTISGHNEAVSSV-LWSEDLEICSASWDHTIRLWDAETGEQKASLGGNK-VVNSISYSPLCKRIASGSTDRHIRIWDPRSKGGSLVQLSLTSHTGWVTSVKWSPHNDKQLISGAIDKM------VKLWDTRSPKAPLYDMAAHEEKILCVEWAENN----------MLLSGGADNKLVTFNYSDT 418          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: tbl3 (transducin (beta)-like 3 [Source:ZFIN;Acc:ZDB-GENE-041114-104])

HSP 1 Score: 62.3882 bits (150), Expect = 1.080e-10
Identity = 58/269 (21.56%), Postives = 109/269 (40.52%), Query Frame = 1
Query:  223 LSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISS-DETTILTGSRDNTIKLWDLPK---------------FTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILW 981
            L K +S+V     N+  I +   ++S  +    GH   V  +    +   L + S+D+++++WS  +  G    +RC   ++  H   +  +  S   +  +++GS+D T+KLWDLPK               FT+KA  K     V  V  SP +  + +  +D  +R++  ++     E                 +  ++   G     C + LW +     L    GH A+V   +F++            ++ + GSD  + LW
Sbjct:  245 LGKTDSHVA-VATNSAQIKIFQLDSSHCQL-LHGHRDMVLALDVSRRGTMLASSSKDRTVRVWSMEEASG---HVRC-VAVATGHAHAVGAVAWSRLKDGFLVSGSQDCTLKLWDLPKGLSPSGTATTALTCRFTEKAHDKD----VNSVAVSPNDRLVASGSQDHTVRLWAVAAKKKKEEEGGGL------------RGPVAVLRGHRRGVCSVRLWGLHDFACLKTFEGHDASVLKVVFVAR---------GTQLLTSGSDGLVKLW 482          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 58.9214 bits (141), Expect = 7.729e-10
Identity = 54/275 (19.64%), Postives = 105/275 (38.18%), Query Frame = 1
Query:  262 NNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEK--YVISASNGFNGNGCE-------------LTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN--TMETQNSPILSNHYVPS 1035
             + +I V ++     + + KGH   V  + +      L + S D ++KLW         +   C  T+ + HD  +S +    +   +++ SRD T+K+W++            R  V  V+ +   S I +   D+ +R++  ++     E  +  ++  C   + D     ++ A+      G +             + +WD+     +  L+GH   V   +F     F         I SC  D +L +W+      Q S     H+V S
Sbjct:   67 EDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDF-------QSFECLRTM-HGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKF---------ILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTS 324          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: DIP2 (Nucleolar protein; specifically associated with the U3 snoRNA, part of the large ribonucleoprotein complex known as the small subunit (SSU) processome, required for 18S rRNA biogenesis, part of the active pre-rRNA processing complex [Source:SGD;Acc:S000004119])

HSP 1 Score: 63.929 bits (154), Expect = 2.072e-11
Identity = 45/191 (23.56%), Postives = 79/191 (41.36%), Query Frame = 1
Query:  460 TLSNAHDLIISGLDISSDETTILTGSRDNTIKLWD---------------LPKFTQKADCKIS-RNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            T+ +AHD  I  LD++SD   ++TGS D T+K WD               LP      D  +   + + CV+ SP + ++  +  D  +++F   S+   +     +      D+SFD K +I++S   N     + +W +        L  HQ ++    F+           +   FSC  D  +  W+
Sbjct:  467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN-----IKIWGLDFGDCHKSLFAHQDSIMNVKFLPQ---------SHNFFSCSKDAVVKYWD 643          

HSP 2 Score: 46.9802 bits (110), Expect = 5.232e-6
Identity = 39/164 (23.78%), Postives = 79/164 (48.17%), Query Frame = 1
Query:  205 TEPITCL---SKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIF 687
             +P  C    + K++++   G+ +G I V +  +  +  +  GH+  +T +++     +L + S+D +I +W  + E G+  +LR       +H   I+G      E  +++ S+D  IKLWDL K  Q  +  I+     C   +  +  ++ TG D  ++I+
Sbjct:   77 AKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL-YKLR-------SHKDSITGF-WCQGEDWLISTSKDGMIKLWDL-KTHQCIETHIAHT-GECWGLAVKDDLLITTGTDSQVKIW 229          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: HAT2 (Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing [Source:SGD;Acc:S000000782])

HSP 1 Score: 55.8398 bits (133), Expect = 4.987e-9
Identity = 59/238 (24.79%), Postives = 112/238 (47.06%), Query Frame = 1
Query:  298 SRIKFSTK-GHEKEVTRMKYLTKSCQL-CTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDL-----PKFTQKADCKISRNLVTCVKYSPTNSFIVAT-GEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVR-MKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            S I+ + K  HE+E+TR +Y+ +   +  T++   ++ L+S+ +  G+   L+  F   N + L  S L     +  +L+GS D+T+ LW++     P    +    +  +++   K+   N  +  T  ED +++I D  + N T++  K          S     +++A+    G    + L+D+R MK+ L+ + GH+  VN   F        S      + S GSDN L++W+
Sbjct:  107 SNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSE--GLQSTLK--FHKDNGYALSFSTLV----KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAA----GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF--------STHVDGVVVSSGSDNRLMMWD 324          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 54.6842 bits (130), Expect = 9.630e-9
Identity = 49/224 (21.88%), Postives = 86/224 (38.39%), Query Frame = 1
Query:  313 STKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKIS----RNLVTCVKYSPTNSF------IVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSC 954
            S KGH   V             + S DK+++LW        D      +     H   +  +DI    + I++GSRD TIK+W     T K  C  +     + V+ V+  P          I++ G DK+++ ++ +   +  +F            S D   + SA     G   E+ LW++  KK +Y L       +     +  W + + +   ++FS 
Sbjct:   60 SFKGHSHIVQDCTLTADGAYALSASWDKTLRLW--------DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVW-----TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASA-----GKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSL 265          

HSP 2 Score: 49.2914 bits (116), Expect = 5.206e-7
Identity = 52/235 (22.13%), Postives = 92/235 (39.15%), Query Frame = 1
Query:  304 IKFSTKGHEKEVTRMKYLTKSCQ---LCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDV-----SFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            ++ + +GH   VT +   T + Q   L + SRDK++  W      G D++          H  I+    +++D    L+ S D T++LWD+            ++ V  V      S I++   DK I+++      +        ++     V       D   +ISA     GN   +  W++   +I  + IGH + +N           T+      I S G D  ++LWN
Sbjct:    9 LRGTLEGHNGWVTSLA--TSAGQPNLLLSASRDKTLISWKLT---GDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISA-----GNDKMVKAWNLNQFQIEADFIGHNSNINTL---------TASPDGTLIASAGKDGEIMLWN 224          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 53.9138 bits (128), Expect = 3.273e-8
Identity = 73/318 (22.96%), Postives = 121/318 (38.05%), Query Frame = 1
Query:  205 TEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETT--ILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNS---PILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSL 1143
            T  ITCL  +++ V   G ++  I V +  N +      GH+  V  +KY      L + S D+++++W  I +G       C   +   H+  +  LDI   +    I+TGSRDNT+ +W LPK +   D     +          N + V      ++R                 ++ +   VS     V+S S         L +WDV   K LY L GH   +   ++         D    R  S   D ++ +W+     N+      +N   P + I+ ++  L+     VG        L    A GS+
Sbjct:  382 TSVITCLQFEDNYV-ITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGI-LVSGSTDRTVRVW-DIKKG-------CCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVG-----VLR----------------GHMASVRTVSGHGNIVVSGS-----YDNTLIVWDVAQMKCLYILSGHTDRIYSTIY---------DHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSI 654          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 52.7582 bits (125), Expect = 6.039e-8
Identity = 39/173 (22.54%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  511 DETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTC--VKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNH 1023
            D    +TGS D T+K+WDL   T K    ++ +++T   V  S  + ++ +  EDK ++ +D     +  ++    ++     VS      + A+ G +     + LWD+R +  +  L+GH+  +N       D         P++ S  +D ++ LW+ +  +   +L++H
Sbjct:  151 DNEWFITGSNDTTMKVWDLA--TGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDY--YGHLSGVRTVSIHPTLDLIATAGRD---SVIKLWDMRTRIPVITLVGHKGPINQVQCTPVD---------PQVVSSSTDATVRLWDVVAGKTMKVLTHH 307          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO29225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T489])

HSP 1 Score: 161.77 bits (408), Expect = 5.977e-45
Identity = 82/229 (35.81%), Postives = 129/229 (56.33%), Query Frame = 1
Query:  379 TVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELT---------------------------LWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            + SRDK+I++W       I +           H L+++ +D++  +T + +GSRDNT+KLWD+   T   + +ISRNLV+CVK+ P  S +  TGEDK +R++D  +++V + +P+K YIQTCCD S D  YV++++NGFN NGCE T                           LWD+R +K L++ +GH  T + CMF+  D   +S    P + +   D+S+ +WN
Sbjct:   29 SASRDKTIRVWR------IGDASHEAVAAYEGHSLVVTSIDLNMAQTLLFSGSRDNTVKLWDVATGTCVLENEISRNLVSCVKWVPDTSLVAQTGEDKTLRVWDTRNMDVAITYPRKNYIQTCCDCSSDGLYVLTSNNGFNRNGCEATTCCDCSPDGLYVLTSNNGFNRNGCEAILWDLRQQKELHQYVGHTQTTSACMFLPYDSMVSSK---PLVVTASHDSSVRIWN 248          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 85.5001 bits (210), Expect = 4.078e-18
Identity = 65/291 (22.34%), Postives = 124/291 (42.61%), Query Frame = 1
Query:  253 CGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYN 1125
             G  + S+ + +F      +   GH+  +  +K+      + + SRDK+++LW           ++ + T+  AH   +  +D S D  ++LT S D ++K+W + +           N V C K+SP    IV+  +DK I+++D +S +    F           V F       A+ G +     + +WD+RM K+L     H   VN   F  +  +         + S  SD +L + + ME +    L  H  P++ ++ S      +  A G+ +  +++ + N
Sbjct:   35 TGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWV--------PSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGF--VNSVEFHPSGTCIAAGGTDST---VKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNY---------LVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFS---RNGEYFASGSSDEQVMVWKTN 300          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO46331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB4])

HSP 1 Score: 68.9366 bits (167), Expect = 7.203e-13
Identity = 59/206 (28.64%), Postives = 88/206 (42.72%), Query Frame = 1
Query:  385 SRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFD-EKYVISASNGFNG----NGCE---LTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLIL 978
            S D +IKLW     G       C  T  N   +       +SD+  I +G  DN IK+WDL K           + VT V+ SP  SF+++   D  +R++D  +       P +R ++       + EK +I  S   +G     G     + +WD   ++ILY+L GH  +VN   F   +         P + SCGSD  L L
Sbjct:  163 SDDSTIKLWDTRKRG-------CAQTFQNVFQVTAVAFSDASDQ--IFSGGIDNEIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFA-----PMERCLKVFLGAQHNFEKNLIKCSWSPDGLMIAAGSADRFVYVWDTNSRRILYKLPGHAGSVNDAHFHPTE---------PILLSCGSDKKLFL 345          

HSP 2 Score: 63.929 bits (154), Expect = 2.962e-11
Identity = 53/223 (23.77%), Postives = 92/223 (41.26%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCD-FTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLV-TCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            GHE E+   ++      L +V  D+ I LW+   E        C+ F +   H   I  +  S+D  T+ T S D T+ LWD     +    K   + V +C        ++V+  +D  I+++D         F   + +     V+F +      S G +    E+ +WD+R   +LY++ GH  TV       +  F  S+S          DN++ +W+
Sbjct:   56 GHEGEIYSSRFHPSGETLASVGFDRLIYLWNVYGE--------CENFAVLKGHTGAIMDVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTF---QNVFQVTAVAFSDASDQIFSGGIDN---EIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSM---------DNTVRMWD 255          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 67.781 bits (164), Expect = 1.005e-12
Identity = 51/213 (23.94%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  256 GFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLS-NAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCC 891
            G  + ++ + + +   +  + KGH+  V+ +     S ++ + S DK++K+W        D E  C F  S + HD  + G+ I+SD   +++ S+D T+++W+L  F   +  +     V CV  SP + F ++  ED +++I+D  S                  V+ D   VIS+     G+  ++ +W +   + L  L GH  +V   
Sbjct:   73 GAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIW--------DVE-TCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISS-----GDDTQVKVWSLESGEELASLHGHSESVRIV 271          

HSP 2 Score: 48.9062 bits (115), Expect = 1.924e-6
Identity = 43/203 (21.18%), Postives = 86/203 (42.36%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDS 930
            G  + +  +     + ++ T   D SI++W        D E   +      H  ++  L +S     +++G+ D+T+K+WD+   +     K  +N V+ V  +P +  I+++  DK ++I+D  +                  ++ D + ++SAS         L +W++     +  L GH  TV C     +D F+ S S
Sbjct:   11 GRSRTILGIAVTPDTKKIITGGADGSIRVW--------DYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRT-----LRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGS 200          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 66.2402 bits (160), Expect = 5.528e-12
Identity = 59/231 (25.54%), Postives = 99/231 (42.86%), Query Frame = 1
Query:  295 NSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQ-ATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWN 984
            N ++K++  GH K V+ +K+      L + S DK IK+W   D G  ++ +         H L IS +  S+D   +++ S D T+K+WD          K   N V C  ++P ++ IV+   D+ +RI+D  +       P      T    + D   ++S+S  ++G      +WD    + L  LI      V+   F  N            I +   DN+L LW+
Sbjct:   54 NYQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYD-GKFEKTI-------TGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSS--YDG---LCRIWDTASGQCLKTLIDDDNPPVSFVKFSPN---------GKYILAATLDNTLKLWD 262          

HSP 2 Score: 52.7582 bits (125), Expect = 1.153e-7
Identity = 52/250 (20.80%), Postives = 101/250 (40.40%), Query Frame = 1
Query:  274 ISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLW---------------------------SQIDEGGIDEELR--------CDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADC-----KISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFD---EKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCM 894
            I +    + + + +  GH+  ++ + + T S  L + S DK++K+W                           + I  G  DE +R        C  TL  AH   ++ +  + D   I++ S D   ++WD    T    C           V+ VK+SP   +I+A   D  ++++D S       +   +  + C   +F     K+++S S        ++ +W+++ K+++ +L GH   V CC 
Sbjct:   89 IKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLP-AHSDPVTAVHFNRDGALIVSSSYDGLCRIWD----TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDH-----KVYIWNLQSKEVVQKLDGHSDVVLCCA 328          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: si:ch73-266o15.4 (WD repeat domain 31 [Source:NCBI gene;Acc:101168470])

HSP 1 Score: 166.392 bits (420), Expect = 1.167e-47
Identity = 103/309 (33.33%), Postives = 170/309 (55.02%), Query Frame = 1
Query:  184 FNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI-LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGI 1107
              Y P     +  ++  + ++   G  + ++ V ++   R   S +GH +EVT++     S  + + SRDK++ +W  +++G  DE ++ +F     H+L+++G+ +S   T + TGSRDN + LWD+     +    ISRNLVT V + P +S +V T EDK IR++D  S  VT  FP K+YIQT CDVS +  Y+IS+SNGF G GCE TLWD+R     + E  GH  T  CC+F+      T+     R+ +   D+S+ +W+    QN+  L    +  +G + S+ P +   +   ++N+G+
Sbjct:   18 LQYEPAHHGSVNTVTNLSPDLCVSGGTDQAVVVYDWRQGRTCQSFQGHNREVTKVLCYPGSTWIFSASRDKTVLMWD-LNQG--DEPIQ-EFC---GHELVVNGIAVSPG-TKLCTGSRDNWMCLWDIETAKCEQRHNISRNLVTHVCWVPASSSVVQTSEDKTIRVWDSRSWQVTNTFPAKQYIQTHCDVSPNGNYLISSSNGFGGQGCEATLWDLRQPGCKVVEYRGHLQTTACCVFLPVCCGGTA-----RVATSSHDSSVKIWD----QNTACLGTLSLDGAGPLVSLAPSDLSNILCASFNSGL 309          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 78.5666 bits (192), Expect = 2.244e-15
Identity = 53/199 (26.63%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPK------FTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            +GH+  VT +++      + + SRDK+++LW           ++ D T   AH   +  ++ S D  T++T S D TIK+W + +      F Q        N V C K+SP +  IV+  +DK I+++D +S      F +        D       + +AS         + LWD+R  K+L     H   VN   F
Sbjct:   57 EGHKDAVTSVQFSPSGHMVASASRDKTVRLWV--------PSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHV------NWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAAS-----TDSSVKLWDIRTNKMLQHYQVHSGAVNSLSF 236          

HSP 2 Score: 50.447 bits (119), Expect = 2.037e-6
Identity = 50/243 (20.58%), Postives = 85/243 (34.98%), Query Frame = 1
Query:  262 NNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFI-SNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            N+ +I V   +  +  FS   H   V   K+      + + S DK+IKLW +     I             H    + +D     T I   S D+++KLWD+         ++    V  + + P  +F++ T  D  ++I                                                D+   K+LY L GHQ++V C  F  + D+FS          S G+D  +++W +
Sbjct:  122 NDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFE--------HAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKIL-----------------------------------------------DLLEGKLLYTLHGHQSSVTCVAFSRTGDYFS----------SGGADEQVMVWKS 299          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 78.1814 bits (191), Expect = 3.358e-15
Identity = 53/199 (26.63%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPK------FTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            +GH+  VT +++      + + SRDK+++LW           ++ D T   AH   +  ++ S D  T++T S D TIK+W + +      F Q        N V C K+SP +  IV+  +DK I+++D +S      F +        D       + +AS         + LWD+R  K+L     H   VN   F
Sbjct:   57 EGHKDAVTSVQFSPSGHMVASASRDKTVRLWV--------PSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHV------NWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAAS-----TDSSVKLWDIRTNKMLQHYQVHSGAVNSLSF 236          

HSP 2 Score: 50.0618 bits (118), Expect = 3.248e-6
Identity = 50/243 (20.58%), Postives = 85/243 (34.98%), Query Frame = 1
Query:  262 NNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFI-SNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            N+ +I V   +  +  FS   H   V   K+      + + S DK+IKLW +     I             H    + +D     T I   S D+++KLWD+         ++    V  + + P  +F++ T  D  ++I                                                D+   K+LY L GHQ++V C  F  + D+FS          S G+D  +++W +
Sbjct:  122 NDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFE--------HAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKIL-----------------------------------------------DLLEGKLLYTLHGHQSSVTCVAFSRTGDYFS----------SGGADEQVMVWKS 299          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 77.411 bits (189), Expect = 4.738e-15
Identity = 53/199 (26.63%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPK------FTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            +GH+  VT +++      + + SRDK+++LW           ++ D T   AH   +  ++ S D  T++T S D TIK+W + +      F Q        N V C K+SP +  IV+  +DK I+++D +S      F +        D       + +AS         + LWD+R  K+L     H   VN   F
Sbjct:   57 EGHKDAVTSVQFSPSGHMVASASRDKTVRLWV--------PSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHV------NWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAAS-----TDSSVKLWDIRTNKMLQHYQVHSGAVNSLSF 236          

HSP 2 Score: 50.0618 bits (118), Expect = 2.857e-6
Identity = 50/243 (20.58%), Postives = 85/243 (34.98%), Query Frame = 1
Query:  262 NNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF-ISNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            N+ +I V   +  +  FS   H   V   K+      + + S DK+IKLW +     I             H    + +D     T I   S D+++KLWD+         ++    V  + + P  +F++ T  D  ++I                                                D+   K+LY L GHQ++V C  F  + D+FS          S G+D  +++W +
Sbjct:  122 NDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFE--------HAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKIL-----------------------------------------------DLLEGKLLYTLHGHQSSVTCVAFSRTGDYFS----------SGGADEQVMVWKS 299          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 75.0998 bits (183), Expect = 1.887e-14
Identity = 51/193 (26.42%), Postives = 86/193 (44.56%), Query Frame = 1
Query:  319 KGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF 897
            +GH+  VT +++      + + SRDK+++LW           ++ D T   AH   +  ++ S D  T++T S D TIK+W + +           N V C K+SP +  IV+  +DK I+++D +S  +      +R      D       + +AS         + LWD+R  K+L     H   VN   F
Sbjct:   53 EGHKDAVTSVQFSPSGHMVASASRDKTVRLWV--------PSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRELF-----RRLYANHVDFHPSGTCIAAAS-----TDSSVKLWDIRTNKMLQHYQVHSGAVNSLSF 227          

HSP 2 Score: 50.8322 bits (120), Expect = 1.616e-6
Identity = 52/243 (21.40%), Postives = 87/243 (35.80%), Query Frame = 1
Query:  262 NNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMF-ISNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            N+ +I V   +  +  FS   H   V   K+      + + S DK+IKLW        D+  R  F       L  + +D     T I   S D+++KLWD+         ++    V  + + P  +F++ T  D  ++I                                                D+   K+LY L GHQ++V C  F  + D+FS          S G+D  +++W +
Sbjct:  118 NDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLW--------DKNSRELF-----RRLYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKIL-----------------------------------------------DLLEGKLLYTLHGHQSSVTCVAFSRTGDYFS----------SGGADEQVMVWKS 290          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000035645.1 (SMESG000035645.1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 353/354 (99.72%), Postives = 354/354 (100.00%), Query Frame = 1
Query:  100 MGGKVSKKKNYMTKKIELNSITEPEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYHVASI 1161
            MGGKVSKKKNYMTKKIELNSITEPEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKK+LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYHVASI
Sbjct:    1 MGGKVSKKKNYMTKKIELNSITEPEVNNFNYPPITTEPITCLSKKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKMLYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQNSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYHVASI 354          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.022e-19
Identity = 70/279 (25.09%), Postives = 120/279 (43.01%), Query Frame = 1
Query:  214 ITCLS-KKNSNVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNG---------CELTLWDVRMKKILYELIGHQATVNCCMFISNDWF--STSDSCAPRIFSCGSDNSLILWNTMETQNSPIL 1014
            +TC+    NS+    G  +  + + NF      +   GHE  +  +K+      + + SRDK+++LW           ++ +  +  AH   +  +DIS D   ++TGS D TIK+W + +          +N V CV++S     I ++ +DK I+++D             R+ Q C   +F E      S  F+ NG           + +WD+RM K+L     H + VN   F  +  F  S+SD  + +I+       L    T++    PIL
Sbjct:   17 VTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWV--------PSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-------------RHNQECIH-TFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLY---TVQGHEGPIL 270          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 56.9954 bits (136), Expect = 9.370e-9
Identity = 60/225 (26.67%), Postives = 90/225 (40.00%), Query Frame = 1
Query:  322 GHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCV-KYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCE--LTLWDVRMKKILYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNT 987
            GH+ EV   K+  +   L +   D+ I LW+    G I      D  + + H+  I  L  SSD   I T S D T+ +WD     +    K   ++V  V   S T     +  +D  IR++D    N T     K  +       F + Y+ S        G E  +  WDVR  KI+    GH  ++     +SND           + S   DN+L +W+T
Sbjct:   58 GHKGEVFCGKFAPEGSFLASAGHDREIILWNTY--GDIK-----DLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDAKHSVLDVAYSPFGD-YIFSG-------GIENVINQWDVREMKIIQTFAGHTDSITSVA-VSND--------GNFLLSNSVDNTLRVWDT 258          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000054739.1 (SMESG000054739.1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.347e-8
Identity = 54/244 (22.13%), Postives = 95/244 (38.93%), Query Frame = 1
Query:  241 NVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCC------------DVSFDEKYVISAS------NGFNGNGCEL----------TLWDVRMKKILYELIGHQATVNC 888
            NV   G  + +I + ++ +   + + +GH   V  + +      L + S D  IKLW  +       E  C  TLS  HD  +SG+        +L+ SRD TIKLW++         +   + V  VK +   S I +   D  +R++  ++     +F +  ++  C                 D+K + S        +G+  +GC L           LWD      L+ L+     ++C
Sbjct:   88 NVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFV-------EFTCVKTLS-GHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDFREHEHVVQCIVWGGQKIHMETNQALLDDKQMTSNGDSSNKLDGYKMSGCHLLASGSRDRTIRLWDTNTGVCLFNLVWSCDFIDC 323          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000035997.1 (SMESG000035997.1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.948e-8
Identity = 54/244 (22.13%), Postives = 95/244 (38.93%), Query Frame = 1
Query:  241 NVGYCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKSIKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNTIKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSSLNVTMEFPKKRYIQTCC------------DVSFDEKYVISAS------NGFNGNGCEL----------TLWDVRMKKILYELIGHQATVNC 888
            NV   G  + +I + ++ +   + + +GH   V  + +      L + S D  IKLW  +       E  C  TLS  HD  +SG+        +L+ SRD TIKLW++         +   + V  VK +   S I +   D  +R++  ++     +F +  ++  C                 D+K + S        +G+  +GC L           LWD      L+ L+     ++C
Sbjct:  122 NVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFV-------EFTCVKTLS-GHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDFREHEHVVQCIVWGGQKIHMETNQALLDDKQMTSNGDSSNKLDGYKMSGCHLLASGSRDRTIRLWDTNTGVCLFNLVWSCDFIDC 357          
The following BLAST results are available for this feature:
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR313.851e-4930.36WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR315.427e-4930.25WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR315.427e-4930.25WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR316.399e-1730.83WD repeat domain 31 [Source:HGNC Symbol;Acc:HGNC:2... [more]
POC1B2.945e-1624.11POC1 centriolar protein B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T05A8.51.821e-2631.28pep chromosome:WBcel235:II:2731319:2735250:-1 gene... [more]
snrp-40.11.682e-1123.97Small Nuclear RibonucleoProtein homolog [Source:U... [more]
wdr-5.14.373e-1023.68WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.14.373e-1023.68WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
pfs-21.096e-919.50Polyadenylation Factor Subunit homolog [Source:Un... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wds4.066e-1326.84gene:FBgn0040066 transcript:FBtr0308566[more]
wds4.066e-1326.84gene:FBgn0040066 transcript:FBtr0070438[more]
CG67242.563e-1028.38gene:FBgn0032298 transcript:FBtr0333491[more]
CG67244.131e-1027.66gene:FBgn0032298 transcript:FBtr0080191[more]
Gbeta76C1.734e-926.99gene:FBgn0004623 transcript:FBtr0074949[more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR313.076e-5232.20si:ch73-266o15.4 [Source:NCBI gene;Acc:568862][more]
si:ch73-266o15.45.081e-5233.13si:ch73-266o15.4 [Source:NCBI gene;Acc:568862][more]
si:ch73-266o15.43.115e-5132.93si:ch73-266o15.4 [Source:NCBI gene;Acc:568862][more]
poc1b3.577e-1521.40POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
poc1b4.206e-1521.40POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ngfr7.329e-1423.70nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.134e-1323.70nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.202e-1323.70nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.231e-1323.70nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.386e-1323.70nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr311.534e-5029.92WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr312.644e-4930.89WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr312.644e-4930.89WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr315.686e-2247.47WD repeat domain 31 [Source:MGI Symbol;Acc:MGI:191... [more]
Poc1b1.714e-1728.87POC1 centriolar protein B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JHB4|WDR31_MOUSE1.850e-4830.89WD repeat-containing protein 31 OS=Mus musculus OX... [more]
sp|Q8NA23|WDR31_HUMAN1.850e-4830.36WD repeat-containing protein 31 OS=Homo sapiens OX... [more]
sp|D3ZW91|POC1B_RAT3.727e-1729.38POC1 centriolar protein homolog B OS=Rattus norveg... [more]
sp|Q5RD06|POC1B_PONAB1.859e-1624.47POC1 centriolar protein homolog B OS=Pongo abelii ... [more]
sp|Q8TC44|POC1B_HUMAN1.791e-1524.11POC1 centriolar protein homolog B OS=Homo sapiens ... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QBM02.792e-5636.34WD repeat-containing protein 31 OS=Mizuhopecten ye... [more]
A0A3S0ZNK72.995e-5634.95WD_REPEATS_REGION domain-containing protein OS=Ely... [more]
R7UKK12.388e-5533.44WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
V4B3D62.589e-5534.74WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A2B4SGD21.300e-5130.73WD repeat-containing protein 31 OS=Stylophora pist... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-266o15.48.058e-5232.46WD repeat domain 31 [Source:NCBI gene;Acc:10304457... [more]
POC1B2.327e-2023.45POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B6.188e-2023.45POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B7.537e-2023.03POC1 centriolar protein homolog B [Source:NCBI gen... [more]
poc1a3.912e-1524.39POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A5.307e-1521.43POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
snrnp401.254e-1226.81small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
wdr121.056e-1123.57WD repeat domain 12 [Source:NCBI gene;Acc:321652][more]
tbl31.080e-1021.56transducin (beta)-like 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
pafah1b1b7.729e-1019.64platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DIP22.072e-1123.56Nucleolar protein; specifically associated with th... [more]
HAT24.987e-924.79Subunit of the Hat1p-Hat2p histone acetyltransfera... [more]
ASC19.630e-921.88G-protein beta subunit and guanine dissociation in... [more]
CDC43.273e-822.96F-box protein required for both the G1/S and G2/M ... [more]
PRP466.039e-822.54Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO292255.977e-4535.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453464.078e-1822.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463317.203e-1328.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497671.005e-1223.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332975.528e-1225.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-266o15.41.167e-4733.33WD repeat domain 31 [Source:NCBI gene;Acc:10116847... [more]
POC1A2.244e-1526.63POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A3.358e-1526.63POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A4.738e-1526.63POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A1.887e-1426.42POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035645.10.000e+099.72SMESG000035645.1[more]
SMESG000024482.12.022e-1925.09SMESG000024482.1[more]
SMESG000045329.19.370e-926.67SMESG000045329.1[more]
SMESG000054739.12.347e-822.13SMESG000054739.1[more]
SMESG000035997.13.948e-822.13SMESG000035997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030268 ID=SMED30030268|Name=Ribosome biogenesis protein WDR12 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1284bp
GGCAGCATTATAAAAGCAGTTAATTTAAGATTATAAAATCAAATAAAATA
ACAAAACTAAAGAAATAATAAAGTGTCATATTTGCCAACAGATTATTGTA
TGGGAGGAAAAGTATCTAAAAAGAAAAATTACATGACAAAGAAAATCGAA
CTAAACAGTATTACTGAGCCAGAAGTTAACAATTTTAATTATCCTCCCAT
AACTACAGAACCAATAACATGCTTATCGAAGAAAAACAGTAATGTTGGTT
ATTGTGGCTTTAATAATGGCTCTATTTCTGTAATAAATTTTAATAATTCA
AGAATTAAATTTAGTACCAAAGGCCACGAAAAAGAAGTAACTCGAATGAA
ATATTTAACAAAATCTTGCCAATTATGTACTGTATCAAGAGATAAATCAA
TCAAATTGTGGTCTCAAATAGATGAAGGTGGAATCGACGAAGAACTTCGC
TGTGATTTCACACTTTCCAATGCGCATGACTTAATTATCAGTGGATTAGA
CATATCAAGCGACGAAACTACAATTTTAACTGGATCAAGAGACAATACAA
TAAAATTGTGGGATCTACCGAAATTTACCCAAAAGGCAGACTGTAAAATA
TCCAGAAATCTTGTTACTTGTGTTAAATATTCCCCAACGAATTCATTTAT
CGTTGCAACGGGTGAGGATAAAATTATCAGAATTTTCGATCCCAGTTCAT
TAAACGTGACGATGGAGTTTCCTAAAAAGAGATACATTCAAACATGTTGT
GACGTTTCCTTTGATGAGAAATATGTCATTTCTGCTAGCAATGGATTCAA
TGGAAATGGTTGTGAATTAACTTTGTGGGATGTAAGGATGAAGAAGATCT
TGTATGAACTGATTGGTCATCAGGCAACTGTTAATTGCTGCATGTTTATC
AGTAACGATTGGTTTTCTACGTCAGATTCATGCGCTCCCAGAATCTTCAG
TTGCGGCAGTGACAATTCCCTTATTCTTTGGAATACTATGGAAACTCAAA
ATTCACCCATTCTCTCAAATCATTACGTTCCCAGTTCTGGAATCATGACA
TCAATATTACCATTAGAAAATCAGAAATTAGCGGTGGGAACTTACAACAC
AGGTATCGTAATTTTGGAGTACAATACTGCTAGAGGATCTCTGTACCACG
TAGCTTCTATTTGATAAAAACTTCACTTCAGAAATCACTTTGATTTTTCA
AGTGATAAAAATATATATAAATTATTTGAACTGATTTTTTTTCGTATTAA
TAACAACAATAAACTTATTATTATTAAAAAAAAA
back to top

protein sequence of SMED30030268-orf-1

>SMED30030268-orf-1 ID=SMED30030268-orf-1|Name=SMED30030268-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MGGKVSKKKNYMTKKIELNSITEPEVNNFNYPPITTEPITCLSKKNSNVG
YCGFNNGSISVINFNNSRIKFSTKGHEKEVTRMKYLTKSCQLCTVSRDKS
IKLWSQIDEGGIDEELRCDFTLSNAHDLIISGLDISSDETTILTGSRDNT
IKLWDLPKFTQKADCKISRNLVTCVKYSPTNSFIVATGEDKIIRIFDPSS
LNVTMEFPKKRYIQTCCDVSFDEKYVISASNGFNGNGCELTLWDVRMKKI
LYELIGHQATVNCCMFISNDWFSTSDSCAPRIFSCGSDNSLILWNTMETQ
NSPILSNHYVPSSGIMTSILPLENQKLAVGTYNTGIVILEYNTARGSLYH
VASI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000463maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
GO:0042273ribosomal large subunit biogenesis
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0030687preribosome, large subunit precursor
GO:0070545PeBoW complex
GO:0005575cellular_component
Vocabulary: molecular function
TermDefinition
GO:0043021ribonucleoprotein complex binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040066WDR31
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 142..156
score: 44.68
coord: 92..106
score: 32.49
coord: 282..296
score: 28.54
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 200..244
e-value: 62.0
score: 5.7
coord: 247..295
e-value: 1.0
score: 17.0
coord: 158..197
e-value: 0.0046
score: 26.2
coord: 115..155
e-value: 7.8E-7
score: 38.7
coord: 66..105
e-value: 4.1E-4
score: 29.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 72..105
e-value: 0.023
score: 15.6
coord: 172..197
e-value: 9.0E-4
score: 20.0
coord: 250..295
e-value: 0.032
score: 15.1
coord: 119..155
e-value: 4.9E-5
score: 24.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 73..105
score: 10.074
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 123..156
score: 13.215
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 22..162
e-value: 2.5E-19
score: 71.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 163..347
e-value: 1.2E-23
score: 86.1
IPR040066WD repeat-containing protein 31PANTHERPTHR19869SPERMATID WD-REPEAT PROTEINcoord: 1..349
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 142..156
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 282..296
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 73..304
score: 22.57
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 36..344