slc25a-4

Overview
Nameslc25a-4 (AKN21572.1)
Smed IDSMED30030267
Length (bp)1558
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-4 (SMED30030267) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-4 (SMED30030267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30030267SMESG000034286.1 gnl|ti|1389002586_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30030267SMESG000034286.1 Contig1107_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30030267SMESG000034286.1 Contig590_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-4 vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 346.665 bits (888), Expect = 5.328e-109
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  457 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 895          

HSP 2 Score: 318.546 bits (815), Expect = 2.329e-98
Identity = 183/440 (41.59%), Postives = 272/440 (61.82%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   17 MRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 447          
BLAST of slc25a-4 vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 347.051 bits (889), Expect = 5.459e-109
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  469 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 318.546 bits (815), Expect = 2.816e-98
Identity = 183/440 (41.59%), Postives = 272/440 (61.82%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   29 MRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 346.665 bits (888), Expect = 7.384e-109
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  473 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 911          

HSP 2 Score: 320.087 bits (819), Expect = 8.657e-99
Identity = 184/448 (41.07%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            E+ + +   R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   25 EIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 463          
BLAST of slc25a-4 vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 346.665 bits (888), Expect = 7.384e-109
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  473 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 911          

HSP 2 Score: 320.087 bits (819), Expect = 8.657e-99
Identity = 184/448 (41.07%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            E+ + +   R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   25 EIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 463          
BLAST of slc25a-4 vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 346.665 bits (888), Expect = 7.384e-109
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  473 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 911          

HSP 2 Score: 320.087 bits (819), Expect = 8.657e-99
Identity = 184/448 (41.07%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            E+ + +   R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   25 EIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 463          
BLAST of slc25a-4 vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 345.125 bits (884), Expect = 2.654e-113
Identity = 191/461 (41.43%), Postives = 292/461 (63.34%), Query Frame = 2
Query:   98 LGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPD-KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLT----VDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERD---PPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            + I+ +I V   + + E  +    S+   R + + +E  M  GL  + + K  VKM P+YV  VP+G E G F+ALDLGGTN+R+L + L+G     ++    + +PE  M G GEALFD IA  +  F+    + D + + LGFTFSFPC Q+GL  G L  WTKGF A+ VEG +VV LL  A  ++ ++ +   AL+NDTVGTL +C+F+   C IG+IVGTG+NACY+E L ++      VD+  +    + +IINTEWGAFG++G L+ +RT++D  +D+ S++PG+ ++EK+ISGMY+GE  R+VL +L ++ LLF GN  DA+  P+ F TK++S+ + D        +   Y +  ++ V  I + DC  + Y C +++ RAA+L  + IA+L+N+MN+  VT+GVDGS++R HP++   ++A I +      E++L LSEDGSG+GAA + A
Sbjct:   20 MSIQNSIDVSNNQMIQEACQRLVLSDQQLRRIMQSMEKSMEQGLATSTK-KVAVKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKLQGKET--KMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGV--TPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAA 474          
BLAST of slc25a-4 vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 340.887 bits (873), Expect = 1.191e-111
Identity = 188/447 (42.06%), Postives = 285/447 (63.76%), Query Frame = 2
Query:  140 VMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPD-KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLT----VDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERD---PPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            + E  +    S+   R + + +E  M  GL  + + K  VKM P+YV  VP+G E G F+ALDLGGTN+R+L + L+G     ++    + +PE  M G GEALFD IA  +  F+    + D + + LGFTFSFPC Q+GL  G L  WTKGF A+ VEG +VV LL  A  ++ ++ +   AL+NDTVGTL +C+F+   C IG+IVGTG+NACY+E L ++      VD+  +    + +IINTEWGAFG++G L+ +RT++D  +D+ S++PG+ ++EK+ISGMY+GE  R+VL +L ++ LLF GN  DA+  P+ F TK++S+ + D        +   Y +  ++ V  I + DC  + Y C +++ RAA+L  + IA+L+N+MN+  VT+GVDGS++R HP++   ++A I +      E++L LSEDGSG+GAA + A
Sbjct:   39 IQEACQRLVLSDQQLRRIMQSMEKSMEQGLATSTK-KVAVKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKLQGKET--KMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGV--TPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAA 479          
BLAST of slc25a-4 vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 340.887 bits (873), Expect = 1.191e-111
Identity = 188/447 (42.06%), Postives = 285/447 (63.76%), Query Frame = 2
Query:  140 VMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPD-KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLT----VDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERD---PPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            + E  +    S+   R + + +E  M  GL  + + K  VKM P+YV  VP+G E G F+ALDLGGTN+R+L + L+G     ++    + +PE  M G GEALFD IA  +  F+    + D + + LGFTFSFPC Q+GL  G L  WTKGF A+ VEG +VV LL  A  ++ ++ +   AL+NDTVGTL +C+F+   C IG+IVGTG+NACY+E L ++      VD+  +    + +IINTEWGAFG++G L+ +RT++D  +D+ S++PG+ ++EK+ISGMY+GE  R+VL +L ++ LLF GN  DA+  P+ F TK++S+ + D        +   Y +  ++ V  I + DC  + Y C +++ RAA+L  + IA+L+N+MN+  VT+GVDGS++R HP++   ++A I +      E++L LSEDGSG+GAA + A
Sbjct:   39 IQEACQRLVLSDQQLRRIMQSMEKSMEQGLATSTK-KVAVKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKLQGKET--KMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGV--TPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAA 479          
BLAST of slc25a-4 vs. Ensembl Celegans
Match: hxk-2 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q9XU15])

HSP 1 Score: 286.96 bits (733), Expect = 3.099e-90
Identity = 181/468 (38.68%), Postives = 287/468 (61.32%), Query Frame = 2
Query:   59 PGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEH-PDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMK-NAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            P  P   L+ M     +E+IS++       +M  F+ S +  R +   L  +M+ GL+    +++ + M PS+V ++P+GKE+G+F+A+DLGGTN R++L+ L+    P    +    +P   M G G+ LFD+IA+ + DFL  +++ D+ + +GFTFS+PC+Q GL    L RWTKG +AT   G++VV+LL  A+ +   +KV+  AL+NDTVGT+ + ++E    C IG+I+GTG+NA Y+ED  K++     A    N K +II+TEWG FG+NG  + I T+YD+ +D  S HPG    +KLI+GM +GE+VRLVL  L E K+LF G     +R   +F TKY+S+   D   + YS    + +EL +      D  ++R  C +V+RR+A LA +AIA ++N++ RP + + +DGS +++HP F   +   I++  +P  +F++  + DGSG+GAA I A
Sbjct:   26 PRTPTTPLAKMASKLNEESISLE------SVMAEFKLSNTTLRRMMSHLSDNMDRGLESG-LERSTIAMLPSFVPELPNGKERGKFVAMDLGGTNLRVMLMELEPGE-PMRTKQFNTRMPNAAMHGTGQKLFDYIAKALCDFLVERELADEHLPVGFTFSYPCDQTGLRSATLLRWTKGVTATGCVGEDVVQLLEDAIARDGRVKVNIVALINDTVGTMVAAAYEAGGHCDIGVIIGTGTNASYMEDSRKIVHGLANATEDYNHKSMIIDTEWGGFGDNGEADYIFTRYDKIVDSKSDHPGVNSLDKLIAGMCMGELVRLVLERLCENKVLFNGIGSKMLRTRNTFPTKYISEILHDDCGV-YSNTRQIMDELGIEGATFSDMLLLREVCVVVSRRSANLAAAAIACVLNRVRRPNMLVAIDGSTYKYHPFFNHWVCEKIRELLDPGLDFKIVQTGDGSGRGAALIAA 484          
BLAST of slc25a-4 vs. Ensembl Celegans
Match: hxk-3 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:U4PC09])

HSP 1 Score: 251.906 bits (642), Expect = 6.659e-78
Identity = 153/445 (34.38%), Postives = 256/445 (57.53%), Query Frame = 2
Query:  128 IPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALK-KLNLKVSCKALVNDTVGTLASCSFEH-PDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            +P EV E++  FR +    + +++++E  M MGL  A    + + M PSYV  +P G E G+++A+DL G N RI+L+T+ G    P      Y +    M G G+ LF FI   +  FL+   + D  + +GF FS+PC    +    L  WTKGF   +   +++V LL  AL+  ++ KVS KA++NDTVG LA+ + ++ P+C IG+++G G N+ Y+E  S++   D  A   +   +I+ TEW  FG++G L+DI T++DR +D  S+H GKQ+ +KL   +Y+GE+VR VL +L+  ++LF+G   + + +  SF TKY+S+   +   +  +   +   EL V    + D  IIR  C++++RR A +  +AI+ L+  +   +V IGV G+L + HP++   +   +++      +F L  +++GS +GAA I A 
Sbjct:    4 LPPEVEEILAKFRLNREQLQEISEKVEQQMKMGL--AKTQGSSIAMLPSYVPALPDGTETGKYVAIDLSGKNLRIMLLTMNGAGTTPTHETVNYIVANHVMKGTGDQLFTFIVNCLQRFLQEFGLVDANLPIGFVFSYPCELLSIRSARLLWWTKGFDIKDCLQRDIVALLEEALEMNMSTKVSIKAVMNDTVGQLAAAAHKYGPECTIGVVIGYGCNSSYLEKTSRITKFDAKARGYDHDNMIVVTEWEEFGKHGELDDILTQFDREVDAASVHKGKQLIDKLCGALYIGEVVRRVLSQLVLDRVLFEGQSCEKLDEDESFPTKYISEILGEEEGVFKACRRIC-EELEVEMHGTGDYIIIREVCDVISRRGASIVAAAISALLRHLELSSVKIGVGGALIQFHPTYHQMLKEKLEELTPITMKFELVPADEGSCQGAALIAAV 445          
BLAST of slc25a-4 vs. Ensembl Fly
Match: Hex-t2 (gene:FBgn0042710 transcript:FBtr0085011)

HSP 1 Score: 357.836 bits (917), Expect = 2.908e-118
Identity = 197/443 (44.47%), Postives = 287/443 (64.79%), Query Frame = 2
Query:  128 IPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            +  E+   +K F   +     V +R+  ++ MGL      +A +K F S+V  +P+GKE+G+++ALDLGG+N+R+LLV L  +N+  E +   Y  P+  MSG G+ALFDF+AE +++F  S  + +++++LGFTFSFP  Q+GL  GIL  WTKGFS   V GKNVV LL  A+ ++ +LK++  A++NDTVGTL SC+F HP+C IGLIVGTGSNACY+E        +          +IIN EWGAFG+NG LE +RT YD+A+DK + +PGKQ FEK ISGMY+GE+VRLV+ ++I K  +F G + + +++ +SF T Y+SD E D P  + +   +L +EL +      D + +RY CE V+ R+A L    +  +INKMN   V IG+DGS++R HP +   +   +K+   P  +F L +SEDGSG+GAA + A
Sbjct:   38 VNTEIEAAVKGFLIDQEKMTEVVERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLI-SNSDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQGLSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHPNCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPS-MIINCEWGAFGDNGVLEFVRTSYDKAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAYISDVESDAPGEYRNCNKVL-SELGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINKMNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAA 477          
BLAST of slc25a-4 vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0333335)

HSP 1 Score: 348.206 bits (892), Expect = 4.976e-115
Identity = 195/440 (44.32%), Postives = 282/440 (64.09%), Query Frame = 2
Query:  140 VMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            V E+ +    ++   + +  R+  ++  GL      KA VK F +YV  +P+G E+G+F+ALDLGGTN+R+LL+ L+ NN   ++    YAIP+  M G G  LFD IAE +++F+    +  + + LGFTFSFP  Q GL  G+L  WTKGF+   V  ++VV+LL  A+ ++ ++++   A++NDT GTL SC++++ +C IGLIVGTG+NACY+E + +       A     K ++INTEWGAFG+NG L+ +RT++DR +D +S++PGKQ FEK+ISGMY+GE+VRLVLV++ +  +LF G   + +     F TKY+S+ E D P    +   +L    L N  D  DC  +RY CE V++RAA+L  + IA LINKM+ PTVT+GVDGS++R HP F   M   I Q   P   F L LSEDGSG+GAA + A 
Sbjct:    2 VHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENN-DFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELF--AAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVLEELGLTNATDG-DCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAV 437          
BLAST of slc25a-4 vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0071362)

HSP 1 Score: 348.206 bits (892), Expect = 4.976e-115
Identity = 195/440 (44.32%), Postives = 282/440 (64.09%), Query Frame = 2
Query:  140 VMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            V E+ +    ++   + +  R+  ++  GL      KA VK F +YV  +P+G E+G+F+ALDLGGTN+R+LL+ L+ NN   ++    YAIP+  M G G  LFD IAE +++F+    +  + + LGFTFSFP  Q GL  G+L  WTKGF+   V  ++VV+LL  A+ ++ ++++   A++NDT GTL SC++++ +C IGLIVGTG+NACY+E + +       A     K ++INTEWGAFG+NG L+ +RT++DR +D +S++PGKQ FEK+ISGMY+GE+VRLVLV++ +  +LF G   + +     F TKY+S+ E D P    +   +L    L N  D  DC  +RY CE V++RAA+L  + IA LINKM+ PTVT+GVDGS++R HP F   M   I Q   P   F L LSEDGSG+GAA + A 
Sbjct:    2 VHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENN-DFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELF--AAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVLEELGLTNATDG-DCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAV 437          
BLAST of slc25a-4 vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0071361)

HSP 1 Score: 348.591 bits (893), Expect = 5.663e-114
Identity = 195/439 (44.42%), Postives = 282/439 (64.24%), Query Frame = 2
Query:  140 VMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            V E+ +    ++   + +  R+  ++  GL      KA VK F +YV  +P+G E+G+F+ALDLGGTN+R+LL+ L+ NN   ++    YAIP+  M G G  LFD IAE +++F+    +  + + LGFTFSFP  Q GL  G+L  WTKGF+   V  ++VV+LL  A+ ++ ++++   A++NDT GTL SC++++ +C IGLIVGTG+NACY+E + +       A     K ++INTEWGAFG+NG L+ +RT++DR +D +S++PGKQ FEK+ISGMY+GE+VRLVLV++ +  +LF G   + +     F TKY+S+ E D P    +   +L    L N  D  DC  +RY CE V++RAA+L  + IA LINKM+ PTVT+GVDGS++R HP F   M   I Q   P   F L LSEDGSG+GAA + A
Sbjct:   95 VHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENN-DFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELF--AAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVLEELGLTNATDG-DCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAA 529          
BLAST of slc25a-4 vs. Ensembl Fly
Match: Hex-C (gene:FBgn0001187 transcript:FBtr0087399)

HSP 1 Score: 338.576 bits (867), Expect = 2.757e-111
Identity = 180/449 (40.09%), Postives = 270/449 (60.13%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYX--XXXXXXXXXXXXXXXXXXXGNLPD----AMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            EV E+M+PF  S+   + V  R  L++  GL  +   +A VK FP+YV  +P+G E G+++ALDLGGTN+R+LLV+LKG++    +    YA+P+  M GPG  LFD IA  +  F++   +    + LGFTFSFPC Q GL  GIL RWTKGF    VEG++V  +L  A+++  +  ++  A++NDT GTL SC+  + DC +G+IVGTG NACY+ED+  V  + +    K  + +I+N EWGAFGE G L+ +RT+YDR +D+ SL+  +Q+FEK+ +GMYL     + L+     +         P+      R    F T+Y+S+ E D      ST  +++N   +      DC+ +RY CE VA+RAA L    ++ L+N+ +   V +G+DGS++R+HP F A M   +++      E+ + LSEDGSG+GAA + A  S
Sbjct:    5 EVRELMQPFVLSDYQVQEVYSRFCLEVARGLKRSTHPQANVKCFPTYVQDLPTGDEMGKYLALDLGGTNFRVLLVSLKGHH-DATVDSQIYAVPKDLMVGPGVDLFDHIAGCLAKFVEKHDMKTAYLPLGFTFSFPCVQLGLKEGILVRWTKGFDCAGVEGEDVGRMLHEAIQRRGDADIAVVAILNDTTGTLMSCAHRNADCRVGVIVGTGCNACYVEDVENVDLL-RADFKKTKRSVIVNAEWGAFGEGGQLDFVRTEYDREVDEKSLNRSEQLFEKMTAGMYLGNLVRLVLLRALERKLIFKQSSRRPEFASVLQRNEEVFETRYISEIEDDSFPEFASTRKIVKNLFGLEKASVEDCQTLRYICECVAKRAATLVAIGVSGLVNRTSNRRVIVGMDGSVYRYHPKFDAYMRQTLQKLVKADKEWDIMLSEDGSGRGAALVAAVAS 451          
BLAST of slc25a-4 vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 342.428 bits (877), Expect = 3.433e-108
Identity = 195/447 (43.62%), Postives = 278/447 (62.19%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++ E ++ FR ++     V KR+  ++  GL  + ++ A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD G+L  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TV           + +N EWGAFG+NG L+DIRTKYD A+D  SL+ GKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K      ++   +T+GVDG+L++ HP F+  M+  +K+   PKC     LSEDGSGKGAA I A
Sbjct:  395 QIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVS-----GEEGRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELA-PKCNVTFLLSEDGSGKGAALITA 832          

HSP 2 Score: 291.197 bits (744), Expect = 1.028e-88
Identity = 166/392 (42.35%), Postives = 250/392 (63.78%), Query Frame = 2
Query:  302 EKGQFMALDLGGTNYRILLVTLKGNNAPPEIIEST-YAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            EKG F+ALDLGG+N+RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC+Q  LD  +L  WTK F    VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++GTLEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +       TK++S  E+    L  + E + R  L V   +  DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P+ + R  LSE GSGKGAA + A
Sbjct:    2 EKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVE-----GDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PESDVRFLLSESGSGKGAALVTA 384          
BLAST of slc25a-4 vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 342.043 bits (876), Expect = 2.234e-107
Identity = 195/447 (43.62%), Postives = 278/447 (62.19%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++ E ++ FR ++     V KR+  ++  GL  + ++ A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD G+L  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TV           + +N EWGAFG+NG L+DIRTKYD A+D  SL+ GKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K      ++   +T+GVDG+L++ HP F+  M+  +K+   PKC     LSEDGSGKGAA I A
Sbjct:  469 QIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVS-----GEEGRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELA-PKCNVTFLLSEDGSGKGAALITA 906          

HSP 2 Score: 319.316 bits (817), Expect = 9.065e-99
Identity = 181/439 (41.23%), Postives = 272/439 (61.96%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIEST-YAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             R S+   R++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+N+RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC+Q  LD  +L  WTK F    VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++GTLEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +       TK++S  E+    L  + E + R  L V   +  DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P+ + R  LSE GSGKGAA + A
Sbjct:   29 MRFSDETLRDIMARFRREMENGLARDTNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVE-----GDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PESDVRFLLSESGSGKGAALVTA 458          
BLAST of slc25a-4 vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 342.043 bits (876), Expect = 2.234e-107
Identity = 195/447 (43.62%), Postives = 278/447 (62.19%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++ E ++ FR ++     V KR+  ++  GL  + ++ A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD G+L  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TV           + +N EWGAFG+NG L+DIRTKYD A+D  SL+ GKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K      ++   +T+GVDG+L++ HP F+  M+  +K+   PKC     LSEDGSGKGAA I A
Sbjct:  469 QIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVS-----GEEGRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELA-PKCNVTFLLSEDGSGKGAALITA 906          

HSP 2 Score: 319.316 bits (817), Expect = 9.065e-99
Identity = 181/439 (41.23%), Postives = 272/439 (61.96%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIEST-YAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             R S+   R++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+N+RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC+Q  LD  +L  WTK F    VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++GTLEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +       TK++S  E+    L  + E + R  L V   +  DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P+ + R  LSE GSGKGAA + A
Sbjct:   29 MRFSDETLRDIMARFRREMENGLARDTNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVE-----GDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PESDVRFLLSESGSGKGAALVTA 458          
BLAST of slc25a-4 vs. Ensembl Zebrafish
Match: hk2 (hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017])

HSP 1 Score: 339.347 bits (869), Expect = 1.582e-106
Identity = 193/447 (43.18%), Postives = 270/447 (60.40%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            E   ++   R        V KR+E +M  GL     + A VKM P++V   P G E+G F+ALDLGGTN+R+LLV ++G      E+    Y IP+    G GE LFD I   I DFL+   +   ++ LGFTFSFPC+Q  LD GIL +WTKGF A+  EG++V  LL  A+ +     +   A+VNDTVGT+ +C +E P C +GLIVGTG+NACY+E++S V  VD      +   + +N EWGAFG+ G L+DI T++DRA+D  S +PGKQ +EK+ISGMYLGEIVR VL+    K LLF+G L + ++    F TK++S  E D   L      +    L  +T D  D  +++  C +V++RAA L G+ +A +++K      +N+ ++T+GVDG+L++ HP FA  M   ++    P CE  L  SEDGSGKGAA I A
Sbjct:  443 ERQRVLDTLRLGRDQLLEVKKRMEEEMKRGLAKKTHNNATVKMLPTFVRSTPDGTERGDFLALDLGGTNFRVLLVRVRGGKRRNVEMNNKIYTIPQDITQGTGEELFDHIVHCIADFLEYMGMKGASLPLGFTFSFPCHQDKLDQGILIKWTKGFKASGCEGEDVASLLKDAIHRCEEFDLDVVAVVNDTVGTMMTCGYEDPQCEVGLIVGTGTNACYMEEMSNVELVD-----GDEGRMCVNMEWGAFGDQGELDDIWTEFDRAVDDQSTYPGKQRYEKMISGMYLGEIVRNVLLHFTAKGLLFRGKLSERLKTRGIFETKFLSQIESDRLALRQVRSILQHLGLTSSTCD--DSILVKEVCSVVSKRAAQLCGAGLAAVVDKIRLNRGLNQLSITVGVDGTLYKLHPHFATIMRETLRDLA-PNCEVSLVQSEDGSGKGAALITA 881          

HSP 2 Score: 332.798 bits (852), Expect = 5.303e-104
Identity = 192/440 (43.64%), Postives = 274/440 (62.27%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCE-RDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             R S  N  +V+KR   +M+ GL       A VKM P++V   P G E G F+ALDLGGTN+R+LLV +  N     E+    YAIPE  M G G  LFD IAE + +FL+   I +K + LGFTFSFPC Q  LD   L  WTKGF A+ VEGK+VV LL  A++K  +  +   A++NDTVGT+ +C ++   C IGLIVGTG+NACY+E++  +  VD      +   + +N EWGAFG++G L+D+RT++DR +D  SL+PGKQ+FEK+ISGMY+GE+VRL+LV++ +  LLF+G+    +     F T ++S  E R       S E +LR   L  T +  DC   +  C+IV+ RAA+L  +++A ++ ++      +R   +IGVDGS++++HP FA  +N +++    P C+ R   SEDGSGKGAA + A
Sbjct:    1 MRLSNENLMDVSKRFRKEMDKGLGRDTNPTAAVKMLPTFVRSTPDGTETGDFLALDLGGTNFRVLLVKVSSNGMQKVEMENQIYAIPENIMRGCGSELFDHIAECLANFLEKLGIKEKKLPLGFTFSFPCQQTKLDESFLVSWTKGFKASGVEGKDVVSLLRKAIRKRGDFDIDIVAVINDTVGTMMTCGYDDHHCEIGLIVGTGTNACYMEEMRHLELVD-----GDEGRMCVNMEWGAFGDDGALDDLRTEFDREIDAGSLNPGKQLFEKMISGMYMGELVRLILVKMAKDGLLFQGHTTPDLLTTGHFQTSFVSAIENRKDDEGIVSAEQVLRGLGLDPTPE--DCVATQRVCQIVSTRAAHLCAASLAAVLRQIRDNKASDRLRTSIGVDGSVYKNHPEFARRLNKMVRSLV-PDCDVRFLRSEDGSGKGAAMVTA 432          
BLAST of slc25a-4 vs. Ensembl Zebrafish
Match: hk2 (hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017])

HSP 1 Score: 339.732 bits (870), Expect = 2.070e-106
Identity = 193/447 (43.18%), Postives = 270/447 (60.40%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            E   ++   R        V KR+E +M  GL     + A VKM P++V   P G E+G F+ALDLGGTN+R+LLV ++G      E+    Y IP+    G GE LFD I   I DFL+   +   ++ LGFTFSFPC+Q  LD GIL +WTKGF A+  EG++V  LL  A+ +     +   A+VNDTVGT+ +C +E P C +GLIVGTG+NACY+E++S V  VD      +   + +N EWGAFG+ G L+DI T++DRA+D  S +PGKQ +EK+ISGMYLGEIVR VL+    K LLF+G L + ++    F TK++S  E D   L      +    L  +T D  D  +++  C +V++RAA L G+ +A +++K      +N+ ++T+GVDG+L++ HP FA  M   ++    P CE  L  SEDGSGKGAA I A
Sbjct:  471 ERQRVLDTLRLGRDQLLEVKKRMEEEMKRGLAKKTHNNATVKMLPTFVRSTPDGTERGDFLALDLGGTNFRVLLVRVRGGKRRNVEMNNKIYTIPQDITQGTGEELFDHIVHCIADFLEYMGMKGASLPLGFTFSFPCHQDKLDQGILIKWTKGFKASGCEGEDVASLLKDAIHRCEEFDLDVVAVVNDTVGTMMTCGYEDPQCEVGLIVGTGTNACYMEEMSNVELVD-----GDEGRMCVNMEWGAFGDQGELDDIWTEFDRAVDDQSTYPGKQRYEKMISGMYLGEIVRNVLLHFTAKGLLFRGKLSERLKTRGIFETKFLSQIESDRLALRQVRSILQHLGLTSSTCD--DSILVKEVCSVVSKRAAQLCGAGLAAVVDKIRLNRGLNQLSITVGVDGTLYKLHPHFATIMRETLRDLA-PNCEVSLVQSEDGSGKGAALITA 909          

HSP 2 Score: 333.569 bits (854), Expect = 4.459e-104
Identity = 193/449 (42.98%), Postives = 279/449 (62.14%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCE-RDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++V + +   R S  N  +V+KR   +M+ GL       A VKM P++V   P G E G F+ALDLGGTN+R+LLV +  N     E+    YAIPE  M G G  LFD IAE + +FL+   I +K + LGFTFSFPC Q  LD   L  WTKGF A+ VEGK+VV LL  A++K  +  +   A++NDTVGT+ +C ++   C IGLIVGTG+NACY+E++  +  VD      +   + +N EWGAFG++G L+D+RT++DR +D  SL+PGKQ+FEK+ISGMY+GE+VRL+LV++ +  LLF+G+    +     F T ++S  E R       S E +LR   L  T +  DC   +  C+IV+ RAA+L  +++A ++ ++      +R   +IGVDGS++++HP FA  +N +++    P C+ R   SEDGSGKGAA + A
Sbjct:   20 QKVDKYLYHMRLSNENLMDVSKRFRKEMDKGLGRDTNPTAAVKMLPTFVRSTPDGTETGDFLALDLGGTNFRVLLVKVSSNGMQKVEMENQIYAIPENIMRGCGSELFDHIAECLANFLEKLGIKEKKLPLGFTFSFPCQQTKLDESFLVSWTKGFKASGVEGKDVVSLLRKAIRKRGDFDIDIVAVINDTVGTMMTCGYDDHHCEIGLIVGTGTNACYMEEMRHLELVD-----GDEGRMCVNMEWGAFGDDGALDDLRTEFDREIDAGSLNPGKQLFEKMISGMYMGELVRLILVKMAKDGLLFQGHTTPDLLTTGHFQTSFVSAIENRKDDEGIVSAEQVLRGLGLDPTPE--DCVATQRVCQIVSTRAAHLCAASLAAVLRQIRDNKASDRLRTSIGVDGSVYKNHPEFARRLNKMVRSLV-PDCDVRFLRSEDGSGKGAAMVTA 460          
BLAST of slc25a-4 vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 350.903 bits (899), Expect = 9.737e-112
Identity = 199/447 (44.52%), Postives = 277/447 (61.97%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E ++ F+ S      V +R+ +++  GL     + A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD IA  I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+    +   A+VNDTVGT+ +C++E P+C IGLIVGTGSNACY+E+   +  VD      +   + +N EWGAFG+NG L+DIRT YD+A+D  SL+ GKQ +EK+ISGMYLGEIVR +L++  ++  LF+G + +A++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+  M+  +K    PKC     LSEDGSGKGAA I A 
Sbjct:  342 QIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLAL-LQVRSILQQLGLNSTCD--DSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLA-PKCNVSFLLSEDGSGKGAALITAV 779          

HSP 2 Score: 181.8 bits (460), Expect = 6.394e-49
Identity = 128/349 (36.68%), Postives = 192/349 (55.01%), Query Frame = 2
Query:  443 EALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQI---------FEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAI-AVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            + LFD +AE + DF++ K+I DK + +GFTFSFPC Q  +D G+L  WTK F A+ VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAF                 D+ SL+PGKQ          FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + + + R   L       DC  +++ C IV+ R+A L  + +  +LI   +   V         R H +    +         P+ + R  LSE GSGKGAA + A 
Sbjct:   24 KVLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVE-----GDEGRMCINTEWGAF-----------------DRGSLNPGKQSLTVTLTLHRFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR---LGVEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGV------PRLRLHKTVRRLV---------PESDVRFLLSESGSGKGAAMVTAV 332          
BLAST of slc25a-4 vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 349.747 bits (896), Expect = 4.173e-111
Identity = 199/447 (44.52%), Postives = 277/447 (61.97%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E ++ F+ S      V +R+ +++  GL     + A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD IA  I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+    +   A+VNDTVGT+ +C++E P+C IGLIVGTGSNACY+E+   +  VD      +   + +N EWGAFG+NG L+DIRT YD+A+D  SL+ GKQ +EK+ISGMYLGEIVR +L++  ++  LF+G + +A++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+  M+  +K    PKC     LSEDGSGKGAA I A 
Sbjct:  362 QIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLAL-LQVRSILQQLGLNSTCD--DSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLA-PKCNVSFLLSEDGSGKGAALITAV 799          

HSP 2 Score: 224.942 bits (572), Expect = 2.927e-64
Identity = 138/339 (40.71%), Postives = 208/339 (61.36%), Query Frame = 2
Query:  446 ALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAI-AVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ALFD +AE + DF++ K+I DK + +GFTFSFPC Q  +D G+L  WTK F A+ VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIR+++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + + + R   L       DC  +++ C IV+ R+A L  + +  +LI   +   V         R H +    +         P+ + R  LSE GSGKGAA + A 
Sbjct:   37 ALFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVE-----GDEGRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR---LGVEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGV------PRLRLHKTVRRLV---------PESDVRFLLSESGSGKGAAMVTAV 352          
BLAST of slc25a-4 vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 349.747 bits (896), Expect = 1.078e-110
Identity = 199/447 (44.52%), Postives = 277/447 (61.97%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E ++ F+ S      V +R+ +++  GL     + A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD IA  I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+    +   A+VNDTVGT+ +C++E P+C IGLIVGTGSNACY+E+   +  VD      +   + +N EWGAFG+NG L+DIRT YD+A+D  SL+ GKQ +EK+ISGMYLGEIVR +L++  ++  LF+G + +A++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+  M+  +K    PKC     LSEDGSGKGAA I A 
Sbjct:  404 QIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLAL-LQVRSILQQLGLNSTCD--DSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLA-PKCNVSFLLSEDGSGKGAALITAV 841          

HSP 2 Score: 216.468 bits (550), Expect = 4.591e-61
Identity = 135/338 (39.94%), Postives = 203/338 (60.06%), Query Frame = 2
Query:  449 LFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAI-AVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            LFD +AE + DF++ K+I DK + +GFTFSFPC Q  +D G+L  WTK F A+ VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIR+++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E     +         +E         DC  +++ C IV+ R+A L  + +  +LI   +   V         R H +    +         P+ + R  LSE GSGKGAA + A 
Sbjct:   86 LFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVE-----GDEGRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIENKAKDILTRLGVEPSHE---------DCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGV------PRLRLHKTVRRLV---------PESDVRFLLSESGSGKGAAMVTAV 394          
BLAST of slc25a-4 vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 346.28 bits (887), Expect = 3.891e-109
Identity = 199/448 (44.42%), Postives = 277/448 (61.83%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E ++ F+ S      V +R+ +++  GL     + A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD IA  I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P+C IGLIVGTGSNACY+E+   +  VD      +   + +N EWGAFG+NG L+DIRT YD+A+D  SL+ GKQ +EK+ISGMYLGEIVR +L++  ++  LF+G + +A++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+  M+  +K    PKC     LSEDGSGKGAA I A 
Sbjct:  437 QIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLAL-LQVRSILQQLGLNSTCD--DSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLA-PKCNVSFLLSEDGSGKGAALITAV 875          

HSP 2 Score: 268.085 bits (684), Expect = 1.184e-79
Identity = 163/439 (37.13%), Postives = 249/439 (56.72%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R   +M  GL       A +KM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ K+I DK + +GFTFSFPC Q  +D G+L  WTK F A+ VEG +VV+LL  A+KK                                 V TG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIR+++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + + + R   L       DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P+ + R  LSE GSGKGAA + A 
Sbjct:   29 MRLSDETLLDIMGRFRAEMANGLSRDTNPTAIIKMLPTFVRSIPDGTEKGDFIALDLGGSHFRILRVKVSHEKKQTVQMESEIYDTPEDIIHGSGTRLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRG-------------------------------VSTGTNACYMEELRHIDMVEG-----DEGRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR---LGVEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGVPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PESDVRFLLSESGSGKGAAMVTAV 427          
BLAST of slc25a-4 vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 346.28 bits (887), Expect = 6.763e-109
Identity = 199/448 (44.42%), Postives = 277/448 (61.83%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E ++ F+ S      V +R+ +++  GL     + A VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD IA  I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P+C IGLIVGTGSNACY+E+   +  VD      +   + +N EWGAFG+NG L+DIRT YD+A+D  SL+ GKQ +EK+ISGMYLGEIVR +L++  ++  LF+G + +A++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+  M+  +K    PKC     LSEDGSGKGAA I A 
Sbjct:  458 QIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLAL-LQVRSILQQLGLNSTCD--DSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLA-PKCNVSFLLSEDGSGKGAALITAV 896          

HSP 2 Score: 313.538 bits (802), Expect = 1.915e-96
Identity = 177/448 (39.51%), Postives = 275/448 (61.38%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            E+ + +   R S+    ++  R   +M  GL       A +KM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ K+I DK + +GFTFSFPC Q  +D G+L  WTK F A+ VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIR+++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + + + R   L       DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P+ + R  LSE GSGKGAA + A 
Sbjct:   10 EIDKYLYSMRLSDETLLDIMGRFRAEMANGLSRDTNPTAIIKMLPTFVRSIPDGTEKGDFIALDLGGSHFRILRVKVSHEKKQTVQMESEIYDTPEDIIHGSGTRLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVE-----GDEGRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR---LGVEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGVPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PESDVRFLLSESGSGKGAAMVTAV 448          
BLAST of slc25a-4 vs. Ensembl Mouse
Match: Hk1 (hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103])

HSP 1 Score: 343.584 bits (880), Expect = 7.428e-108
Identity = 200/448 (44.64%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  FR S+     V K+L  +M MGL      +A VKM PSYV  +P G E G F+ALDLGGTN+R+LLV ++ G     E+    Y+IP   M G G+ LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +V  LL  A+K+     +   A+VNDTVGT+ +C++E P C IGLIVGTGSNACY+E++  V  V+      N   + IN EWGAFG+NG L+DIRT +D+ +D+ SL+ GKQ FEK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V++RAA L G+ +A ++ K      ++   VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  469 QIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVE-----GNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCTVSFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 314.309 bits (804), Expect = 9.049e-97
Identity = 177/440 (40.23%), Postives = 271/440 (61.59%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R + +M  GL   +   A VKM P++V  +P G EKG F+ALDLGG+++RIL V +    +    +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  +L  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F T  ++  E D   +  + E + R   L       DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   29 MRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTR---LGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Mouse
Match: Hk2 (hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197])

HSP 1 Score: 342.813 bits (878), Expect = 8.064e-108
Identity = 198/442 (44.80%), Postives = 279/442 (63.12%), Query Frame = 2
Query:  152 MKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++  + S      V +R++++M  GL     + A VKM P+YV   P G EKG F+ALDLGGTN+R+LLV ++ G     E+    Y+IP+  M G GE LFD I + I DFL+   +   ++ LGFTFSFPC Q  LD  IL +WTKGF A+  EG++VV LL  A+++     +   A+VNDTVGT+ +C +E P C +GLIVGTGSNACY+E++  V  VD          + +N EWGAFG+NG L+D+RT +D A+D+ SL+PGKQ FEK+ISGMYLGEIVR +L++  ++ LLF+G + + ++    F TK++S  E D   L      +LR+  L +T D  D  I++  C +VARRAA L G+ +A +++K+  NR      VT+GVDG+L++ HP FA  M+  ++    PKC+     SEDGSGKGAA I A
Sbjct:  446 LESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVD-----GEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLAL-LQVRAILRHLGLESTCD--DSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLA-PKCDVSFLESEDGSGKGAALITA 878          

HSP 2 Score: 329.717 bits (844), Expect = 7.676e-103
Identity = 186/439 (42.37%), Postives = 275/439 (62.64%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             R S+     +++R   +M  GL       A VKM P++V   P G E G+F+ALDLGGTN+R+L V +  N     E+    YAIPE  M G G  LFD IAE + +F+   +I +K + LGFTFSFPC+Q  LD   L  WTKGF ++ VEG++VV+L+  A+++  +  +   A+VNDTVGT+ +C ++  +C IGLIVGTGSNACY+E++  +  V+      +   + IN EWGAFG++GTL DIRT++DR +D  SL+PGKQ+FEK+ISGMY+GE+VRL+LV++ + +LLF+G L   +    SF TK +SD E D   +  + + ++R  L ++ +   DC      C+IV+ R+A L  + +A ++ ++       R   TIGVDGS+++ HP FA  ++  +++   P C+ R   SEDGSGKGAA + A
Sbjct:    1 MRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVE-----GDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVR--LGLSPLQE-DCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLV-PDCDVRFLRSEDGSGKGAAMVTA 430          
BLAST of slc25a-4 vs. Ensembl Mouse
Match: Hk1 (hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103])

HSP 1 Score: 343.199 bits (879), Expect = 1.144e-107
Identity = 200/448 (44.64%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  FR S+     V K+L  +M MGL      +A VKM PSYV  +P G E G F+ALDLGGTN+R+LLV ++ G     E+    Y+IP   M G G+ LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +V  LL  A+K+     +   A+VNDTVGT+ +C++E P C IGLIVGTGSNACY+E++  V  V+      N   + IN EWGAFG+NG L+DIRT +D+ +D+ SL+ GKQ FEK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V++RAA L G+ +A ++ K      ++   VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  468 QIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVE-----GNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCTVSFLLSEDGSGKGAALITAV 906          

HSP 2 Score: 313.538 bits (802), Expect = 1.363e-96
Identity = 177/440 (40.23%), Postives = 271/440 (61.59%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R + +M  GL   +   A VKM P++V  +P G EKG F+ALDLGG+++RIL V +    +    +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  +L  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F T  ++  E D   +  + E + R   L       DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   28 MRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTR---LGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 458          
BLAST of slc25a-4 vs. Ensembl Mouse
Match: Hk2 (hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197])

HSP 1 Score: 342.813 bits (878), Expect = 1.354e-107
Identity = 198/442 (44.80%), Postives = 279/442 (63.12%), Query Frame = 2
Query:  152 MKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++  + S      V +R++++M  GL     + A VKM P+YV   P G EKG F+ALDLGGTN+R+LLV ++ G     E+    Y+IP+  M G GE LFD I + I DFL+   +   ++ LGFTFSFPC Q  LD  IL +WTKGF A+  EG++VV LL  A+++     +   A+VNDTVGT+ +C +E P C +GLIVGTGSNACY+E++  V  VD          + +N EWGAFG+NG L+D+RT +D A+D+ SL+PGKQ FEK+ISGMYLGEIVR +L++  ++ LLF+G + + ++    F TK++S  E D   L      +LR+  L +T D  D  I++  C +VARRAA L G+ +A +++K+  NR      VT+GVDG+L++ HP FA  M+  ++    PKC+     SEDGSGKGAA I A
Sbjct:  474 LESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVD-----GEEGRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLAL-LQVRAILRHLGLESTCD--DSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLA-PKCDVSFLESEDGSGKGAALITA 906          

HSP 2 Score: 330.487 bits (846), Expect = 5.609e-103
Identity = 187/448 (41.74%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPP-EIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++V + +   R S+     +++R   +M  GL       A VKM P++V   P G E G+F+ALDLGGTN+R+L V +  N     E+    YAIPE  M G G  LFD IAE + +F+   +I +K + LGFTFSFPC+Q  LD   L  WTKGF ++ VEG++VV+L+  A+++  +  +   A+VNDTVGT+ +C ++  +C IGLIVGTGSNACY+E++  +  V+      +   + IN EWGAFG++GTL DIRT++DR +D  SL+PGKQ+FEK+ISGMY+GE+VRL+LV++ + +LLF+G L   +    SF TK +SD E D   +  + + ++R  L ++ +   DC      C+IV+ R+A L  + +A ++ ++       R   TIGVDGS+++ HP FA  ++  +++   P C+ R   SEDGSGKGAA + A
Sbjct:   20 QKVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVE-----GDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVR--LGLSPLQE-DCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLV-PDCDVRFLRSEDGSGKGAAMVTA 458          
BLAST of slc25a-4 vs. Ensembl Mouse
Match: Hk1 (hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103])

HSP 1 Score: 342.813 bits (878), Expect = 2.349e-107
Identity = 200/448 (44.64%), Postives = 276/448 (61.61%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  FR S+     V K+L  +M MGL      +A VKM PSYV  +P G E G F+ALDLGGTN+R+LLV ++ G     E+    Y+IP   M G G+ LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +V  LL  A+K+     +   A+VNDTVGT+ +C++E P C IGLIVGTGSNACY+E++  V  V+      N   + IN EWGAFG+NG L+DIRT +D+ +D+ SL+ GKQ FEK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V++RAA L G+ +A ++ K      ++   VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  496 QIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVE-----GNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCTVSFLLSEDGSGKGAALITAV 934          

HSP 2 Score: 309.686 bits (792), Expect = 6.246e-95
Identity = 181/474 (38.19%), Postives = 278/474 (58.65%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNL-------------------------PDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            E++ + +   R S+    ++  R + +M  GL   +   A VKM P++V  +P G EKG F+ALDLGG+++RIL V +    +    +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  +L  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +                         PD  R+ Y    +   D  RD   +  + E + R   L       DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   24 EKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETGWELSPD--RRWYQAYMRCTQDTHRDKEGVQNAKEILTR---LGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 486          
BLAST of slc25a-4 vs. UniProt/SwissProt
Match: sp|Q26609|HXK_SCHMA (Hexokinase OS=Schistosoma mansoni OX=6183 PE=1 SV=2)

HSP 1 Score: 473.396 bits (1217), Expect = 4.032e-163
Identity = 241/444 (54.28%), Postives = 318/444 (71.62%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            Q+ E+V+E++KPF  S  +Y  +  R+   M +GL  +  +K+ +KMFPSYV+K P+G E G F+ALDLGGTNYR+L VTL+G    P I E TY IP  KMSG G  LF +IAET+ DFL++  + DK   LGFTFSFPC QKGL    L RWTKGFSA  VEG NV ELL   L K  L V C A+VNDTVGTLASC+ E P CA+GLIVGTG+N  YIED SKV  +D          ++INTEWGAFGE G L+  RT++D++MD +SLHPGKQ++EK++SGMYLGE+VR ++V L+E+K+LF+G+LP+ ++   S LT+Y++D ERDP HL Y+T YML ++L V  ++ +D +I+RY CE+V +RAAYLAG+ IA ++ ++NR  VT+GVDGSL++ HP F   M  ++ + K     F L+LSEDGSGKGAAAI A+
Sbjct:    7 QLFEKVVEILKPFDLSVVDYEEICDRMGESMRLGLQKSTNEKSSIKMFPSYVTKTPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYCIPAEKMSGSGTELFKYIAETLADFLENNGMKDKKFDLGFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQTELDKRELNVKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNVAYIEDSSKVELMDGV----KEPEVVINTEWGAFGEKGELDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIVRYACEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLYKFHPKFCERMTDMVDKLKPKNTRFCLRLSEDGSGKGAAAIAAS 446          
BLAST of slc25a-4 vs. UniProt/SwissProt
Match: sp|Q9NFT7|HXK2_DROME (Hexokinase type 2 OS=Drosophila melanogaster OX=7227 GN=Hex-t2 PE=2 SV=4)

HSP 1 Score: 357.836 bits (917), Expect = 2.915e-117
Identity = 197/443 (44.47%), Postives = 287/443 (64.79%), Query Frame = 2
Query:  128 IPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            +  E+   +K F   +     V +R+  ++ MGL      +A +K F S+V  +P+GKE+G+++ALDLGG+N+R+LLV L  +N+  E +   Y  P+  MSG G+ALFDF+AE +++F  S  + +++++LGFTFSFP  Q+GL  GIL  WTKGFS   V GKNVV LL  A+ ++ +LK++  A++NDTVGTL SC+F HP+C IGLIVGTGSNACY+E        +          +IIN EWGAFG+NG LE +RT YD+A+DK + +PGKQ FEK ISGMY+GE+VRLV+ ++I K  +F G + + +++ +SF T Y+SD E D P  + +   +L +EL +      D + +RY CE V+ R+A L    +  +INKMN   V IG+DGS++R HP +   +   +K+   P  +F L +SEDGSG+GAA + A
Sbjct:   38 VNTEIEAAVKGFLIDQEKMTEVVERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLI-SNSDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQGLSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHPNCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPS-MIINCEWGAFGDNGVLEFVRTSYDKAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAYISDVESDAPGEYRNCNKVL-SELGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINKMNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAA 477          
BLAST of slc25a-4 vs. UniProt/SwissProt
Match: sp|P05708|HXK1_RAT (Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 PE=1 SV=4)

HSP 1 Score: 347.821 bits (891), Expect = 1.038e-108
Identity = 201/448 (44.87%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  FR S+     V KRL  +M MGL      KA VKM PS+V  +P G E G F+ALDLGGTN+R+LLV ++ G     E+    Y+IP   M G G+ LFD I   I+DFL    I    + LGFTFSFPC+Q  LD GIL  WTKGF AT+ EG +V  LL  A+K+     +   A+VNDTVGT+ +C++E P C IGLIVGTG+NACY+E++  V  V+      N   + IN EWGAFG+NG L+DIRT +D+ +D+ SL+ GKQ FEK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V++RAA L G+ +A ++ K      ++   VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  469 QIEETLAHFRLSKQTLMEVKKRLRTEMEMGLRKETNSKATVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCHQTNLDCGILISWTKGFKATDCEGHDVASLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEIGLIVGTGTNACYMEEMKNVEMVE-----GNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCTVSFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 303.908 bits (777), Expect = 5.017e-92
Identity = 179/440 (40.68%), Postives = 274/440 (62.27%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R + +M  GL   +   A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +A+ + DF++ KKI DK + +GFTFSFPC Q  +D  +L  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F T  +S  E+D   +  + E + R  L V   D +DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE G+GKGAA + A 
Sbjct:   29 MRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVSMESEIYDTPENIVHGSGTQLFDHVADCLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKDKEGIQNAKEILTR--LGVEPSD-VDCVSVQHICTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLV-PDSDVRFLLSESGTGKGAAMVTAV 459          
BLAST of slc25a-4 vs. UniProt/SwissProt
Match: sp|P19367|HXK1_HUMAN (Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 SV=3)

HSP 1 Score: 347.051 bits (889), Expect = 2.622e-108
Identity = 200/448 (44.64%), Postives = 278/448 (62.05%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +VV LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  469 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 318.546 bits (815), Expect = 1.352e-97
Identity = 183/440 (41.59%), Postives = 272/440 (61.82%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  +D  IL  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   29 MRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. UniProt/SwissProt
Match: sp|Q5RC71|HXK1_PONAB (Hexokinase-1 OS=Pongo abelii OX=9601 GN=HK1 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 2.826e-107
Identity = 199/448 (44.42%), Postives = 277/448 (61.83%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E +  F  ++     V KR+  +M +GL     + A VKM PS+V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    I    + LGFTFSFPC Q  LD GIL  WTKGF AT+  G +V  LL  A+K+     +   A+VNDTVGT+ +C++E P C +GLIVGTGSNACY+E++  V  V+      +   + IN EWGAFG+NG L+DIRT YDR +D+ SL+ GKQ +EK+ISGMYLGEIVR +L++  +K  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  +++  C +V+RRAA L G+ +A +++K      ++R  VT+GVDG+L++ HP F+  M+  +K+  +PKC     LSEDGSGKGAA I A 
Sbjct:  469 QIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGNDVATLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVE-----GDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLNSTCD--DSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKEL-SPKCNVSFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 316.235 bits (809), Expect = 9.418e-97
Identity = 182/440 (41.36%), Postives = 271/440 (61.59%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+++RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK   +GFTFSFPC Q  +D  +L  WTK F A+ VEG +VV+LL  A+KK  +   +  A+VNDTVGT+ +C ++   C +GLI+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LEDIRT++DR +D+ SL+PGKQ+FEK++SGMYLGE+VRL+LV++ ++ LLF+G +   +     F T  +S  E++   LH + E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++N++       R   T+GVDGSL++ HP ++   +  +++   P  + R  LSE GSGKGAA + A 
Sbjct:   29 MRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKSPVGFTFSFPCQQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLV-PDSDVRFLLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. TrEMBL
Match: A0A0H3YFE0 (Phosphotransferase OS=Schmidtea mediterranea OX=79327 GN=slc25a-4 PE=2 SV=1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 474/474 (100.00%), Postives = 474/474 (100.00%), Query Frame = 2
Query:   41 MDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            MDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS
Sbjct:    1 MDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 474          
BLAST of slc25a-4 vs. TrEMBL
Match: G4VIV9 (Phosphotransferase OS=Schistosoma mansoni OX=6183 GN=Smp_043030 PE=3 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 1.195e-160
Identity = 241/444 (54.28%), Postives = 318/444 (71.62%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            Q+ E+V+E++KPF  S  +Y  +  R+   M +GL  +  +K+ +KMFPSYV+K P+G E G F+ALDLGGTNYR+L VTL+G    P I E TY IP  KMSG G  LF +IAET+ DFL++  + DK   LGFTFSFPC QKGL    L RWTKGFSA  VEG NV ELL   L K  L V C A+VNDTVGTLASC+ E P CA+GLIVGTG+N  YIED SKV  +D          ++INTEWGAFGE G L+  RT++D++MD +SLHPGKQ++EK++SGMYLGE+VR ++V L+E+K+LF+G+LP+ ++   S LT+Y++D ERDP HL Y+T YML ++L V  ++ +D +I+RY CE+V +RAAYLAG+ IA ++ ++NR  VT+GVDGSL++ HP F   M  ++ + K     F L+LSEDGSGKGAAAI A+
Sbjct:    7 QLFEKVVEILKPFDLSVVDYEEICDRMGESMRLGLQKSTNEKSSIKMFPSYVTKTPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYCIPAEKMSGSGTELFKYIAETLADFLENNGMKDKKFDLGFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQTELDKRELNVKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNVAYIEDSSKVELMDGV----KEPEVVINTEWGAFGEKGELDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIVRYACEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLYKFHPKFCERMTDMVDKLKPKNTRFCLRLSEDGSGKGAAAIAAS 446          
BLAST of slc25a-4 vs. TrEMBL
Match: C1L5D0 (Phosphotransferase OS=Schistosoma japonicum OX=6182 GN=Hex-A PE=2 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 7.948e-160
Identity = 246/446 (55.16%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            Q+ E+V+E+++PF  S ++Y     +++  M +GL  +   K+ +KMFPSYV+KVP+G E G F+ALDLGGTNYR+L VTL+G    P I E TY+IP  KMSG G  LF +IAET++DFL +  + DK   LGFTFSFPC QKGL    L RWTKGF+A  VEG NV ELL  AL +  L V C A+VNDTVGTLASC+ E   CA+GLIVGTG+N  YIED SKV  VD     +    +I+NTEWGAFGENG L+  RT++D+AMD  SLHPGKQ+FEK++SGMYLGE+VR +LV L+E+K+LF+G LP+ ++   S LT+Y++D ERDP HL YST YML  +L V  ++ +D +I+RY CE+V +RAAYLAG+ IA ++ ++NR  VT+GVDGSLF+ H  F   M  +I + K     F L+LSEDGSGKGAAAI A+ S
Sbjct:    7 QLFEKVVEVLRPFDLSVADYEEFCDKMDEAMRLGLQKSTNGKSSIKMFPSYVTKVPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYSIPAEKMSGTGTELFRYIAETLSDFLDNNGMRDKKFDLGFTFSFPCEQKGLTHATLVRWTKGFTADGVEGNNVAELLQNALDEHGLHVRCVAVVNDTVGTLASCALEDSKCAVGLIVGTGTNVAYIEDSSKVEMVDNIFEPE----VIVNTEWGAFGENGELDCWRTQFDKAMDIESLHPGKQLFEKMVSGMYLGELVRHILVYLVEQKVLFRGKLPERLKVRNSLLTRYLTDVERDPAHLLYSTYYMLTEDLSVPVVEPVDNRIVRYTCEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLFKFHLKFCERMTDMIDKLKPKNTRFCLRLSEDGSGKGAAAIAASCS 448          
BLAST of slc25a-4 vs. TrEMBL
Match: A0A4Z2DGI9 (Phosphotransferase OS=Schistosoma japonicum OX=6182 GN=EWB00_001184 PE=3 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 2.028e-159
Identity = 246/446 (55.16%), Postives = 318/446 (71.30%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            Q+ E+V+E+++PF  S  +Y     +++  M +GL  +   K+ +KMFPSYV+KVP+G E G F+ALDLGGTNYR+L VTL+G    P I E TY+IP  KMSG G  LF +IAET++DFL +  + DK   LGFTFSFPC QKGL    L RWTKGF+A  VEG NV ELL  AL +  L V C A+VNDTVGTLASC+ E   CA+GLIVGTG+N  YIED SKV  VD     +    +I+NTEWGAFGENG L+  RT++D+AMD  SLHPGKQ+FEK++SGMYLGE+VR +LV L+E+K+LF+G LP+ ++   S LT+Y++D ERDP HL YST YML  +L V  ++ +D +I+RY CE+V +RAAYLAG+ IA ++ ++NR  VT+GVDGSLF+ H  F   M  +I + K     F L+LSEDGSGKGAAAI A+ S
Sbjct:    7 QLFEKVVEVLRPFDLSVVDYEEFCDKMDEAMRLGLQKSTNGKSSIKMFPSYVTKVPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYSIPAEKMSGTGTELFRYIAETLSDFLDNNGMRDKKFDLGFTFSFPCEQKGLTHATLVRWTKGFTADGVEGNNVAELLQNALDEHGLHVRCVAVVNDTVGTLASCALEDSKCAVGLIVGTGTNVAYIEDSSKVEMVDNIFEPE----VIVNTEWGAFGENGELDCWRTQFDKAMDIESLHPGKQLFEKMVSGMYLGELVRHILVYLVEQKVLFRGKLPERLKVRNSLLTRYLTDVERDPAHLLYSTYYMLTEDLSVPVVEPVDNRIVRYTCEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLFKFHLKFCERMTDMIDKLKPKNTRFCLRLSEDGSGKGAAAIAASCS 448          
BLAST of slc25a-4 vs. TrEMBL
Match: C1LHK9 (Phosphotransferase OS=Schistosoma japonicum OX=6182 GN=Hex-A PE=2 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.985e-158
Identity = 245/446 (54.93%), Postives = 317/446 (71.08%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            Q+ E+V+E+++PF  S  +Y     +++  M +GL  +   K+ +KMFPSYV+KVP+G E G F+ALDLGGTNYR+L VTL+G    P I E TY+IP  KMSG G  LF +IAET++DFL +  + DK   LGFTFSFPC QKGL    L RWTKGF+A  VEG NV ELL  AL +  L V C A+VNDTVGTLASC+ E   CA+GLIVGTG+N  YIED SKV  VD     +    +I+NTEWGAFGENG L+  RT++D+AMD  SLHPGKQ+FEK++SGMYLGE+VR +LV L+E+K+LF+G LP+ ++   S LT+Y++D ERDP HL YST YML  +L V  ++ +D +I+RY CE+V +RAAYLAG+ IA ++ ++NR  VT+GVDGSLF+ H  F   M  +I + K     F L+LSEDGS KGAAAI A+ S
Sbjct:    7 QLFEKVVEVLRPFDLSVVDYEEFCDKMDEAMRLGLQKSTNGKSSIKMFPSYVTKVPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYSIPAEKMSGTGTELFRYIAETLSDFLDNNGMRDKKFDLGFTFSFPCEQKGLTHATLVRWTKGFTADGVEGNNVAELLQNALDEHGLHVRCVAVVNDTVGTLASCALEDSKCAVGLIVGTGTNVAYIEDSSKVEMVDNIFEPE----VIVNTEWGAFGENGELDCWRTQFDKAMDIESLHPGKQLFEKMVSGMYLGELVRHILVYLVEQKVLFRGKLPERLKVRNSLLTRYLTDVERDPAHLLYSTYYMLTEDLSVPVVEPVDNRIVRYTCEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLFKFHLKFCERMTDMIDKLKPKNTRFCLRLSEDGSWKGAAAIAASCS 448          
BLAST of slc25a-4 vs. Ensembl Cavefish
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:103028521])

HSP 1 Score: 355.525 bits (911), Expect = 1.417e-112
Identity = 199/448 (44.42%), Postives = 283/448 (63.17%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E++  FR ++     V KR+  ++  GL    +DKA VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TVD      +   + +N EWGAFG+NG L+DIRT+YDRA+D  SL+PGKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   +T+GVDG+L++ HP F+  M+  +K+   PKC+    LSEDGSGKGAA I A 
Sbjct:  469 QIAEILAEFRLTQDQLLEVKKRMLTEIQTGLSKKTQDKATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVACISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTQYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQICGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELA-PKCDVNFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 323.939 bits (829), Expect = 1.643e-100
Identity = 180/442 (40.72%), Postives = 273/442 (61.76%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
             R S+   R++  R  +++  GL       A +KM P++V  +P G EKG F+ALDLGG+N+RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  LD  +L  WTK F    VEG +VV+LL  A+KK  +      A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + E + R   L     + DC  +++ C IV+ R+A L  + +  ++N++       R   T+G+DGSL++ HP ++  ++  +++   P+C+ R  LSE GSGKGAA + A  S
Sbjct:   29 MRFSDETLRDIKARFRMELEKGLSRDTNPTATIKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQNYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHISAIEKTKEGLTKAKEILTR---LGVEPSADDCIAVQHVCAIVSFRSANLIAATLGAILNRLKDNKNVPRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLV-PECDVRFLLSESGSGKGAALVTAWAS 461          
BLAST of slc25a-4 vs. Ensembl Cavefish
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:103028521])

HSP 1 Score: 355.525 bits (911), Expect = 2.060e-112
Identity = 199/448 (44.42%), Postives = 283/448 (63.17%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++ E++  FR ++     V KR+  ++  GL    +DKA VKM P+YV   P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD GIL  WTKGF AT+ EG++VV LL   +K+     +   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TVD      +   + +N EWGAFG+NG L+DIRT+YDRA+D  SL+PGKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   +T+GVDG+L++ HP F+  M+  +K+   PKC+    LSEDGSGKGAA I A 
Sbjct:  483 QIAEILAEFRLTQDQLLEVKKRMLTEIQTGLSKKTQDKATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVACISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVD-----GDQGRMCVNMEWGAFGDNGCLDDIRTQYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQICGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELA-PKCDVNFLLSEDGSGKGAALITAV 921          

HSP 2 Score: 323.939 bits (829), Expect = 1.820e-100
Identity = 180/454 (39.65%), Postives = 279/454 (61.45%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            ++  ++ + +   R S+   R++  R  +++  GL       A +KM P++V  +P G EKG F+ALDLGG+N+RIL V +         +ES  Y  PE  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  LD  +L  WTK F    VEG +VV+LL  A+KK  +      A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G LEDIRT++DR +D+ SL+PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +     F TK++S  E+    L  + E + R   L     + DC  +++ C IV+ R+A L  + +  ++N++       R   T+G+DGSL++ HP ++  ++  +++   P+C+ R  LSE GSGKGAA + A  S
Sbjct:   31 RVTAKIDKYLYSMRFSDETLRDIKARFRMELEKGLSRDTNPTATIKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQNYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHISAIEKTKEGLTKAKEILTR---LGVEPSADDCIAVQHVCAIVSFRSANLIAATLGAILNRLKDNKNVPRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLV-PECDVRFLLSESGSGKGAALVTAWAS 475          
BLAST of slc25a-4 vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 343.199 bits (879), Expect = 8.064e-108
Identity = 196/449 (43.65%), Postives = 283/449 (63.03%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            EE+ + +  F  S +  + V +++ +++  GL     D A VKM PSYV + P G E+G+F+ALDLGGTN+R+L+V ++ G      +    YAIP   M G GE LFD I + I+DFL    + +  + LGFTFSFPC+Q G+D G L  WTKGF AT  EG +VV++L  A+K+ N   +   A+VNDTVGT+ +C++E P C IGLI GTGSN CY+ED+  V  V+      +   + INTEWG FG+N  +EDIRT++D  +D+ SL+ GKQ FEK+ SGMYLGEIVR +L++L ++ LLF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K+  NR      +T+GVDG+L++ HP F+  +   +K+   P+CE    LSEDGSGKGAA I A 
Sbjct:  468 EEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVE-----GDEGQMCINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELA-PQCEVEFILSEDGSGKGAALITAV 907          

HSP 2 Score: 286.96 bits (733), Expect = 1.006e-86
Identity = 172/450 (38.22%), Postives = 272/450 (60.44%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTL-KGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNEL-LVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLIN------KMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++V   +   R S+     ++ R   +M  GL       A +KM P++V   P G EKG+F+ALDLGG+ +++L V + +  N   ++    + IPE  ++G G  LFD +A+++ +F++   I  K   LGFTFSFPC Q  LD G+L  W+K + A  V+G NVV+ L  A+ K   + V   ALVNDTVGT+ +C ++   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G L D  T +D  +D  S++PGKQ+FEK++SGMY+GE+VRL+L+++ ++ LLFKG + DA+R    F T+++S  E     L  + E +   EL L  T D  DC  +++ C IV+ R+A L  +A+A ++       K+     T+G+DG+++R HP ++  ++ ++++   P+C  R  LSE GSGKGAA + A 
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGLRNTREIL--TELGLTPTED--DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLV-PECHVRFVLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 342.813 bits (878), Expect = 8.482e-108
Identity = 196/449 (43.65%), Postives = 283/449 (63.03%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            EE+ + +  F  S +  + V +++ +++  GL     D A VKM PSYV + P G E+G+F+ALDLGGTN+R+L+V ++ G      +    YAIP   M G GE LFD I + I+DFL    + +  + LGFTFSFPC+Q G+D G L  WTKGF AT  EG +VV++L  A+K+ N   +   A+VNDTVGT+ +C++E P C IGLI GTGSN CY+ED+  V  V+      +   + INTEWG FG+N  +EDIRT++D  +D+ SL+ GKQ FEK+ SGMYLGEIVR +L++L ++ LLF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K+  NR      +T+GVDG+L++ HP F+  +   +K+   P+CE    LSEDGSGKGAA I A 
Sbjct:  468 EEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVE-----GDEGQMCINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELA-PQCEVEFILSEDGSGKGAALITAV 907          

HSP 2 Score: 286.96 bits (733), Expect = 1.052e-86
Identity = 172/450 (38.22%), Postives = 272/450 (60.44%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTL-KGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNEL-LVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLIN------KMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++V   +   R S+     ++ R   +M  GL       A +KM P++V   P G EKG+F+ALDLGG+ +++L V + +  N   ++    + IPE  ++G G  LFD +A+++ +F++   I  K   LGFTFSFPC Q  LD G+L  W+K + A  V+G NVV+ L  A+ K   + V   ALVNDTVGT+ +C ++   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G L D  T +D  +D  S++PGKQ+FEK++SGMY+GE+VRL+L+++ ++ LLFKG + DA+R    F T+++S  E     L  + E +   EL L  T D  DC  +++ C IV+ R+A L  +A+A ++       K+     T+G+DG+++R HP ++  ++ ++++   P+C  R  LSE GSGKGAA + A 
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGLRNTREIL--TELGLTPTED--DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLV-PECHVRFVLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 342.813 bits (878), Expect = 1.003e-107
Identity = 196/449 (43.65%), Postives = 283/449 (63.03%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            EE+ + +  F  S +  + V +++ +++  GL     D A VKM PSYV + P G E+G+F+ALDLGGTN+R+L+V ++ G      +    YAIP   M G GE LFD I + I+DFL    + +  + LGFTFSFPC+Q G+D G L  WTKGF AT  EG +VV++L  A+K+ N   +   A+VNDTVGT+ +C++E P C IGLI GTGSN CY+ED+  V  V+      +   + INTEWG FG+N  +EDIRT++D  +D+ SL+ GKQ FEK+ SGMYLGEIVR +L++L ++ LLF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C  V+RRAA L G+ +A +++K+  NR      +T+GVDG+L++ HP F+  +   +K+   P+CE    LSEDGSGKGAA I A 
Sbjct:  468 EEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVE-----GDEGQMCINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELA-PQCEVEFILSEDGSGKGAALITAV 907          

HSP 2 Score: 286.574 bits (732), Expect = 1.274e-86
Identity = 172/450 (38.22%), Postives = 272/450 (60.44%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTL-KGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNEL-LVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLIN------KMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            ++V   +   R S+     ++ R   +M  GL       A +KM P++V   P G EKG+F+ALDLGG+ +++L V + +  N   ++    + IPE  ++G G  LFD +A+++ +F++   I  K   LGFTFSFPC Q  LD G+L  W+K + A  V+G NVV+ L  A+ K   + V   ALVNDTVGT+ +C ++   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G L D  T +D  +D  S++PGKQ+FEK++SGMY+GE+VRL+L+++ ++ LLFKG + DA+R    F T+++S  E     L  + E +   EL L  T D  DC  +++ C IV+ R+A L  +A+A ++       K+     T+G+DG+++R HP ++  ++ ++++   P+C  R  LSE GSGKGAA + A 
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGLRNTREIL--TELGLTPTED--DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLV-PECHVRFVLSESGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008354.1 (pep scaffold:Pmarinus_7.0:GL478372:35293:41413:-1 gene:ENSPMAG00000007525.1 transcript:ENSPMAT00000008354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.168 bits (827), Expect = 6.563e-104
Identity = 181/431 (42.00%), Postives = 273/431 (63.34%), Query Frame = 2
Query:  188 NVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEII--ESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             V  R+   M+ GL     D A +KM PS+V   P G E+G+++ALDLGGTN+R+L V +   +   ++      Y IP+  M+G  E LFD IA+ ++DFL+ + I  + + L FTFSFPC Q  LD   L  WTKGF  + VEG+++V+LL  A+K+  +  +   A+VNDTVGT+ +C ++   C +GLIVGTG+N CY+E+LS V  V+      +   + +NTEWGAFG++G L+D+ T++DR +D NSL+PGKQ++EK+ISGMYLGEIVRLVLV+L E+ LLF G +  A+    SF T+++S  E++   L  + E +L++  L  ++   DC+     C +V+ R+A+L  + +A ++ ++      +R   T+GVDGS+++ HP F+  +   +K    P+CE    LSEDGSGKGAA + A
Sbjct:   38 QVRVRMRAAMDAGLGQQTHDAASIKMLPSFVRSTPDGTERGEYLALDLGGTNFRVLRVKIADESGQQKVFMENEIYVIPKEAMAGTAEQLFDLIAKCLSDFLEKRNIKSQKLPLAFTFSFPCKQTKLDESTLVTWTKGFKTSGVEGRDIVQLLREAIKRRGDFDIDVVAVVNDTVGTMMTCGYDDQRCEVGLIVGTGTNVCYMEELSNVELVE-----GDEGRMCVNTEWGAFGDDGALDDVLTEFDRELDHNSLNPGKQLYEKMISGMYLGEIVRLVLVKLTEEGLLFGGKVSSALGTKGSFETRFVSAMEKENVGLEKA-EKILKDLGLQVSVQ--DCEAACLICCLVSTRSAHLCAAGLAAVVTRIRQNQAKDRLQTTVGVDGSVYKLHPQFSQRLQDALKLLV-PECEVHFILSEDGSGKGAAMVTA 459          

HSP 2 Score: 105.145 bits (261), Expect = 3.189e-24
Identity = 52/147 (35.37%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTL-KGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGL 562
            Q   ++ E + P +      ++V + L  +M  GL      +A VKM PSYV  +P+G E+G+F+ LDLGG N+ ++LV L  G      I +  Y++PE    G  E LFD +AE   + L+      ++I +G  FSFPC Q  L
Sbjct:  466 QQRRQIDEKLAPLKLDHKVLKDVKRHLREEMERGLKCESHKEASVKMLPSYVRTIPNGNEEGEFLTLDLGGGNFIVMLVKLPGGGRREASIFKKIYSVPENIQRGTAEKLFDHLAECAGELLQESGRSGRSIHVGLIFSFPCRQGSL 612          
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Match: gck (glucokinase (hexokinase 4) [Source:ZFIN;Acc:ZDB-GENE-060825-204])

HSP 1 Score: 291.967 bits (746), Expect = 2.347e-94
Identity = 170/420 (40.48%), Postives = 256/420 (60.95%), Query Frame = 2
Query:  116 ISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIEST---YAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCER--DPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRP----TVTIGVDGSLFRHHP 1339
            +S +  ++V +++  F   +     V  R+  +M  GL      +A VKM P+YV   P G E G F+ALDLGGTN+R++LV +  N      +E+    Y IPE  M+G  E LFD+IAE I ++L    +  K + LGFTFSFP     LD GIL  WTKGF+AT  EG NVVELL  A+K+  +  +   A+VNDTV T+ SC +E  +  IG+IVGTG N CY+E++  V       L++  + + IN EWGAFG++G LED+R +YDR +D+ S + G+Q+FEK+ISG Y+GE+VRL++++L  + LLF G   + ++  + F TKY+S  E   D   +  +   +L   L +   ++ +C+++R  C+ V+RRAA L  + +A ++NK+  NR      +T+GVDGS+++ HP
Sbjct:    2 VSGRAGQQVEQLLLEFVLDQQELEEVMHRMRREMERGLRLETHQEASVKMLPTYVRSTPDGSEVGDFLALDLGGTNFRVILVKVGQNEEGEWRVETKNELYCIPEDVMTGTAEMLFDYIAECIANYLDKLNMKHKKLPLGFTFSFPVKHVDLDKGILINWTKGFTATGAEGNNVVELLREAIKRRGDFDMDVVAMVNDTVATMISCYYEDHNTEIGMIVGTGCNTCYMEEMRNV------DLVEGDEGMCINMEWGAFGDSGELEDLRLEYDRKVDETSNNRGQQLFEKIISGKYMGELVRLLVMKLTNQGLLFGGKASEKLQTHFKFETKYVSQIESSDDGAEMKQTLNVLLG--LGLQPTEA-ECRLVRRSCQAVSRRAASLCAAGMAAVVNKIRENRSLEQLEITVGVDGSVYKLHP 412          
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000091.1 (pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.415 bits (459), Expect = 7.315e-54
Identity = 113/271 (41.70%), Postives = 170/271 (62.73%), Query Frame = 2
Query:  569 GILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVG-TGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSL-----DCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPS 1342
            G L  WTKGF A+  EGK+VV LL  A+++ N  ++   A+VNDTVGT+ +C++E P C IGLIVG TGSN CY+EDL  +  V+      +   + IN EWGAFG++G+L+DIRT+YD  +D  SL+PG+QIFEK+ISG+YLGE+VRL+LV++  + LLF G     +     F T++M         +  S E +L+   L++   SL     DC  ++  C IV+ R+AYL  +A+  +++++       +   T+GVDG++++ HP 
Sbjct:    2 GFLVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDVVAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEG-----DEGRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQFMC------VPVQRSKEGVLKARELLSDHFSLRPSEEDCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTHPQ 261          
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000092.1 (pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000092.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 1.279e-53
Identity = 114/271 (42.07%), Postives = 169/271 (62.36%), Query Frame = 2
Query:  569 GILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVG-TGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSL-----DCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPS 1342
            G L  WTKGF A+  EGK+VV LL  A+++ N  ++   A+VNDTVGT+ +C++E P C IGLIVG TGSN CY+EDL  +  V+      +   + IN EWGAFG++G+L+DIRT+YD  +D  SL+PG+QIFEK+ISG+YLGE+VRL+LV++  + LLF G     +     F T+    C R       S E +L+   L++   SL     DC  ++  C IV+ R+AYL  +A+  +++++       +   T+GVDG++++ HP 
Sbjct:    2 GFLVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDVVAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEG-----DEGRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQNPRVCRR-------SKEGVLKARELLSDHFSLRPSEEDCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTHPQ 260          
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000094.1 (pep scaffold:Pmarinus_7.0:GL478056:170806:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 1.647e-53
Identity = 114/270 (42.22%), Postives = 171/270 (63.33%), Query Frame = 2
Query:  569 GILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVG-TGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSL-----DCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHP 1339
            G L  WTKGF A+  EGK+VV LL  A+++ N  ++   A+VNDTVGT+ +C++E P C IGLIVG TGSN CY+EDL  +  V+      +   + IN EWGAFG++G+L+DIRT+YD  +D  SL+PG+QIFEK+ISG+YLGE+VRL+LV++  + LLF G     +     F T++    + D   L  S E +L+   L++   SL     DC  ++  C IV+ R+AYL  +A+  +++++       +   T+GVDG++++ HP
Sbjct:    2 GFLVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDVVAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEG-----DEGRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQFSLAIDVDI--LMRSKEGVLKARELLSDHFSLRPSEEDCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTHP 264          
BLAST of slc25a-4 vs. Ensembl Yeast
Match: HXK1 (Hexokinase isoenzyme 1; a cytosolic protein that catalyzes phosphorylation of glucose during glucose metabolism; expression is highest during growth on non-glucose carbon sources; glucose-induced repression involves hexokinase Hxk2p; HXK1 has a paralog, HXK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001949])

HSP 1 Score: 234.572 bits (597), Expect = 1.184e-71
Identity = 168/476 (35.29%), Postives = 258/476 (54.20%), Query Frame = 2
Query:   59 PGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIP-EIKMSGPGEALFDFIAETINDFLKSKKIPD--KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACY---IEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKN-----PKCEFRLKLSEDGSGKGAAAIVA 1453
            P  P+    SM       ++  ++ +E+ ++   F       R V K    ++N GL    +    + M P +V + P+GKE G ++A+DLGGTN R++LV L GN+   +  +S Y +P +++ +   E L+ FIA+++ DF+  +++ +   T+ LGFTFS+P +Q  ++ GIL RWTKGF   NVEG +VV LL   + K  L +   AL+NDTVGTL +  +  P+  +G+I GTG N  +   + D+ K+       +  N+  + IN E+G+F +N  L   RTKYD A+D+ S  PG+Q FEK+ SG YLGE++RLVL+EL EK L+ K      +++PY   T Y +  E DP      T+ + + +  V T    + K+IR  CE++  RAA LA   IA +  K    T  I  DGS++  +P F       ++          K    +  +EDGSG GAA I A
Sbjct:    6 PKKPQARKGSMA------DVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGL---TKKGGNIPMIPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTF-DTTQSKYKLPHDMRTTKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYPASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEISKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAFYDVVSDIEKLEGKLADDIPSNSP-MAINCEYGSF-DNEHLVLPRTKYDVAVDEQSPRPGQQAFEKMTSGYYLGELLRLVLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLEDTDDIFQKDFGVKTTLP-ERKLIRRLCELIGTRAARLAVCGIAAICQKRGYKTGHIAADGSVYNKYPGFKEAAAKGLRDIYGWTGDASKDPITIVPAEDGSGAGAAVIAA 468          
BLAST of slc25a-4 vs. Ensembl Yeast
Match: HXK2 (Hexokinase isoenzyme 2; phosphorylates glucose in cytosol; predominant hexokinase during growth on glucose; represses expression of HXK1, GLK1, induces expression of its own gene; antiapoptotic; phosphorylation/dephosphorylation at Ser14 by kinase Snf1p, phosphatase Glc7p-Reg1p regulates nucleocytoplasmic shuttling of Hxk2p; functions downstream of Sit4p in control of cell cycle, mitochondrial function, oxidative stress resistance, chronological lifespan; has paralog HXK1 [Source:SGD;Acc:S000003222])

HSP 1 Score: 216.468 bits (550), Expect = 9.002e-65
Identity = 152/427 (35.60%), Postives = 238/427 (55.74%), Query Frame = 2
Query:  128 IPEEVMEMMKPFR-----PSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPE-IKMSGPGEALFDFIAETINDFLKSKKIPD---KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACY------IEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSF---AAN 1354
            +P+E+M+ ++ F      P+E+  + VTK    ++  GL    +    + M P +V   P+GKE G F+A+DLGGTN R++LV L G+    +  +S Y +P+ ++ +   + L++FIA+++  F+  ++ P    + I LGFTFSFP +Q  ++ GIL RWTKGF   N+E  +VV +L   + K N+ +   AL+NDT GTL +  +  P+  +G+I GTG N  Y      IE L   L+ D    +  +  + IN E+G+F +N  +   RTKYD  +D+ S  PG+Q FEK+ SG YLGEI+RL L+++ ++  +FK        KP+   T Y +  E DP      T+ + +NE  +NT    + K+IR   E++  RAA L+   IA +  K    T  I  DGS++  +P F   AAN
Sbjct:   19 VPKELMQQIENFEKIFTVPTET-LQAVTKHFISELEKGL---SKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRTF-DTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFI-DEQFPQGISEPIPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKLQGKLSDD----IPPSAPMAINCEYGSF-DNEHVVLPRTKYDITIDEESPRPGQQTFEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARIEEDPFENLEDTDDLFQNEFGINTT-VQERKLIRRLSELIGARAARLSVCGIAAICQKRGYKTGHIAADGSVYNRYPGFKEKAAN 433          
BLAST of slc25a-4 vs. Ensembl Yeast
Match: GLK1 (Glucokinase; catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources; GLK1 has a paralog, EMI2, that arose from the whole genome duplication [Source:SGD;Acc:S000000545])

HSP 1 Score: 183.726 bits (465), Expect = 2.135e-52
Identity = 152/448 (33.93%), Postives = 229/448 (51.12%), Query Frame = 2
Query:  263 MFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGP----------GEALFDFIAETINDFLKSKKIPD--------KTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLK-VSCKALVNDTVGT-LASC----------SFEHPDCAIGLIVGTGSNACYIEDLSKVLTVD---KTALMKNAK-FIIINTEWGAFGENGTLEDIRTKYDRAMDKN-SLHPGKQIFEKLISGMYXXXX-----XXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVL------INKMNRPTVTIGVDGSLFRHHPSFAANMN---AIIKQFKNPKCEFRLKLSEDGSGKGAA--AIVA 1453
            M P++V+  P+G E+G  +A DLGGTN+RI  V L G++        T+++ ++K   P           + LF F+A     F+K K  PD        K + LGFTFS+P +Q  L+ G L RWTKGF   +  GK+VV+L    L    +  +   AL NDTVGT L+ C          S E  +  IG I GTG+N CY+E+++K+  +    +  L+K  K  +IIN EWG+F +N       TKYD  +D+  S +PG  +FEK +SGM+LGE+     V L    L+ ++   K  LP  +  P+   ++ +S  E D       TE  L   L + T  +   +I +     ++RR+AYLA   +A +      +NK     V IG DGS+  ++P F + +    A+       + +  LK+++DGSG GAA  A+VA
Sbjct:   64 MIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDH--------TFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMK-KYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSF-DNELKHLPTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQK-LVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA 500          
BLAST of slc25a-4 vs. Ensembl Yeast
Match: EMI2 (Non-essential protein of unknown function; required for transcriptional induction of the early meiotic-specific transcription factor IME1; required for sporulation; expression regulated by glucose-repression transcription factors Mig1/2p; EMI2 has a paralog, GLK1, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002924])

HSP 1 Score: 177.563 bits (449), Expect = 4.204e-50
Identity = 151/439 (34.40%), Postives = 218/439 (49.66%), Query Frame = 2
Query:  263 MFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNA----------PPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLK-VSCKALVNDTVGT-LASC--SFEHPDCA-------IGLIVGTGSNACYIEDLSKVLTVD---KTALMKNAKF-IIINTEWGAFGENGTLEDIRTKYDRAMD-KNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXX-----XXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVL------INKMNRPTVTIGVDGSLFRHHPSFAANMN---AIIKQFKNPKCEFRLKLSEDGSGKGAA--AIVA 1453
            M P+YV+ +P+G E+G  +A DLGGT++R+  VTL G+            P E +       E   S  G     F+ +   + LKS     K + +GFTFS+P +Q  L  G L RWTK F   +  GK+VV L    L    L  ++  AL NDTVGT L+ C  S   P  A       IG I GTG+N CY+ED+  +  +    +T L+   K  + IN EWG+F +N       TKYD  +D K S +PG  +FEK ISGMYLGE++R +LV+L  +     +      LP  ++ P+   ++ +S  E D       TE      L + T    + K I+     + RR+AYLA   IA +      +NK     V IG DG +  ++P F + +    A+       + +  L+L++DGSG GAA  A+VA
Sbjct:   64 MIPTYVTSLPNGTERGVLLAADLGGTHFRVCSVTLNGDGTFDMQQLKSKIPEEYLNDKDVTSEELFSYLGRRTRAFVRKHHPELLKSTGENIKPLKMGFTFSYPVDQTSLSSGTLIRWTKSFKIEDTVGKDVVRLYQEQLDIQGLSMINVVALTNDTVGTFLSHCYTSGSRPSSAGEISEPVIGCIFGTGTNGCYMEDIENIKKLPDELRTRLLHEGKTQMCINIEWGSF-DNELKHLSATKYDIDIDQKFSPNPGYHLFEKRISGMYLGELLRNILVDLHARGLILGQYRNYDQLPHRLKTPFQLCSEVLSRIEIDDSTNLRETELSFLQSLRLPTTFE-ERKAIQNLVRSITRRSAYLAAVPIAAILIKTNALNKRYHGEVEIGFDGYVIEYYPGFRSMLRHALALSPIGTEGERKIHLRLAKDGSGVGAALCALVA 500          
BLAST of slc25a-4 vs. Ensembl Yeast
Match: YLR446W_mRNA (Putative hexokinase; transcript is upregulated during sporulation and the unfolded protein response; YLR446W is not an essential gene [Source:SGD;Acc:S000004438])

HSP 1 Score: 50.8322 bits (120), Expect = 2.854e-7
Identity = 55/222 (24.77%), Postives = 101/222 (45.50%), Query Frame = 2
Query:  305 KGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETI------NDFLKSKKIPDKT--ISLGFTFSFPCNQKGLDVGILTRWTKGFSATN-VEGKNVVELLGVALKKL---NLK-----VSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMK-----------NAKFIIINTEWGAFGEN 886
            + + + +D GGT  +  +++L     P  +IE   A  E+  +      F+ I  TI      N ++K K    +     +  TFSFP N +G  V +     KGF  T+ ++G  V +L+  +  ++   N++     ++   ++ND +    +  F   + +I LI+GTG+NAC+      +    + AL +           N K ++IN+E G  G+N
Sbjct:   59 EDKILTIDFGGTRLKFAIISL-----PQIVIEYNDAF-ELTYNIVDSNFFNQIIYTICTRLAANGYIKKKNESSEASKFFVSVTFSFPLNPEGEVVAM----GKGFVMTDTLQGSTVKQLIQSSFHRIISENIEEFFCTMNVCHVINDAIAVSLTSKFICENDSISLIIGTGTNACFEVPYGYLPPFKRDALRETLPSSYNKETLNFKHVLINSEIGFIGKN 270          
BLAST of slc25a-4 vs. Ensembl Nematostella
Match: EDO43108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ9])

HSP 1 Score: 306.99 bits (785), Expect = 6.452e-100
Identity = 178/410 (43.41%), Postives = 255/410 (62.20%), Query Frame = 2
Query:  209 LDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLN-LKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKG 1435
            +D  +  DP  R+ + +KM P+YV ++P G E G F+ALDLGGTN+R+LLV +   N    +    + + +  M+     LFD+IA+ I  F+K K + DKT+ LGFTFSFP  Q  L  G+L RWTKGFSA  VEG++VV LL  AL + N   V   ALVNDT GT+ +C F+  +   GLI+GTG+NACY+E L  V   ++     N   +IINTEWGAFG++G L  I T++D+ +D  S++PG+Q+FEK+ISGMYLGE+ R + ++LI + LL  G   + ++   SFLTK++SD E    +     + +L+ EL V    + D +I+R+ C  V++RAA LA + +A ++ K      TI +DG+LF+ HP F   M   +K+   P    +L LSEDGSGKG
Sbjct:    1 MDNGLSADPKARENSPIKMLPTYVRRMPDGSESGDFLALDLGGTNFRVLLVQVL--NGKVHMESEIFPLDQTLMTSDSITLFDYIADCITLFVKKKSLQDKTLPLGFTFSFPVQQLSLTSGLLIRWTKGFSAGGVEGEDVVRLLKDALHRKNSHSVDVVALVNDTTGTMMACGFDDRNVIAGLILGTGTNACYMESLDNVKKWNEERGCSNE--VIINTEWGAFGDSGVLNWIITEHDKKIDVESINPGQQVFEKMISGMYLGELARHICMDLIHRGLLLNGIASNKLKTKGSFLTKFVSDIESGDEN---KLQQVLK-ELDVKAT-ARDQEILRHICTAVSKRAARLASAGLATIVKKTKAYNSTIAIDGTLFKKHPKFKPYMQEALKELL-PDSHLKLMLSEDGSGKG 400          
BLAST of slc25a-4 vs. Ensembl Nematostella
Match: EDO26338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC96])

HSP 1 Score: 51.6026 bits (122), Expect = 7.144e-9
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  173 ESNYRNVTKRLELDMNMGL--DPAHRDKACVKMFPSYVSKVPSGKEKGQFMALD 328
            +S+   V K LE DM+ GL  DP  R+ + +KM P+YV ++P G E G F+ALD
Sbjct:    3 KSSLEQVMKLLEEDMDNGLSADPKARENSPIKMLPTYVRRMPDGSESGDFLALD 56          
BLAST of slc25a-4 vs. Ensembl Medaka
Match: HK1 (hexokinase-1 [Source:NCBI gene;Acc:101157032])

HSP 1 Score: 352.058 bits (902), Expect = 3.856e-111
Identity = 199/447 (44.52%), Postives = 284/447 (63.53%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALK-KLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++ + +  FR ++S    V KR+++++  GL      +A VKM P++V + P G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    +    + LGFTFSFPC+Q  LD GIL  WTKGF AT+ EG++VVELL  A+K K   ++   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  + TV  T        + +N EWGAFG+NG L+DIRTKYD+A+D+NSL+ GKQ +EK+ SGMYLGEIVR +L++L ++  LF+G + + ++    F TK++S  E D   L      +L+   L +T D  D  I++  C  V+RRAA + G+ +A +++K      ++   VT+GVDG+L++ HP F+      +K+   PKC+    LSEDGSGKGAA I A
Sbjct:  469 QIQQTLAEFRLNKSQLLEVKKRMKVEIERGLRKETHKEATVKMLPTFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRSVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGFTFSFPCHQTSLDAGILVNWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVPGT-----EGRMCVNMEWGAFGDNGCLDDIRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRAILQQLGLDSTCD--DSIIVKEVCGTVSRRAAQICGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSRIFLQTVKELA-PKCDVNFLLSEDGSGKGAALITA 906          

HSP 2 Score: 319.316 bits (817), Expect = 7.536e-99
Identity = 179/439 (40.77%), Postives = 273/439 (62.19%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMN------RPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
             R S+   +++  R   +M  GL       A VKM P++V  +P G EKG F+ALDLGG+N+RIL V +  +   P  +ES  Y  P+  + G G  LFD +AE + DF++ +KI DK + +GFTFSFPC Q  LD  +L  WTK F A+ VEG +VV+LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + INTEWGAFG++G+LED+RT++DR +D+ S++PGKQ+FEK++SGMY+GE+VRL+LV++ ++ LLF+G +   +       TK++S  E+    L    E + R  L V   D  DC  +++ C IV+ R+A L  + +  ++ ++       R   T+G+DGSL++ HP +A  ++  +++   P  + R  LSE GSGKGAA + A
Sbjct:   29 MRFSDDTLKDIMNRYRREMESGLGRDTNATATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQAYDTPDDIIHGSGTQLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKKFKASGVEGMDVVKLLNKAIKKRGDYQADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVE-----GDEGRMCINTEWGAFGDDGSLEDLRTEFDREIDRGSMNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKIETKHVSAIEKSKEGLKKCMEILTR--LGVEPSDE-DCLAVQHVCTIVSFRSANLISATLGAILCRLKDNKGVARLRTTVGIDGSLYKMHPQYARRLHKTVRRLV-PDSDVRFLLSESGSGKGAAMVTA 458          
BLAST of slc25a-4 vs. Ensembl Medaka
Match: hk1 (hexokinase-1 [Source:NCBI gene;Acc:101156878])

HSP 1 Score: 348.977 bits (894), Expect = 5.779e-110
Identity = 197/449 (43.88%), Postives = 283/449 (63.03%), Query Frame = 2
Query:  134 EEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLK-GNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM--NRPT----VTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
            +++++++  FR +      V  R+ +++  GL     D A VKM P++V   P+G E G F+ALDLGGTN+R+LLV ++ G     E+    YAIP   M G GE LFD I   I+DFL    + +  + LGFTFSFPC Q  LD G L  WTKGF AT+ EG++VV LL  A+K+    ++   A+VNDTVGT+ +C++E P C +GLI GTGSNACY+E++  V  VD      +   + +N EWGAFG+NG L+D+RT+YDRA+D  SL+PGKQ +EK+ SGMYLGEIVR +L+++ +K  LF+G + + ++    F TK++S  E D   L      +L++  L +T D  D  I++  C IV+RRAA L G+ +A +++K+  NR      +T+GVDG+L++ HP F+  M+  + +   PKC     LSEDGSGKGAA I A 
Sbjct:  468 KQIVQILSEFRLTTEQLLEVKNRMRVEIQNGLSKRTHDSATVKMLPTFVQSTPNGTEHGDFLALDLGGTNFRVLLVKIRSGKKRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGFTFSFPCKQTSLDAGTLVTWTKGFKATDCEGEDVVGLLREAIKRREEFELDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNVEMVD-----GDEGQMCVNMEWGAFGDNGCLDDMRTEYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLAL-LQVRSILQHLGLDSTCD--DSIIVKEVCGIVSRRAAQLCGAGMAAVVDKIRENRGVDHLNITVGVDGTLYKLHPHFSGIMHQTVNELA-PKCSVNFLLSEDGSGKGAALITAV 907          

HSP 2 Score: 308.145 bits (788), Expect = 1.385e-94
Identity = 173/440 (39.32%), Postives = 267/440 (60.68%), Query Frame = 2
Query:  161 FRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIES-TYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKL-NLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKM------NRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAA 1456
             R S+    ++T R  +++  GL       A +KM P++V  +P G EKG F+ALDLGG+ +RIL V +         +ES  +  PE  + G G  LFD +AE +  F++   I DK + +GFTFSFPC Q  LD G L  WTK F A+ VEG +VV LL  A+KK  + +    A+VNDTVGT+ +C F+   C +G+I+GTG+NACY+E+L  +  V+      +   + +NTEWGAFG++G LEDIRT++DR +D+ SL+PGKQ+FEK++SG+Y+GE+VRL+LV++  + LLF+G +   M     F TK++S  E+    L  + + + +   L     + DC  +++ C IV+ R+A L  + +A ++ ++       R   T+G+DGSL++ HP ++  ++  +++   P C+ R  LS  GSGKGAA + A 
Sbjct:   29 MRFSDETLLDITNRFRMELVKGLGRDTNATASLKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIFDTPEDIIHGTGTQLFDHVAECLGTFMEKHNIKDKKLPVGFTFSFPCQQAKLDEGYLITWTKSFKASGVEGMDVVNLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVE-----GDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAREGLLFEGQITPEMLTKGKFETKHVSAIEKSKEGLTKARDVLSK---LGVEPSADDCVAVQHICSIVSHRSANLVAAVLAGILMRLKENKGVGRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLV-PDCDVRFLLSNSGSGKGAAMVTAV 459          
BLAST of slc25a-4 vs. Ensembl Medaka
Match: ENSORLT00000036782.1 (hexokinase-2 [Source:NCBI gene;Acc:101165960])

HSP 1 Score: 333.569 bits (854), Expect = 4.365e-109
Identity = 195/466 (41.85%), Postives = 298/466 (63.95%), Query Frame = 2
Query:   80 LSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLV-TLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            L + G  G + ++++Q    V + ++PFR S    ++V+ RL  DM  GL      +A VKM P++V   P G EKG F+ALDLGGTN+R+L V  L+      ++     AIP+  M G GE LFD IA  + +FL S+K+  +T+ LGFTFSFPC QK +D  IL RWTKGF+ + VEG++VV LL  A+ ++ +  +S  A+VNDTVGT+ SC +    C IG+I+GTG+NACY+E++  V  V+     ++ + + INTEWG FG++G L+D+ T++D  +DK S++PG   FEK+ISGMYLGEIVRLVL++L E+KLLF+G   +A+  P SF T+++S+ E     L  + + + + +L  + +D+    + R  C+ V+ R+A L  +A+A ++N+      ++    T+GVDG+++R HP+F+  + A ++    PKC+    +SEDGSGKGAA + A
Sbjct:    8 LVNQGPFGSELSLTLQ----VQKHLEPFRLSLEKLQDVSARLRKDMIRGLGKHSHHRASVKMLPTFVRATPDGTEKGDFLALDLGGTNFRVLHVRVLEEEQRVLKMDSQICAIPQDIMLGTGEKLFDHIAACLAEFLDSQKLRGQTLPLGFTFSFPCEQKEIDKSILIRWTKGFNCSGVEGEDVVNLLKEAIHRRGDYDISSVAMVNDTVGTMMSCGYRDQSCEIGMIIGTGTNACYMEEMKNVKRVEG----EDGR-MCINTEWGGFGDDGCLKDVLTEFDEEVDKTSINPGVHTFEKMISGMYLGEIVRLVLLKLTEEKLLFRGCPSEALLTPGSFETRFISEIEEPDSGLENAKKILTKLDLDWDLVDAC---VARLVCDTVSSRSARLCAAALATIVNRIRINRGLDHLKTTVGVDGTVYRKHPNFSDELQAAVRLLA-PKCDVTFLISEDGSGKGAAMVTA 460          
BLAST of slc25a-4 vs. Ensembl Medaka
Match: ENSORLT00000042254.1 (hexokinase-2 [Source:NCBI gene;Acc:101165960])

HSP 1 Score: 333.954 bits (855), Expect = 4.965e-109
Identity = 191/447 (42.73%), Postives = 289/447 (64.65%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLV-TLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            +V + ++PFR S    ++V+ RL  DM  GL      +A VKM P++V   P G EKG F+ALDLGGTN+R+L V  L+      ++     AIP+  M G GE LFD IA  + +FL S+K+  +T+ LGFTFSFPC QK +D  IL RWTKGF+ + VEG++VV LL  A+ ++ +  +S  A+VNDTVGT+ SC +    C IG+I+GTG+NACY+E++  V  V+     ++ + + INTEWG FG++G L+D+ T++D  +DK S++PG   FEK+ISGMYLGEIVRLVL++L E+KLLF+G   +A+  P SF T+++S+ E     L  + + + + +L  + +D+    + R  C+ V+ R+A L  +A+A ++N+      ++    T+GVDG+++R HP+F+  + A ++    PKC+    +SEDGSGKGAA + A
Sbjct:   23 QVQKHLEPFRLSLEKLQDVSARLRKDMIRGLGKHSHHRASVKMLPTFVRATPDGTEKGDFLALDLGGTNFRVLHVRVLEEEQRVLKMDSQICAIPQDIMLGTGEKLFDHIAACLAEFLDSQKLRGQTLPLGFTFSFPCEQKEIDKSILIRWTKGFNCSGVEGEDVVNLLKEAIHRRGDYDISSVAMVNDTVGTMMSCGYRDQSCEIGMIIGTGTNACYMEEMKNVKRVEG----EDGR-MCINTEWGGFGDDGCLKDVLTEFDEEVDKTSINPGVHTFEKMISGMYLGEIVRLVLLKLTEEKLLFRGCPSEALLTPGSFETRFISEIEEPDSGLENAKKILTKLDLDWDLVDAC---VARLVCDTVSSRSARLCAAALATIVNRIRINRGLDHLKTTVGVDGTVYRKHPNFSDELQAAVRLLA-PKCDVTFLISEDGSGKGAAMVTA 460          
BLAST of slc25a-4 vs. Ensembl Medaka
Match: ENSORLT00000024342.2 (hexokinase-2 [Source:NCBI gene;Acc:101165960])

HSP 1 Score: 333.569 bits (854), Expect = 6.248e-109
Identity = 191/447 (42.73%), Postives = 289/447 (64.65%), Query Frame = 2
Query:  137 EVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLV-TLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVAL-KKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINK------MNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            +V + ++PFR S    ++V+ RL  DM  GL      +A VKM P++V   P G EKG F+ALDLGGTN+R+L V  L+      ++     AIP+  M G GE LFD IA  + +FL S+K+  +T+ LGFTFSFPC QK +D  IL RWTKGF+ + VEG++VV LL  A+ ++ +  +S  A+VNDTVGT+ SC +    C IG+I+GTG+NACY+E++  V  V+     ++ + + INTEWG FG++G L+D+ T++D  +DK S++PG   FEK+ISGMYLGEIVRLVL++L E+KLLF+G   +A+  P SF T+++S+ E     L  + + + + +L  + +D+    + R  C+ V+ R+A L  +A+A ++N+      ++    T+GVDG+++R HP+F+  + A ++    PKC+    +SEDGSGKGAA + A
Sbjct:   27 QVQKHLEPFRLSLEKLQDVSARLRKDMIRGLGKHSHHRASVKMLPTFVRATPDGTEKGDFLALDLGGTNFRVLHVRVLEEEQRVLKMDSQICAIPQDIMLGTGEKLFDHIAACLAEFLDSQKLRGQTLPLGFTFSFPCEQKEIDKSILIRWTKGFNCSGVEGEDVVNLLKEAIHRRGDYDISSVAMVNDTVGTMMSCGYRDQSCEIGMIIGTGTNACYMEEMKNVKRVEG----EDGR-MCINTEWGGFGDDGCLKDVLTEFDEEVDKTSINPGVHTFEKMISGMYLGEIVRLVLLKLTEEKLLFRGCPSEALLTPGSFETRFISEIEEPDSGLENAKKILTKLDLDWDLVDAC---VARLVCDTVSSRSARLCAAALATIVNRIRINRGLDHLKTTVGVDGTVYRKHPNFSDELQAAVRLLA-PKCDVTFLISEDGSGKGAAMVTA 464          
BLAST of slc25a-4 vs. Planmine SMEST
Match: SMESG000034286.1 (SMESG000034286.1)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 476/477 (99.79%), Postives = 477/477 (100.00%), Query Frame = 2
Query:   32 SDDMDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 1462
            +DDMDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS
Sbjct:   55 NDDMDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVAAHS 531          
BLAST of slc25a-4 vs. Planmine SMEST
Match: SMESG000043559.1 (SMESG000043559.1)

HSP 1 Score: 479.945 bits (1234), Expect = 8.609e-167
Identity = 250/445 (56.18%), Postives = 322/445 (72.36%), Query Frame = 2
Query:  125 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTV--DKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYXXXXXXXXXXXXXXXXXXXXGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 1453
            ++P+EV+E+++PF     +YR V   LE  MN GL  A  D A VKMFPSYV+K+P+GKE+GQF+ALDLGGTNYR+LLV+LK  N  P+IIE+TYAIP  KM G G+ LFD+IA+T+ DF+K   +    I+LGFTFSFPC+Q GL+   L RWTKGFSAT+ EG+NV ELL  A+  LNL V C A+VNDTVGTL SC+ +   C +G+IVGTG+NA Y+E + KV T   DKT L     +++IN EWGAFGE+G L+  RT+YD  +D+ SLHP +QIFEK+ SGMYLGE+VR++LV+L+ K LLF+G +P ++  P SF TKY+S+ ERDPPHL Y T YML  +L V + +  D  I+R  CE VA RAAY  GS IA L+N++N+  +T+G+DGSLF+ H  F   M  I+ Q KN   +F LKLSEDGSGKGAAAI A
Sbjct:    4 RLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLK-QNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGL----DYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 443          
The following BLAST results are available for this feature:
BLAST of slc25a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HK15.328e-10944.64hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK15.459e-10944.64hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK17.384e-10944.64hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK17.384e-10944.64hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK17.384e-10944.64hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
back to top
BLAST of slc25a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hxk-12.654e-11341.43Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-11.191e-11142.06Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-11.191e-11142.06Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-23.099e-9038.68Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-36.659e-7834.38Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:U... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hex-t22.908e-11844.47gene:FBgn0042710 transcript:FBtr0085011[more]
Hex-A4.976e-11544.32gene:FBgn0001186 transcript:FBtr0333335[more]
Hex-A4.976e-11544.32gene:FBgn0001186 transcript:FBtr0071362[more]
Hex-A5.663e-11444.42gene:FBgn0001186 transcript:FBtr0071361[more]
Hex-C2.757e-11140.09gene:FBgn0001187 transcript:FBtr0087399[more]
back to top
BLAST of slc25a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk13.433e-10843.62hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hk12.234e-10743.62hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hk12.234e-10743.62hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hk21.582e-10643.18hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017... [more]
hk22.070e-10643.18hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk19.737e-11244.52hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk14.173e-11144.52hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk11.078e-11044.52hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk13.891e-10944.42hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk16.763e-10944.42hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
back to top
BLAST of slc25a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hk17.428e-10844.64hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103][more]
Hk28.064e-10844.80hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197][more]
Hk11.144e-10744.64hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103][more]
Hk21.354e-10744.80hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197][more]
Hk12.349e-10744.64hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103][more]
back to top
BLAST of slc25a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26609|HXK_SCHMA4.032e-16354.28Hexokinase OS=Schistosoma mansoni OX=6183 PE=1 SV=... [more]
sp|Q9NFT7|HXK2_DROME2.915e-11744.47Hexokinase type 2 OS=Drosophila melanogaster OX=72... [more]
sp|P05708|HXK1_RAT1.038e-10844.87Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 ... [more]
sp|P19367|HXK1_HUMAN2.622e-10844.64Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 S... [more]
sp|Q5RC71|HXK1_PONAB2.826e-10744.42Hexokinase-1 OS=Pongo abelii OX=9601 GN=HK1 PE=2 S... [more]
back to top
BLAST of slc25a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFE00.000e+0100.00Phosphotransferase OS=Schmidtea mediterranea OX=79... [more]
G4VIV91.195e-16054.28Phosphotransferase OS=Schistosoma mansoni OX=6183 ... [more]
C1L5D07.948e-16055.16Phosphotransferase OS=Schistosoma japonicum OX=618... [more]
A0A4Z2DGI92.028e-15955.16Phosphotransferase OS=Schistosoma japonicum OX=618... [more]
C1LHK92.985e-15854.93Phosphotransferase OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk11.417e-11244.42hexokinase 1 [Source:NCBI gene;Acc:103028521][more]
hk12.060e-11244.42hexokinase 1 [Source:NCBI gene;Acc:103028521][more]
hkdc18.064e-10843.65hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
hkdc18.482e-10843.65hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
hkdc11.003e-10743.65hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008354.16.563e-10442.00pep scaffold:Pmarinus_7.0:GL478372:35293:41413:-1 ... [more]
gck2.347e-9440.48glucokinase (hexokinase 4) [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000000091.17.315e-5441.70pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-... [more]
ENSPMAT00000000092.11.279e-5342.07pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-... [more]
ENSPMAT00000000094.11.647e-5342.22pep scaffold:Pmarinus_7.0:GL478056:170806:181090:-... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HXK11.184e-7135.29Hexokinase isoenzyme 1; a cytosolic protein that c... [more]
HXK29.002e-6535.60Hexokinase isoenzyme 2; phosphorylates glucose in ... [more]
GLK12.135e-5233.93Glucokinase; catalyzes the phosphorylation of gluc... [more]
EMI24.204e-5034.40Non-essential protein of unknown function; require... [more]
YLR446W_mRNA2.854e-724.77Putative hexokinase; transcript is upregulated dur... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO431086.452e-10043.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263387.144e-946.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HK13.856e-11144.52hexokinase-1 [Source:NCBI gene;Acc:101157032][more]
hk15.779e-11043.88hexokinase-1 [Source:NCBI gene;Acc:101156878][more]
ENSORLT00000036782.14.365e-10941.85hexokinase-2 [Source:NCBI gene;Acc:101165960][more]
ENSORLT00000042254.14.965e-10942.73hexokinase-2 [Source:NCBI gene;Acc:101165960][more]
ENSORLT00000024342.26.248e-10942.73hexokinase-2 [Source:NCBI gene;Acc:101165960][more]
back to top
BLAST of slc25a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000034286.10.000e+099.79SMESG000034286.1[more]
SMESG000043559.18.609e-16756.18SMESG000043559.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030267
GenBankAKN21572.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030267 ID=SMED30030267|Name=slc25a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1558bp
ATTTAATACGATAATAAGTTATCGCTAAAGCAGTGACGACATGGATCAGT
TGAATGAGCCGGGAAATCCTCGGAATTCTCTTTCGAGCATGGGAGTTTTG
GGAATCAAAGAAAATATCAGTGTCCAAATCCCCGAAGAAGTAATGGAGAT
GATGAAACCTTTCAGGCCTTCAGAATCTAATTATCGAAACGTTACAAAAC
GGTTGGAGCTTGATATGAATATGGGGTTGGACCCTGCTCACAGAGATAAG
GCATGCGTTAAAATGTTCCCATCGTATGTTTCAAAAGTTCCTTCAGGAAA
AGAAAAAGGACAATTCATGGCTCTCGATCTTGGAGGAACCAACTATCGTA
TTTTGCTGGTAACATTGAAAGGAAATAACGCCCCGCCAGAAATCATTGAA
TCTACGTATGCGATTCCTGAAATTAAAATGTCAGGACCCGGAGAAGCGTT
ATTTGATTTTATTGCCGAAACGATAAATGATTTCTTAAAATCGAAAAAAA
TCCCGGATAAAACTATCTCACTCGGATTCACATTTTCTTTTCCATGCAAT
CAAAAAGGACTTGATGTGGGAATTTTGACTCGCTGGACAAAAGGGTTTTC
TGCGACAAATGTCGAAGGGAAAAATGTAGTGGAATTATTAGGAGTTGCCT
TAAAGAAATTGAATTTAAAAGTGTCATGTAAAGCGTTGGTGAACGATACT
GTTGGAACTTTAGCATCGTGTTCGTTCGAGCATCCTGATTGTGCAATCGG
GCTTATAGTCGGAACCGGATCAAATGCATGTTACATAGAGGATCTCAGCA
AAGTTCTCACGGTTGACAAAACAGCCCTAATGAAAAATGCAAAATTCATC
ATAATTAACACGGAATGGGGTGCATTTGGCGAGAACGGCACTCTCGAGGA
TATTCGAACGAAATATGATCGGGCAATGGATAAAAACAGTTTGCATCCCG
GAAAGCAGATATTTGAAAAATTGATTTCTGGAATGTATTTAGGAGAAATT
GTCAGACTCGTTTTGGTTGAGTTGATAGAAAAAAAGTTGTTATTTAAAGG
CAATTTACCGGACGCAATGAGAAAACCATATTCGTTTTTGACCAAATATA
TGTCAGATTGTGAAAGGGATCCACCTCATCTGCATTACAGTACAGAATAC
ATGCTACGAAATGAACTACTAGTAAATACGATAGATTCTCTAGATTGCAA
AATTATAAGATATTGCTGTGAAATAGTTGCAAGACGAGCAGCTTACTTGG
CAGGATCAGCCATTGCTGTATTAATAAATAAAATGAATAGGCCAACAGTT
ACAATAGGAGTCGACGGGTCATTGTTTCGCCATCATCCAAGTTTCGCCGC
AAACATGAACGCCATTATTAAACAATTCAAAAATCCTAAATGTGAGTTCC
GTTTGAAACTATCTGAAGACGGCAGTGGCAAAGGAGCTGCAGCAATTGTA
GCTGCTCATTCATTTTAACCCTTTTTTCAGATTCATTTTTGATTTTTTAA
ATTTTATTTATTTATTATTTTTTTAAATAAACTTTTCACATTTTTGTTTG
AAAAAGAA
back to top

protein sequence of SMED30030267-orf-1

>SMED30030267-orf-1 ID=SMED30030267-orf-1|Name=SMED30030267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MDQLNEPGNPRNSLSSMGVLGIKENISVQIPEEVMEMMKPFRPSESNYRN
VTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGT
NYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLK
SKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELL
GVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIE
DLSKVLTVDKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNS
LHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFL
TKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRA
AYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPK
CEFRLKLSEDGSGKGAAAIVAAHSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR022672Hexokinase_N
IPR022673Hexokinase_C
IPR019807Hexokinase_BS
IPR001312Hexokinase
Vocabulary: molecular function
TermDefinition
GO:0016773phosphotransferase activity, alcohol group as acceptor
GO:0005524ATP binding
GO:0004396hexokinase activity
GO:0005536glucose binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006096glycolytic process
GO:0046835carbohydrate phosphorylation
GO:0001678cellular glucose homeostasis
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00475HEXOKINASEcoord: 93..109
score: 63.89
coord: 213..229
score: 53.21
coord: 306..328
score: 63.5
coord: 389..411
score: 37.21
coord: 236..250
score: 71.32
coord: 456..472
score: 60.47
coord: 161..186
score: 66.46
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 78..469
e-value: 5.4E-163
score: 544.3
NoneNo IPR availableGENE3DG3DSA:3.40.367.20coord: 51..459
e-value: 5.4E-163
score: 544.3
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 93..251
e-value: 6.06423E-13
score: 65.3027
IPR022673Hexokinase, C-terminalPFAMPF03727Hexokinase_2coord: 235..471
e-value: 3.3E-81
score: 272.3
IPR022672Hexokinase, N-terminalPFAMPF00349Hexokinase_1coord: 34..229
e-value: 1.9E-61
score: 207.4
IPR001312HexokinasePANTHERPTHR19443HEXOKINASEcoord: 36..472
IPR001312HexokinasePROSITEPS51748HEXOKINASE_2coord: 28..471
score: 49.295
IPR019807Hexokinase, binding sitePROSITEPS00378HEXOKINASE_1coord: 161..186
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 33..232
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 233..472