SUN domain-containing protein 2

Overview
NameSUN domain-containing protein 2
Smed IDSMED30030263
Length (bp)3054
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SUN domain-containing protein 2 (SMED30030263) t-SNE clustered cells

Violin plots show distribution of expression levels for SUN domain-containing protein 2 (SMED30030263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SUN domain-containing protein 2 (SMED30030263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SUN domain-containing protein 2 (SMED30030263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30030263SMESG000019736.1 SmedASXL_015558SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30030263SMESG000019736.1 Contig7454newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030263SMESG000019736.1 Contig7454uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 196.823 bits (499), Expect = 5.816e-52
Identity = 85/188 (45.21%), Postives = 132/188 (70.21%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ-MDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV  +VK AL  ++ D++G+ D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG FTY  D  P+QTF+ Q   M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  527 QVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGE 714          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 196.823 bits (499), Expect = 5.816e-52
Identity = 85/188 (45.21%), Postives = 132/188 (70.21%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ-MDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV  +VK AL  ++ D++G+ D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG FTY  D  P+QTF+ Q   M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  527 QVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGE 714          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18587])

HSP 1 Score: 195.282 bits (495), Expect = 6.428e-52
Identity = 89/192 (46.35%), Postives = 129/192 (67.19%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTF-YIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q R +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +VV+LS  I   + +++HIPK++SP+ +I SA +DF +  L NE  + G  LG FTY  D   +Q F  ++   DT F  +EL + SN+G+ +YTC+YR RVHG+ +K
Sbjct:  443 QARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK 634          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 196.823 bits (499), Expect = 8.633e-52
Identity = 85/188 (45.21%), Postives = 132/188 (70.21%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ-MDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV  +VK AL  ++ D++G+ D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG FTY  D  P+QTF+ Q   M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  548 QVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGE 735          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18587])

HSP 1 Score: 195.667 bits (496), Expect = 1.296e-51
Identity = 89/192 (46.35%), Postives = 129/192 (67.19%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTF-YIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q R +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +VV+LS  I   + +++HIPK++SP+ +I SA +DF +  L NE  + G  LG FTY  D   +Q F  ++   DT F  +EL + SN+G+ +YTC+YR RVHG+ +K
Sbjct:  519 QARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK 710          
BLAST of SUN domain-containing protein 2 vs. Ensembl Celegans
Match: unc-84 (Nuclear migration and anchoring protein unc-84 [Source:UniProtKB/Swiss-Prot;Acc:Q20745])

HSP 1 Score: 140.584 bits (353), Expect = 1.388e-33
Identity = 73/181 (40.33%), Postives = 110/181 (60.77%), Query Frame = 3
Query: 2433 DKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQ---PSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTS--LGNFTYLIDSNPVQTFYIQNQMD--TKFIELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            DK G  D+ALES+GG + +TRC+ETY         + IP+     SPR +IQ    SL PGECW  + SRG + V+LS  I ++S+S +HI   ++P  +  SA +   + A   + D + +   +G++TY +D  P+Q F  +++ D   KF+EL V SNYG   +TC+YRLRVHGK+++
Sbjct:  932 DKTGKVDYALESSGGAVVSTRCSETYKSYTRLEKFWDIPIYYFHYSPRVVIQRNSKSLFPGECWCFKESRGYIAVELSHFIDVSSISYEHIGSEVAPEGNRSSAPKGVLVWAY-KQIDDLNSRVLIGDYTYDLDGPPLQFFLAKHKPDFPVKFVELEVTSNYG-APFTCLYRLRVHGKVVQ 1110          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335513)

HSP 1 Score: 187.963 bits (476), Expect = 1.051e-48
Identity = 84/194 (43.30%), Postives = 131/194 (67.53%), Query Frame = 3
Query: 2376 VRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTK----FIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +R  +VRQ+VK  L ++ ADK G+ DFALESAGG I +TRCTE+Y  +++ I++FGIPL   TN+PR  I P++ PGECW  +G  G +V++L++ + +T  +++HIPKS+SP+  I+SA ++F +  L  E D+     G++ +  +   +Q F +QN +D K     +EL + +N+G+  YTC+YR RVHGK
Sbjct:  685 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQN-LDIKRPYEIVELRIETNHGHPTYTCLYRFRVHGK 877          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335514)

HSP 1 Score: 187.963 bits (476), Expect = 1.720e-48
Identity = 84/194 (43.30%), Postives = 131/194 (67.53%), Query Frame = 3
Query: 2376 VRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTK----FIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +R  +VRQ+VK  L ++ ADK G+ DFALESAGG I +TRCTE+Y  +++ I++FGIPL   TN+PR  I P++ PGECW  +G  G +V++L++ + +T  +++HIPKS+SP+  I+SA ++F +  L  E D+     G++ +  +   +Q F +QN +D K     +EL + +N+G+  YTC+YR RVHGK
Sbjct:  769 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQN-LDIKRPYEIVELRIETNHGHPTYTCLYRFRVHGK 961          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335512)

HSP 1 Score: 187.963 bits (476), Expect = 1.720e-48
Identity = 84/194 (43.30%), Postives = 131/194 (67.53%), Query Frame = 3
Query: 2376 VRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTK----FIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +R  +VRQ+VK  L ++ ADK G+ DFALESAGG I +TRCTE+Y  +++ I++FGIPL   TN+PR  I P++ PGECW  +G  G +V++L++ + +T  +++HIPKS+SP+  I+SA ++F +  L  E D+     G++ +  +   +Q F +QN +D K     +EL + +N+G+  YTC+YR RVHGK
Sbjct:  769 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQN-LDIKRPYEIVELRIETNHGHPTYTCLYRFRVHGK 961          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: spag4 (gene:FBgn0032368 transcript:FBtr0340563)

HSP 1 Score: 75.8702 bits (185), Expect = 1.442e-14
Identity = 39/130 (30.00%), Postives = 76/130 (58.46%), Query Frame = 3
Query: 2562 TNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNP-VQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            TN P  +I+  L+PG C+   GSR  V + L+  I + ++++ H+ + ++P   + SA ++F++  L +E  K    LG ++Y   +N   Q++ +++    + ++   NSN+G  + TCIYR+ V+G+L
Sbjct:  148 TNPPVNMIRTGLSPGSCFGFNGSRATVTLHLARTIIVEAITLTHVAREMTPDLCVKSAPKNFDVYGLRSENSKR-ELLGQWSYDNAANKRTQSYSVRSDTFFRNLDFSFNSNHG-ANSTCIYRVEVYGRL 275          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: si:dkey-92f12.2 (si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-379])

HSP 1 Score: 199.134 bits (505), Expect = 7.464e-54
Identity = 88/193 (45.60%), Postives = 132/193 (68.39%), Query Frame = 3
Query: 2370 ACVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
                I  V+++V  A++L+ AD +G+ D+ALES+G ++  TRC+ETY  R++ +++FGIPL   + SPRT+IQP L PG+CW  RGS+G +V+ LS  + IT V+++HIPK +SP+  +DSA +DF +  ++NET+  G  LG F Y  D  P+QTF +    D    +EL V SN+G+ +YTC+YR RVHG+
Sbjct:  382 GAATIQDVKEIVHRAISLYRADGIGLADYALESSGASVLNTRCSETYKTRSACLSLFGIPLWYHSESPRTVIQPELYPGKCWAFRGSQGFLVISLSYPVAITHVTLEHIPKDLSPTGRLDSAPKDFSVYGVSNETED-GKLLGTFIYDQDGEPIQTFKLPEVSDVYSMVELRVLSNWGHLEYTCVYRFRVHGE 573          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 186.422 bits (472), Expect = 7.411e-50
Identity = 82/188 (43.62%), Postives = 126/188 (67.02%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL L++ D+ G  D+ALES GG++ +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +V++LS ++      ++HIPKS+SPS +I SA + F +  L +E    G  LG++TY  D + +Q F +  + D  F  IE+ V SN+G+ +YTC+YR RVHGK
Sbjct:  344 QVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHGK 531          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 186.037 bits (471), Expect = 4.718e-48
Identity = 82/188 (43.62%), Postives = 126/188 (67.02%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL L++ D+ G  D+ALES GG++ +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +V++LS ++      ++HIPKS+SPS +I SA + F +  L +E    G  LG++TY  D + +Q F +  + D  F  IE+ V SN+G+ +YTC+YR RVHGK
Sbjct:  658 QVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHGK 845          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 186.422 bits (472), Expect = 4.739e-48
Identity = 82/188 (43.62%), Postives = 126/188 (67.02%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL L++ D+ G  D+ALES GG++ +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +V++LS ++      ++HIPKS+SPS +I SA + F +  L +E    G  LG++TY  D + +Q F +  + D  F  IE+ V SN+G+ +YTC+YR RVHGK
Sbjct:  668 QVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHGK 855          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: zgc:152977 (zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353])

HSP 1 Score: 185.652 bits (470), Expect = 7.331e-48
Identity = 78/187 (41.71%), Postives = 130/187 (69.52%), Query Frame = 3
Query: 2391 VRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            V+ +V  A+ L++ D++GM D+ALES GG+I +TRC+E++  + + +++FG+PL   + SPR +IQP ++PG CW  +GS G +V+ LS +I  T+ +++H+ KS+SP+ +I SA ++F +  L +E  + G  LG + Y  D + +QTF + +++ + F  IE+ V SN+GN +YTC+YR RVHGK
Sbjct:  652 VQLIVTNAIKLYSEDRIGMVDYALESGGGSIISTRCSESFNTKTALLSLFGLPLWYFSQSPRVVIQPEVHPGNCWAFKGSTGYIVIGLSMKIVPTAFTLEHVAKSLSPTGNISSAPREFNVYGLDDEQQEEGQLLGQYVYEEDGDSLQTFLVSDEVSSGFQIIEMRVLSNWGNPEYTCVYRFRVHGK 838          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 197.978 bits (502), Expect = 3.398e-55
Identity = 87/188 (46.28%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ--MDTKFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +V ++V  A+  ++ D++GM D+ALES+G ++  TRC+ET+  + + +++FG+PL   + SPR I+QP LNPG CW  RGS+G  V++LS+ I  T+V+IDHIP+S+SP  +I SA +DF +  L  E+ K G  LGNFTY     P+QTF IQ       + +EL + SN+G+ +YTCIYR RVHG+
Sbjct:  193 EVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHGE 380          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 198.364 bits (503), Expect = 1.038e-54
Identity = 87/188 (46.28%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ--MDTKFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +V ++V  A+  ++ D++GM D+ALES+G ++  TRC+ET+  + + +++FG+PL   + SPR I+QP LNPG CW  RGS+G  V++LS+ I  T+V+IDHIP+S+SP  +I SA +DF +  L  E+ K G  LGNFTY     P+QTF IQ       + +EL + SN+G+ +YTCIYR RVHG+
Sbjct:  240 EVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHGE 427          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 197.978 bits (502), Expect = 2.084e-54
Identity = 87/188 (46.28%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ--MDTKFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +V ++V  A+  ++ D++GM D+ALES+G ++  TRC+ET+  + + +++FG+PL   + SPR I+QP LNPG CW  RGS+G  V++LS+ I  T+V+IDHIP+S+SP  +I SA +DF +  L  E+ K G  LGNFTY     P+QTF IQ       + +EL + SN+G+ +YTCIYR RVHG+
Sbjct:  263 EVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHGE 450          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 200.675 bits (509), Expect = 2.872e-53
Identity = 87/188 (46.28%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ--MDTKFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +V ++V  A+  ++ D++GM D+ALES+G ++  TRC+ET+  + + +++FG+PL   + SPR I+QP LNPG CW  RGS+G  V++LS+ I  T+V+IDHIP+S+SP  +I SA +DF +  L  E+ K G  LGNFTY     P+QTF IQ       + +EL + SN+G+ +YTCIYR RVHG+
Sbjct:  517 EVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHGE 704          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:100137098])

HSP 1 Score: 182.57 bits (462), Expect = 1.239e-46
Identity = 81/191 (42.41%), Postives = 124/191 (64.92%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            + + ++  AL L++ D+ GM DFALES GG+I  TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +G++G +VV+LS  I  T+ SI+HIPKS+SP  +I SA +DF +  L +E  + G  L    Y  +  P+Q F+I  +    F  +EL + SN+G++D+TC+YR R HG  ++
Sbjct:  684 ETQAMINNALRLYSQDRTGMADFALESGGGSILGTRCSETYGTKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGTQGYLVVRLSRMIYPTAFSIEHIPKSLSPLGNITSAPKDFAVYGLDDEYQEDGQVLIRAVYDQEGEPLQIFHIMEEYKKPFQIVELRIFSNWGHQDFTCLYRFRAHGTPVQ 874          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 200.29 bits (508), Expect = 2.143e-53
Identity = 86/188 (45.74%), Postives = 134/188 (71.28%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQ-NQMDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV ++VK AL  ++ D++GM D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG F Y  D  P+QTFY Q ++M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  509 QVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHGE 696          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 200.29 bits (508), Expect = 4.008e-53
Identity = 86/188 (45.74%), Postives = 134/188 (71.28%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQ-NQMDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV ++VK AL  ++ D++GM D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG F Y  D  P+QTFY Q ++M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  539 QVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHGE 726          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 200.29 bits (508), Expect = 4.034e-53
Identity = 86/188 (45.74%), Postives = 134/188 (71.28%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQ-NQMDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV ++VK AL  ++ D++GM D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG F Y  D  P+QTFY Q ++M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  541 QVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHGE 728          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun1 (Sad1 and UNC84 domain containing 1 [Source:MGI Symbol;Acc:MGI:1924303])

HSP 1 Score: 193.741 bits (491), Expect = 7.830e-51
Identity = 86/191 (45.03%), Postives = 129/191 (67.54%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q   +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +VV+LS +I  T+ +++HIPK++SP+ +I SA +DF +  L  E  + G  LG FTY  + + +Q F+   + D  F  +EL V SN+G+ +YTC+YR RVHG+ I+
Sbjct:  567 QAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ 757          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun1 (Sad1 and UNC84 domain containing 1 [Source:MGI Symbol;Acc:MGI:1924303])

HSP 1 Score: 193.356 bits (490), Expect = 1.339e-50
Identity = 86/191 (45.03%), Postives = 129/191 (67.54%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q   +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +VV+LS +I  T+ +++HIPK++SP+ +I SA +DF +  L  E  + G  LG FTY  + + +Q F+   + D  F  +EL V SN+G+ +YTC+YR RVHG+ I+
Sbjct:  600 QAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ 790          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8BJS4|SUN2_MOUSE (SUN domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sun2 PE=1 SV=3)

HSP 1 Score: 200.29 bits (508), Expect = 2.822e-52
Identity = 86/188 (45.74%), Postives = 134/188 (71.28%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQ-NQMDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV ++VK AL  ++ D++GM D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG F Y  D  P+QTFY Q ++M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  541 QVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHGE 728          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9UH99|SUN2_HUMAN (SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2 PE=1 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 2.793e-51
Identity = 85/188 (45.21%), Postives = 132/188 (70.21%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ-MDT-KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV  +VK AL  ++ D++G+ D+ALES G ++ +TRC+ETY  + + +++FGIPL   + SPR I+QP ++PG CW  +G +G  VV+LSA+I+ T+V+++H+PK++SP+ +I SA +DF I     +  + GT LG FTY  D  P+QTF+ Q   M T + +EL + +N+G+ +YTCIYR RVHG+
Sbjct:  527 QVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGE 714          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|O94901|SUN1_HUMAN (SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1 PE=1 SV=3)

HSP 1 Score: 194.126 bits (492), Expect = 5.898e-50
Identity = 89/192 (46.35%), Postives = 129/192 (67.19%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTF-YIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q R +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FGIPL   + SPR +IQP + PG CW  +GS+G +VV+LS  I   + +++HIPK++SP+ +I SA +DF +  L NE  + G  LG FTY  D   +Q F  ++   DT F  +EL + SN+G+ +YTC+YR RVHG+ +K
Sbjct:  621 QARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK 812          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9D666|SUN1_MOUSE (SUN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sun1 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 2.000e-49
Identity = 86/191 (45.03%), Postives = 129/191 (67.54%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGKLIK 2954
            Q   +V  AL L++ DK GM DFALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +VV+LS +I  T+ +++HIPK++SP+ +I SA +DF +  L  E  + G  LG FTY  + + +Q F+   + D  F  +EL V SN+G+ +YTC+YR RVHG+ I+
Sbjct:  723 QAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ 913          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5SS91|SUN3_MOUSE (SUN domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sun3 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.585e-33
Identity = 62/187 (33.16%), Postives = 110/187 (58.82%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHG 2942
            ++  LV Y L  F  D++ + D+AL+SAG ++     +E+Y +  + +   GI  +     P  I+QP ++PG+CW   GS+G ++++L+ +I  T+V+++HI + +SPS +I SA ++F +  +  + +     LG F Y      +QTF +QN+       ++L + SN+G+  YTC+YR RVHG
Sbjct:  128 EMSNLVHYVLKKFRGDQIQLADYALKSAGASVIEAGTSESYKNNKAKLYWHGIGFLNYEMPPDMILQPDVHPGKCWAFPGSQGHILIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVMKKCEGEEIFLGQFIYNKMEATIQTFELQNEASESLLCVKLQILSNWGHPKYTCLYRFRVHG 314          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A4E0QYL7 (SUN domain-containing protein 2 OS=Fasciola hepatica OX=6192 GN=D915_009043 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.171e-60
Identity = 104/190 (54.74%), Postives = 141/190 (74.21%), Query Frame = 3
Query: 2382 IHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTK-FIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            I  ++ L+  AL  FAAD+ GM DFALESAGG +  TRCT+TYTD ++  +IFGIPL RL+NSPRTI+QP  NPGECWP  GS G  V++LSA + I++VS++H+P+S++P+E +DSA +DF IK L +E D+ G  LGNFTY I+   +QTF + NQ + + +IE  V SN+G+  YTC+YRLRVHG +
Sbjct:  581 IDTIQSLIDVALQRFAADRTGMADFALESAGGAVVGTRCTKTYTDGSALFSIFGIPLARLSNSPRTILQPGNNPGECWPFHGSTGQAVIRLSAPVLISAVSLEHLPRSLAPNERLDSAPKDFIIKGLDSEDDEEGIILGNFTYNINGPSIQTFSVHNQTEPRQYIEFAVLSNHGHPLYTCVYRLRVHGTM 770          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A504Y825 (SUN domain-containing protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_05680 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.958e-60
Identity = 104/190 (54.74%), Postives = 141/190 (74.21%), Query Frame = 3
Query: 2382 IHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTK-FIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            I  ++ L+  AL  FAAD+ GM DFALESAGG +  TRCT+TYTD ++  +IFGIPL RL+NSPRTI+QP  NPGECWP  GS G  V++LSA + I++VS++H+P+S++P+E +DSA +DF IK L +E D+ G  LGNFTY I+   +QTF + NQ + + +IE  V SN+G+  YTC+YRLRVHG +
Sbjct:  955 IDTIQSLIDVALQRFAADRTGMADFALESAGGAVVGTRCTKTYTDGSALFSIFGIPLARLSNSPRTILQPGNNPGECWPFHGSTGQAVIRLSAPVLISAVSLEHLPRSLAPNERLDSAPKDFIIKGLDSEDDEEGIILGNFTYNINGPSIQTFSVHNQTEPRQYIEFAVLSNHGHPLYTCVYRLRVHGTM 1144          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: C1LD59 (Sad1/unc-84-like protein 2 OS=Schistosoma japonicum OX=6182 GN=Rab5IP PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 6.738e-60
Identity = 93/188 (49.47%), Postives = 138/188 (73.40%), Query Frame = 3
Query: 2391 VRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQN-QMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLI 2951
            +  ++  AL  FAAD+ G+ D+ALESAGG+I  TRCT+TYT+ AS  +IFG+PL RL+NSPRTI+QP  NPG+CWP  G++G  +++LS+ I ++SV+++H+PK ++P+  +DSA +DF +KAL +E+D+ G  LG F Y + + P+Q F  +      +FIELI+ SN+G+  YTCIYR RVHG ++
Sbjct:   43 IAHMIDEALYRFAADRTGLTDYALESAGGSIVGTRCTKTYTEGASLFSIFGLPLARLSNSPRTILQPGNNPGDCWPFHGNKGQAIIRLSSPIIVSSVTLEHLPKELAPNGRLDSAPRDFVVKALQSESDEDGIVLGKFIYDVQNKPIQNFSTKEYSKPIQFIELIILSNHGHPKYTCIYRFRVHGNMV 230          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A094ZNW0 (SUN domain-containing protein 2 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_04024 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.755e-58
Identity = 94/186 (50.54%), Postives = 140/186 (75.27%), Query Frame = 3
Query: 2397 QLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQN-QMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLI 2951
            +++  AL+ FAAD+ G+ D+ALES+GG+I  TRCT+TYT+ AS ++IFG+PL RL+NSPRTI+QP  NPG+CWP  GS+G  +++LS+ + I+SV+++H+P+ ++P+  +DSA +DF +KAL +E D  G  LG FTY +D  P+Q F I+      +F+EL++ SN+G+  YTCIYR RVHG +I
Sbjct:  411 KMIDEALHRFAADRTGLTDYALESSGGSIVGTRCTKTYTEGASLLSIFGLPLARLSNSPRTILQPGNNPGDCWPFHGSKGQAIIRLSSPVIISSVTLEHLPRELAPNGRLDSAPRDFLVKALQSEYDD-GVVLGEFTYNVDGRPIQNFRIREYSKPVQFVELVILSNHGHPKYTCIYRFRVHGNMI 595          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A0L8FNZ0 (SUN domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22012640mg PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 3.902e-58
Identity = 94/186 (50.54%), Postives = 135/186 (72.58%), Query Frame = 3
Query: 2391 VRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQ--MDTKFIELIVNSNYGNKDYTCIYRLRVHG 2942
            VR LV  AL  F+ADK G+ D+ALES GG++ +TRC+ETY  + + +++FGIPL   +NSPRT IQP +NPGECW  +GS G +V+QLS  ++IT+ S++HIPKSI+P   IDSA +DF + +L +  D+ G +LGN+TY  D  P+Q F +Q Q    T+ +E+ ++SNYGN ++TC+YR R+HG
Sbjct:  250 VRSLVDEALVKFSADKTGLADYALESGGGSVISTRCSETYAKKTALVSMFGIPLFYKSNSPRTAIQPDVNPGECWAFKGSIGVLVIQLSRLVRITAFSMEHIPKSIAPYGQIDSAPKDFSVYSLKDINDQEGINLGNYTYREDGKPLQQFPVQTQDAAPTQLVEVRISSNYGNLEFTCLYRFRIHG 435          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000054157.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:12811942:12822292:-1 gene:ENSAMXG00000039800.1 transcript:ENSAMXT00000054157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.978 bits (502), Expect = 2.559e-55
Identity = 88/190 (46.32%), Postives = 129/190 (67.89%), Query Frame = 3
Query: 2382 IHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            I  V+Q+V  AL++F AD  GM D+ALES+G  +  +RC+E+Y  + +  +IFGIPL   TNSPRT+IQP L PG+CW  RGS G + + LS+ +KIT V+++H+P+ +SP+  I+SA +DF +  + +E +  G  LG FTY  +  P+QTF I    +  +  +EL + SN+GN +YTCIYR RVHG+
Sbjct:  193 IKDVKQIVHRALSVFRADGTGMADYALESSGACVINSRCSESYHGQIACFSIFGIPLFYNTNSPRTVIQPELYPGKCWAFRGSEGFLTISLSSPVKITHVTLEHLPRVLSPTGHINSAPKDFAVYGMTDENEG-GKLLGRFTYDQEGEPIQTFKIPVSANEVYWLVELRILSNWGNPEYTCIYRFRVHGQ 381          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: si:dkey-92f12.2 (si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-379])

HSP 1 Score: 190.66 bits (483), Expect = 2.979e-51
Identity = 83/190 (43.68%), Postives = 128/190 (67.37%), Query Frame = 3
Query: 2382 IHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDT--KFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            +  V ++V  AL+L+ AD +GM D+ALES+G ++  TRC+ET+  + + +++FGIPL   + SPRT+ QP L PG+CW  RGS G +V+ LS  +++T VS++H+P+S+SP+  IDSA +DF +  +  E D  G  L  FTY  D  P+QTF + +      + +EL + SN+G+ +YTC+YR RVHG+
Sbjct:  358 VKDVERIVNRALSLYRADGVGMADYALESSGASVINTRCSETFHTKTACLSLFGIPLWYQSESPRTVTQPELYPGKCWAFRGSEGFLVIALSYPVRMTHVSLEHVPRSLSPTGRIDSAPKDFAVYGMTGE-DAEGELLATFTYNQDGEPIQTFKLPDSPTEVYQLVELRILSNWGHPEYTCVYRFRVHGQ 546          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: zgc:152977 (zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353])

HSP 1 Score: 194.126 bits (492), Expect = 1.039e-50
Identity = 82/187 (43.85%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYI-QNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL L++ D++G+ D+ALES GG++ +TRC+ETY  + + +++FG+PL   + SPR +IQP ++PG CW  RGS G +V++LS +I  T+ S++HIPK++SP+ +I SA ++F +  L +E  + G  LG + Y  D  P+QT+++  N    + IEL V SN+G+ +YTC+YR RVHG+
Sbjct:  645 QVQLIVQNALKLYSQDRIGLVDYALESGGGSVLSTRCSETYETKTALMSLFGLPLWYFSQSPRAVIQPDVHPGNCWAFRGSHGYLVIRLSMKIVPTAFSVEHIPKTLSPTGNISSAPRNFTVYGLEDEQQEEGQILGRYVYQEDGEPLQTYHVTDNTKAYQIIELRVLSNWGHPEYTCLYRFRVHGE 831          
BLAST of SUN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009801.1 (pep scaffold:Pmarinus_7.0:GL477354:48090:51409:-1 gene:ENSPMAG00000008863.1 transcript:ENSPMAT00000009801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 2.566e-53
Identity = 83/190 (43.68%), Postives = 123/190 (64.74%), Query Frame = 3
Query: 2382 IHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQM---DTKFIELIVNSNYGNKDYTCIYRLRVHG 2942
            + +V  +V+ AL L+  DK+G  DFALESAGGT+ + RC+E Y+ + + IT+FG+PL   + SPR IIQP + PG+CW  +GSRG V ++LS  I  +  +++HIP+++SP+  I SA +DF +  L  E  + G  LG + Y    +P+Q F++ N         +EL + SN+GN +YTCIYR RVHG
Sbjct:   13 VQEVYAIVQSALRLYEEDKIGKFDFALESAGGTVISVRCSEAYSQQIALITLFGVPLWYTSQSPRVIIQPDVYPGDCWAFKGSRGYVAIKLSDTIYPSDFTLEHIPRALSPTGDITSAPKDFAVYGLDEEIQQEGYLLGQYIYDKHGDPLQMFHMSNSTVAHPFGIVELRILSNWGNSEYTCIYRFRVHG 202          
BLAST of SUN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO40082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D4])

HSP 1 Score: 138.272 bits (347), Expect = 3.001e-37
Identity = 78/194 (40.21%), Postives = 113/194 (58.25%), Query Frame = 3
Query: 2391 VRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETY---TDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPS--ESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDT---KFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            +R  ++ AL+ ++ADKLG+PD+ALES GG I     + T+   T+R      FG+     T SPR IIQP   PG+CW  +G +G VV++LS  I  T  +++HIP S+S +    I +A +DF +   A+        LGNFTY  +   +QTF ++        +++EL V SN+G   +TCIYRLRVHG L
Sbjct:    6 LRDNMEAALDKYSADKLGIPDYALESDGGAIHFPHHSTTFNTGTERG----WFGLSFWYDTVSPRVIIQPDNKPGQCWAFQGQQGYVVIKLSRAIIPTMFTLEHIPSSLSTNGHGKIPTAPKDFSVWGWADPEGTEKVMLGNFTYKKEGKSLQTFQVKGTPSDAVFRYVELRVLSNHGQATHTCIYRLRVHGDL 195          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000029699.1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 185.267 bits (469), Expect = 1.713e-47
Identity = 83/188 (44.15%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL LF+ D+ G  D+ALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +V++LS +I  TS  ++HIPKS+SP+ +I SA ++F +  L +E    G  LG++TY  +   +Q F ++ + D  F  IE+ V SN+G+ +YTC+YR RVHG+
Sbjct:  816 QVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHGE 1003          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000042946.1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 184.882 bits (468), Expect = 2.301e-47
Identity = 83/188 (44.15%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL LF+ D+ G  D+ALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +V++LS +I  TS  ++HIPKS+SP+ +I SA ++F +  L +E    G  LG++TY  +   +Q F ++ + D  F  IE+ V SN+G+ +YTC+YR RVHG+
Sbjct:  877 QVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHGE 1064          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000010709.2 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 184.882 bits (468), Expect = 2.487e-47
Identity = 83/188 (44.15%), Postives = 129/188 (68.62%), Query Frame = 3
Query: 2388 QVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKF--IELIVNSNYGNKDYTCIYRLRVHGK 2945
            QV+ +V+ AL LF+ D+ G  D+ALES GG+I +TRC+ETY  + + +++FG+PL   + SPR +IQP + PG CW  +GS+G +V++LS +I  TS  ++HIPKS+SP+ +I SA ++F +  L +E    G  LG++TY  +   +Q F ++ + D  F  IE+ V SN+G+ +YTC+YR RVHG+
Sbjct:  866 QVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHGE 1053          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000034186.1 (uncharacterized LOC101162344 [Source:NCBI gene;Acc:101162344])

HSP 1 Score: 167.162 bits (422), Expect = 8.298e-43
Identity = 80/177 (45.20%), Postives = 120/177 (67.80%), Query Frame = 3
Query: 2430 ADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQ--PSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDT--KFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            ADK+   DFALE+ G ++ +TRC+ETY  R++ +T+FG PL   + SPRT+IQ  P L PG+CW   G +G +V+ LS  I+I+ V++DH+P+  +P+  IDSA +DF++  + N+T++ G  LG FTY  +    QTF + N  D   + +EL V SN+G+ +YTC+YR RVHGK+
Sbjct:  455 ADKMA--DFALETQGASVISTRCSETYRIRSACLTLFGFPLWYPSESPRTVIQGFPVLLPGKCWAFHGVQGTLVISLSHPIRISHVTLDHLPRYNAPTGRIDSAPKDFQVYGMKNDTEE-GMLLGAFTYDENGESSQTFELPNPSDVVYRIVELRVLSNWGHMEYTCLYRFRVHGKI 628          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000019736.1 (SMESG000019736.1)

HSP 1 Score: 1878.99 bits (4866), Expect = 0.000e+0
Identity = 953/959 (99.37%), Postives = 956/959 (99.69%), Query Frame = 3
Query:   81 MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNEDEMLRKFSGNKVTSSQSGTPNRKKNHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYSFFDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAELENLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFXXXXXXXXXXXXXXXXXXXXXXXXXQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFNEQMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSEXXXXXXXXXXXXXXXXACVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF 2957
            MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNED+MLRKFSGNKVTSSQSGTPNRKKNHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYS FDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAEL NLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFKEKSLSNSESVKKLELLLDLFRLDLQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFN+QMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSENSFNRGSLNSRSRSSSACVRIHQVRQLVK ALNLFAADKLGMPDFALESAGGTI+TTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF
Sbjct:    1 MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNEDKMLRKFSGNKVTSSQSGTPNRKKNHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYSLFDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAELGNLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFKEKSLSNSESVKKLELLLDLFRLDLQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFNDQMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSENSFNRGSLNSRSRSSSACVRIHQVRQLVKDALNLFAADKLGMPDFALESAGGTISTTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF 959          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000019736.1 (SMESG000019736.1)

HSP 1 Score: 1873.6 bits (4852), Expect = 0.000e+0
Identity = 953/962 (99.06%), Postives = 956/962 (99.38%), Query Frame = 3
Query:   81 MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNEDEMLRKFSGNKVTSSQSGTPNRKK---NHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYSFFDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAELENLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFXXXXXXXXXXXXXXXXXXXXXXXXXQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFNEQMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSEXXXXXXXXXXXXXXXXACVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF 2957
            MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNED+MLRKFSGNKVTSSQSGTPNRKK   NHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYS FDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAEL NLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFKEKSLSNSESVKKLELLLDLFRLDLQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFN+QMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSENSFNRGSLNSRSRSSSACVRIHQVRQLVK ALNLFAADKLGMPDFALESAGGTI+TTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF
Sbjct:    1 MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRDNVRKTILDSESFEYDTECNEDKMLRKFSGNKVTSSQSGTPNRKKIIRNHSGDNERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEILHDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRDKTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKSRLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRHSVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRRRLSLNNRSKYSLFDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFSFDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIISKTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLASDIQTETSSRQSTSMKISEVQKDMESQIINLKAELGNLKLAQSKTGNAVENFTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFKEKSLSNSESVKKLELLLDLFRLDLQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHEVSEEIKQLSGSQQKAITKFNDQMSNLEMKINEHQSQLSDKEFVDKLVNSHFENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSENSFNRGSLNSRSRSSSACVRIHQVRQLVKDALNLFAADKLGMPDFALESAGGTISTTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKLIKF 962          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 152.14 bits (383), Expect = 2.417e-37
Identity = 73/192 (38.02%), Postives = 114/192 (59.38%), Query Frame = 3
Query: 2373 CVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            C+   +++++VK A+  ++ADK+G+ DFALES GG++  TR + TY      ++    PL R  +S RTIIQP    GECW   GS G  V+QLS +I + +V+++H+P  +     I SA + F+I +L   + +    +G F Y  D   +QTF +      + ++  V SN+GN D+TC+YRLR+HG L
Sbjct:  670 CLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 861          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 152.14 bits (383), Expect = 2.536e-37
Identity = 73/192 (38.02%), Postives = 114/192 (59.38%), Query Frame = 3
Query: 2373 CVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            C+   +++++VK A+  ++ADK+G+ DFALES GG++  TR + TY      ++    PL R  +S RTIIQP    GECW   GS G  V+QLS +I + +V+++H+P  +     I SA + F+I +L   + +    +G F Y  D   +QTF +      + ++  V SN+GN D+TC+YRLR+HG L
Sbjct:  719 CLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 910          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 152.14 bits (383), Expect = 2.703e-37
Identity = 73/192 (38.02%), Postives = 114/192 (59.38%), Query Frame = 3
Query: 2373 CVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGTIATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGSRGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDKIGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRLRVHGKL 2948
            C+   +++++VK A+  ++ADK+G+ DFALES GG++  TR + TY      ++    PL R  +S RTIIQP    GECW   GS G  V+QLS +I + +V+++H+P  +     I SA + F+I +L   + +    +G F Y  D   +QTF +      + ++  V SN+GN D+TC+YRLR+HG L
Sbjct:  741 CLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 932          
The following BLAST results are available for this feature:
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUN25.816e-5245.21Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN25.816e-5245.21Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN16.428e-5246.35Sad1 and UNC84 domain containing 1 [Source:HGNC Sy... [more]
SUN28.633e-5245.21Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN11.296e-5146.35Sad1 and UNC84 domain containing 1 [Source:HGNC Sy... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
unc-841.388e-3340.33Nuclear migration and anchoring protein unc-84 [S... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
koi1.051e-4843.30gene:FBgn0265003 transcript:FBtr0335513[more]
koi1.720e-4843.30gene:FBgn0265003 transcript:FBtr0335514[more]
koi1.720e-4843.30gene:FBgn0265003 transcript:FBtr0335512[more]
spag41.442e-1430.00gene:FBgn0032368 transcript:FBtr0340563[more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-92f12.27.464e-5445.60si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
sun17.411e-5043.62Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
sun14.718e-4843.62Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
sun14.739e-4843.62Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
zgc:1529777.331e-4841.71zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353][more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUN23.398e-5546.28Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN21.038e-5446.28Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN22.084e-5446.28Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN22.872e-5346.28Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN11.239e-4642.41Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sun22.143e-5345.74Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun24.008e-5345.74Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun24.034e-5345.74Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun17.830e-5145.03Sad1 and UNC84 domain containing 1 [Source:MGI Sym... [more]
Sun11.339e-5045.03Sad1 and UNC84 domain containing 1 [Source:MGI Sym... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BJS4|SUN2_MOUSE2.822e-5245.74SUN domain-containing protein 2 OS=Mus musculus OX... [more]
sp|Q9UH99|SUN2_HUMAN2.793e-5145.21SUN domain-containing protein 2 OS=Homo sapiens OX... [more]
sp|O94901|SUN1_HUMAN5.898e-5046.35SUN domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|Q9D666|SUN1_MOUSE2.000e-4945.03SUN domain-containing protein 1 OS=Mus musculus OX... [more]
sp|Q5SS91|SUN3_MOUSE2.585e-3333.16SUN domain-containing protein 3 OS=Mus musculus OX... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0QYL71.171e-6054.74SUN domain-containing protein 2 OS=Fasciola hepati... [more]
A0A504Y8254.958e-6054.74SUN domain-containing protein 2 OS=Fasciola gigant... [more]
C1LD596.738e-6049.47Sad1/unc-84-like protein 2 OS=Schistosoma japonicu... [more]
A0A094ZNW02.755e-5850.54SUN domain-containing protein 2 (Fragment) OS=Schi... [more]
A0A0L8FNZ03.902e-5850.54SUN domain-containing protein (Fragment) OS=Octopu... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000054157.12.559e-5546.32pep primary_assembly:Astyanax_mexicanus-2.0:14:128... [more]
si:dkey-92f12.22.979e-5143.68si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
zgc:1529771.039e-5043.85zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353][more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009801.12.566e-5343.68pep scaffold:Pmarinus_7.0:GL477354:48090:51409:-1 ... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400823.001e-3740.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000029699.11.713e-4744.15Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000042946.12.301e-4744.15Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000010709.22.487e-4744.15Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000034186.18.298e-4345.20uncharacterized LOC101162344 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019736.10.000e+099.37SMESG000019736.1[more]
SMESG000019736.10.000e+099.06SMESG000019736.1[more]
SMESG000020187.12.417e-3738.02SMESG000020187.1[more]
SMESG000020187.12.536e-3738.02SMESG000020187.1[more]
SMESG000020187.12.703e-3738.02SMESG000020187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030263 ID=SMED30030263|Name=SUN domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3054bp
ATCAAATTCAATTTAATTTAATCTTTTTATTAATTTAATTATAAATTATA
TATTTTAAATACACGTATTATATTTTTACAATGTTCTGGAGAAACAATTA
CGCAAATAATGAAAATTGCGTCGATTATTTTCATAATAAAAAAAGGACCA
ATTATACGTATGCAGAAAGTGGTAGCTATAGAATTGTGACAGAGAAGCAA
AATGTAAACGAACCTTACCTTATGAGAGATAATGTACGCAAAACTATTTT
AGATTCAGAATCATTTGAATATGACACTGAATGTAATGAGGATGAAATGC
TGAGGAAATTTTCGGGTAACAAAGTGACCAGCAGTCAGTCGGGCACTCCA
AATCGTAAGAAAAATCATTCGGGAGACAATGAGAGAGTGCTGCGGTCTCG
GACTCTTGTCACATCACAAATAAATAATACTTCAACTACTCCATTTGTTC
GAGAGCATGAAGAACACGATATTTATAAATATGGTATACTGAATACCAAC
ACAAACAATTCCGGTCCCGATGAGATATTGCACGACAAGCCCAAACGATC
AGTTGTAGATAATTATGATTTGTCAGGCGATGAAGGAATGGGCTCTGATA
CCATTGATTCTGACAATCCGCTTGGGAATTTCGGTTCCAATAATGCCAAT
TCCATTAGGCCGGCCATGCAACACAGAGATAAAACCAAAACTCAGTGGTT
TCAAAGAAGCATGTTCGGATTACCGAATGAGGAATCGGATGAAGCGAATG
AAGATTTATCGGGCGCAATTTCTGGCGACGAACAATACAATATCGGTTCA
TATCAACAGTCACATCTCAACCAAAAATCCAGATTGCCCAAATGGCAATC
GAGAAAATCTCATAGATCAGATCTGTGGAATTCCAATCGGAAATTAGACA
ACATTTTCTGCAGTCCACTGGCAATGATTAGTCTGCTAATAGAATGGATT
GTTGGCATAGTAACCACAATCGTTCGGCATTCGGTGCGTCATGCCAGGCA
GTTTGCATTTAATTCTAATATCATACGTTGGTTAACGATGCCATTTTACT
TGCCAATTGTTATTATTAGACAATCAGTTGCTGCATTAGCTTATTCATCT
GACAGATTGTTTGGCACAACAATGAGACGTCGATTAAGCTTGAATAATCG
CAGCAAATATTCGTTTTTTGATATTGTTTCCAGTATTTTGTGGCTGCTTT
TTGTTGCCGTAACTGTGATAGTTTTGTTGCATTTCTTCCTTGGTGGCCAC
TCCAACCAAACCCCGGAAACGAAATTCTCGTTTGATTTTGACTCGGGTTT
ATCTAAACATTTTTATCGTTTTGTTGGAAACGATTGCATGGAGAATAATA
ATTGTTGCAAAAATAATTGGGAACAAATTCGACGGTTTACGTTTTGCCTA
TTTTCTTTACCAGCTCGAATGATAATATCAAAAACCGATCATTTTAATAC
AACAGAATCTTTACAACAGACAAGCAATATTTCAAACTTAGAGGGAATTC
TTGAAACGTTTAAAAATATAATATCCAAGCAAGATCAGAAAATGGCTAAT
TATGATGAGAAACTCAACCAACTGGCATCTGATATACAAACCGAAACAAG
TTCTCGCCAATCGACATCAATGAAAATTTCGGAAGTCCAAAAGGACATGG
AAAGTCAGATAATAAACTTAAAAGCAGAATTGGAAAATTTGAAATTAGCT
CAATCGAAAACCGGAAATGCCGTGGAAAATTTCACCGGAAATCAATTAAA
TAACCTTAATTTGAAATATGACGAGTTGGAGGTATCAAAACGCAAGTTGG
AAAGCCACATACAGACTCTGGCAGATTTGGTGGGAACATTTAAAGAGAAA
TCCTTATCAAATTCTGAATCCGTCAAAAAACTGGAACTTCTGCTAGATCT
TTTCAGACTAGATCTACAAAATGTTAAAAGCACAATTATTGAACTTGATA
ACAGAACAGAAACAAATATACATTCCAATAACATTATGAATATACAATTG
ACAAATTTGAAGAAAGAAATTATGCACGAGGTCAGTGAAGAAATCAAACA
GTTATCAGGATCTCAACAGAAAGCAATAACAAAATTTAATGAGCAAATGT
CAAACCTTGAGATGAAAATAAACGAACATCAATCACAATTGTCGGATAAA
GAATTTGTAGATAAATTAGTAAATTCTCATTTTGAAAATCTCAAACAAGA
TGTAAAAGATGAAATAAATACAATCTTGTGGCAGAATCTCACAGATCATG
TGAATATTTTAATGAAGTCCATGGACTTGAAAATTGAGCAAACCTCGAAT
CTTTACCTAAGTAACAGCGAAAATTCATTCAATCGTGGCTCTTTAAATTC
TCGCTCCAGAAGTTCTTCGGCGTGCGTGCGTATTCATCAAGTTCGACAGT
TGGTAAAATATGCTTTAAATTTGTTTGCTGCCGATAAATTGGGCATGCCA
GATTTTGCCTTAGAATCGGCTGGTGGAACAATTGCAACGACGAGATGCAC
CGAAACATACACTGACCGTGCTTCAACAATTACAATTTTCGGTATTCCAC
TAGTGAGATTAACTAATTCTCCTAGAACCATAATTCAACCTAGCCTGAAT
CCAGGTGAATGTTGGCCTATGAGAGGTAGTAGAGGTGCAGTTGTAGTACA
ATTATCAGCACAAATCAAGATCACTTCCGTATCCATTGATCACATTCCGA
AATCAATTTCCCCAAGTGAATCTATAGATTCTGCTATTCAAGATTTTGAG
ATTAAAGCTTTGGCCAATGAAACTGATAAAATTGGAACGTCTCTTGGGAA
TTTCACCTATTTGATTGACTCTAATCCTGTTCAAACATTTTACATTCAGA
ATCAAATGGACACGAAATTCATTGAGCTGATTGTCAATTCCAATTACGGT
AACAAAGATTACACTTGTATTTACAGGCTCAGGGTCCATGGAAAACTTAT
CAAATTTTGATTTAACGAAATGTTAATTTTTGTAAATTTCGTTATTGTAA
TTTTAATAATTTCTCTTGTTTTGTTTTATCATGTCTTTTTGACATTGTTT
CTGT
back to top

protein sequence of SMED30030263-orf-1

>SMED30030263-orf-1 ID=SMED30030263-orf-1|Name=SMED30030263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=960bp
MFWRNNYANNENCVDYFHNKKRTNYTYAESGSYRIVTEKQNVNEPYLMRD
NVRKTILDSESFEYDTECNEDEMLRKFSGNKVTSSQSGTPNRKKNHSGDN
ERVLRSRTLVTSQINNTSTTPFVREHEEHDIYKYGILNTNTNNSGPDEIL
HDKPKRSVVDNYDLSGDEGMGSDTIDSDNPLGNFGSNNANSIRPAMQHRD
KTKTQWFQRSMFGLPNEESDEANEDLSGAISGDEQYNIGSYQQSHLNQKS
RLPKWQSRKSHRSDLWNSNRKLDNIFCSPLAMISLLIEWIVGIVTTIVRH
SVRHARQFAFNSNIIRWLTMPFYLPIVIIRQSVAALAYSSDRLFGTTMRR
RLSLNNRSKYSFFDIVSSILWLLFVAVTVIVLLHFFLGGHSNQTPETKFS
FDFDSGLSKHFYRFVGNDCMENNNCCKNNWEQIRRFTFCLFSLPARMIIS
KTDHFNTTESLQQTSNISNLEGILETFKNIISKQDQKMANYDEKLNQLAS
DIQTETSSRQSTSMKISEVQKDMESQIINLKAELENLKLAQSKTGNAVEN
FTGNQLNNLNLKYDELEVSKRKLESHIQTLADLVGTFKEKSLSNSESVKK
LELLLDLFRLDLQNVKSTIIELDNRTETNIHSNNIMNIQLTNLKKEIMHE
VSEEIKQLSGSQQKAITKFNEQMSNLEMKINEHQSQLSDKEFVDKLVNSH
FENLKQDVKDEINTILWQNLTDHVNILMKSMDLKIEQTSNLYLSNSENSF
NRGSLNSRSRSSSACVRIHQVRQLVKYALNLFAADKLGMPDFALESAGGT
IATTRCTETYTDRASTITIFGIPLVRLTNSPRTIIQPSLNPGECWPMRGS
RGAVVVQLSAQIKITSVSIDHIPKSISPSESIDSAIQDFEIKALANETDK
IGTSLGNFTYLIDSNPVQTFYIQNQMDTKFIELIVNSNYGNKDYTCIYRL
RVHGKLIKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
IPR012919SUN_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 520..540
NoneNo IPR availableCOILSCoilCoilcoord: 481..501
NoneNo IPR availableCOILSCoilCoilcoord: 556..583
NoneNo IPR availableCOILSCoilCoilcoord: 666..686
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..105
NoneNo IPR availablePANTHERPTHR12911SAD1/UNC-84-LIKE PROTEIN-RELATEDcoord: 630..955
coord: 79..577
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 317..339
NoneNo IPR availableTMHMMTMhelixcoord: 360..382
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 764..957
e-value: 2.1E-67
score: 228.5
IPR012919SUN domainPFAMPF07738Sad1_UNCcoord: 827..955
e-value: 1.6E-35
score: 122.0
IPR012919SUN domainPROSITEPS51469SUNcoord: 798..957
score: 37.835