Reverse transcriptase domain-containing protein

Overview
NameReverse transcriptase domain-containing protein
Smed IDSMED30030259
Length (bp)2296
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reverse transcriptase domain-containing protein (SMED30030259) t-SNE clustered cells

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30030259) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reverse transcriptase domain-containing protein (SMED30030259) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30030259) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030259

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030259h1SMcG0008470 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030259h1SMcG0008470 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030259h1SMcG0008469 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030259h1SMcG0008469 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030259h1SMcG0008470 Contig4597GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030259h1SMcG0016518 Contig4597GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30030259h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30030259h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30030259h1SMcG0008470 dd_Smed_v4_6515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030259h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030259h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030259h1SMcG0008470 dd_Smed_v4_2558_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30030259h1SMcG0008470 Contig46397uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030259h1SMcG0008470 Contig46397newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030259h1SMcG0008470 Contig4597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030259h1SMcG0016518 Contig4597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2A4JD51 (Uncharacterized protein (Fragment) OS=Heliothis virescens OX=7102 GN=B5V51_3559 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.020e-33
Identity = 89/269 (33.09%), Postives = 147/269 (54.65%), Query Frame = 3
Query:  675 TGKPVSEAAANISKD*RLTEKISVMLFDTTAVNTGHLNGACAILEKTLSKKRIWLACRHHILEVICEEVFKXXXXXXXXXXXXXXXXXXXXXXXXXIREAEFSICHYVRLEQDLKPLKEEIIIFCSNILQIKDN*RYLPREDHKDFLTLNLIFLGKILPSGCIFVFLELITIQGGCLKYIYIMNIYLFRHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFISL 1481
            TG+  + A  +   +  L +K+  M FDTTAVN+G  NGAC +LE+ + K  +WLACRHHILE++ E    T  G S+     +  +    +      + +  I     LE  ++ + +  I F  N L       + PR+D+K+ L L +I+LG +   G +F     +       K IY + I+LFRHQFK+TK +++ I +   F+ ++Y+  W Q  + ++A  NDL+ IK L  +++++ ++++ ALK I  HLWYL+ E + L
Sbjct:  303 TGETCASAVYDTILEWGLNDKVKCMCFDTTAVNSGLRNGACVLLEQKMEKDMLWLACRHHILEIMLEAAINTALGPSSGPDILIFKRFKSLWNKIDQSDYKTVISDPSSLEY-VQNIMQATISFAQNQLN-----EFQPRDDYKELLNLTIIYLGGVPEKGVLFRKPAGLHRARWMAKAIYSLKIFLFRHQFKLTKREEKGIKDICIFSVIIYVKYWYQASVASSAPRNDLQLIKDLTIFENINQTLAKVALKKILGHLWYLSEELVPL 565          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2S2PVY4 (Uncharacterized protein OS=Sipha flava OX=143950 GN=g.18527 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.472e-33
Identity = 101/274 (36.86%), Postives = 151/274 (55.11%), Query Frame = 3
Query:  648 FGCSKI*TRTGKPVSEAAANISKD*RLTEKISVMLFDTTAVNTGHLNGACAILEKTLSKKRIWLACRHHILEVICEEVFKXXXXXXXXXXXXXXXXXXXXXXXXXIREAEFSICHYVRLEQDLKPLKEEIIIFCSNILQIKDN*RYLPREDHKDFLTLNLIFLGKILPSGCIFVFLELITIQGGCLKYIYIMNIYLFRHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAE 1469
             G  +I + TG+ +S A  +  ++  L + I   +FDTTA NTG LNGAC +LE+ L +  ++LACRHH+ E++   VF T    ++TG D ++FK+FK       + +  +      ++  LK + +EI+IF  N  +IKDN   LPR+D+K+ L L +IFLG + P G  F       +     K IY + I+LFR QFK+TK +++++     F    Y  AW        A LND+ F+K L  YK     ++E A+  I  HLWYLN E
Sbjct:  105 LGVPEIKSGTGREISSALYHTLQEWSLEDTIQAFVFDTTASNTGILNGACHLLEQKLDRNILYLACRHHVYEIVLHGVFTTVNLVNSTGPDIIIFKKFKNEWRNIDQNSFSTWSTDENVKNILKGISDEILIFAKN--KIKDN---LPRDDYKELLELIIIFLGGVPPQGIHFRAPGAYHLARWMAKAIYCLKIFLFRTQFKITKKQEKALKRICCFIIKCYAEAWFSSTNAITAPLNDIYFLKTLNAYKMDDIEVAEKAISKIINHLWYLNEE 373          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: T1FGT8 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20208037 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.148e-33
Identity = 102/320 (31.87%), Postives = 166/320 (51.88%), Query Frame = 3
Query:  618 AMVVIRC--WEAFGCSKI*TRTGKPVSEAAANISKD*RLTEKISVMLFDTTAVNTGHLNGACAILEKTLSKKRIWLACRHHILEVICEEVFKXXXXXXXXXXXXXXXXXXXXXXXXXIREAEFSICHYVRLEQDL-KPLKEEIIIFCSNILQIKDN*RYLPREDHKDFLTLNLIFLGKILPSGCIFVFLELITIQGG------CLKYIYIMNIYLFRHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFI--SLFSKYLSG*EKQPYCLLEATNG 1544
            A+VV  C   +  G  KI + TG+  + A   + K   ++E I  M FDTTA NTG  +GAC +LEK L +  +  ACRHH+ E+I  EVF  T     +    +            I ++        R+   L + ++ +I+   +  L    +  Y+PRED+K  + L L+ LG  + +   + F     + G         K IY + +YLFR++FK+T  + +S+ EF  FA+ +Y+ AW+ CPIP++A +NDL+    +  Y +++ +++  A K ++ HLWYL  E +  SLFS  ++  EKQ   ++EA N 
Sbjct:  130 AVVVTGCKVEKILGIVKIASSTGQAQANATFQLLKLWDVSEDIIGMCFDTTAANTGTSSGACVLLEKLLHRNLLHFACRHHVHELIIGEVF--TVLFGPSRGPNIGMFERFRANWPNINQSNHKPLDDDRINHSLLQMMRSDIVPSLTCFLSADSS--YIPREDYKKLVELCLLVLGYPMQTDGKYHF----RVPGAYHMARWMAKVIYCLKMYLFRNEFKLTATETKSLTEFCLFATHIYVPAWMLCPIPSDALVNDLQLASRIEQYSEINKNVASAATKKLKNHLWYLGTEMVWLSLFSNKVANAEKQ--LIVEAMNA 439          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: J9M4P2 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 2.057e-32
Identity = 95/274 (34.67%), Postives = 148/274 (54.01%), Query Frame = 3
Query:  648 FGCSKI*TRTGKPVSEAAANISKD*RLTEKISVMLFDTTAVNTGHLNGACAILEKTLSKKRIWLACRHHILEVICEEVFKXXXXXXXXXXXXXXXXXXXXXXXXXIREAEFSICHYVRLEQDLKPLKEEIIIFCSNILQIKDN*RYLPREDHKDFLTLNLIFLGKILPSGCIFVFLELITIQGGCLKYIYIMNIYLFRHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAE 1469
             G   + + TGK +S A  +  KD  + EK+   +FDTTA N+G LNG+C +LE+ L++  ++LACRHHI E+I + VF  +   + +G +  +FKRFK    +  +    +      +++ L  + +++IIFC + L      + LPR+D+K+FL L +IFLG + P    F       +     K IY + IY+F+ QFK+TK +  S+     F    YI  W + P    A  ND+ F++ L DYK     ++E A+K    HLWYL  E
Sbjct:  426 LGVPHLSSGTGKEISSAVYDTLKDWSMLEKVQAFVFDTTASNSGRLNGSCVLLEQMLNRPILFLACRHHIFEIILQSVFSYSKLTTMSGPEIPIFKRFKNNWNQIDQTKYNTWVSDNEVKKILHKVADDVIIFCKDTLN-----QNLPRDDYKEFLELVIIFLGGVPPKSIHFKRPGAYHLARWMCKGIYCLKIYIFQEQFKLTKAEITSLKTICCFIVKCYIEFWFRSPNAIEAPYNDVLFLRKLEDYKSDDKKVAELAIKKFINHLWYLGEE 694          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: T1EUJ2 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20200242 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 3.254e-32
Identity = 92/277 (33.21%), Postives = 152/277 (54.87%), Query Frame = 3
Query:  726 LTEKISVMLFDTTAVNTGHLNGACAILEKTLSKKRIWLACRHHILEVICEEVFKXXXXXXXXXXXXXXXXXXXXXXXXXIREAEFSICHYVRLEQD------LKPLKEEIIIFCSNILQIKDN*RYLPREDHKDFLTLNLIFLGKILPSGCIFVFLELITIQGG------CLKYIYIMNIYLFRHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFI--SLFSKYLSG*EKQ 1514
            ++E I  M FDTTA NTG  +GAC +LEK L +  +  ACRHH+ E+I  EVF   FG S   + G+  +    +          S  ++  L+ D      L+ ++ +I+   +  L    +  Y+PRED+K+ + L L+ LG  + +   + F     + G         K IY + +YLFR++FK+T  + +S+ EF  FA+ +Y+ AW+ CPIP++A +NDL+ +  +  Y +++ +++  A K ++ HLWYL  E +  SLFS  ++  EKQ
Sbjct:  194 VSEDIIGMCFDTTAANTGTSSGACVLLEKLLHRNLLHFACRHHVHELIIGEVFTVLFGPSRGPNIGMFERFRAYW-------PNISQSNHKPLDDDRMNHSLLQMMRSDIVPSLTCFLSADSS--YIPREDYKELVKLCLLVLGYPMQTDGKYHF----RVPGAYHMARWMAKVIYCLKMYLFRNEFKLTATETKSLTEFCLFATHIYVPAWMLCPIPSDAQVNDLQLLSRIEQYSEINKNVASAATKKLKNHLWYLGTEMVWLSLFSNKVANAEKQ 457          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 155.992 bits (393), Expect = 4.365e-62
Identity = 88/99 (88.89%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1477 LFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 1770
            LFSQ ISVDEKNSL ACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  735 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 833          

HSP 2 Score: 103.219 bits (256), Expect = 4.365e-62
Identity = 48/58 (82.76%), Postives = 52/58 (89.66%), Query Frame = 2
Query: 1772 VPSEELHWCHHSTHFSPNQRRKRKLLNSIAKSFQVQKNQLC*RDRNLKTFRTQKVQTK 1945
            +PSEELHWCHHSTHFSPNQRRK+KLLNSIAKSFQVQKNQLC    NLKTFRTQK  ++
Sbjct:  834 LPSEELHWCHHSTHFSPNQRRKKKLLNSIAKSFQVQKNQLC----NLKTFRTQKTSSE 887          

HSP 3 Score: 168.703 bits (426), Expect = 6.588e-43
Identity = 89/134 (66.42%), Postives = 101/134 (75.37%), Query Frame = 3
Query: 1239 RHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPYC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 1601
            R++ +MTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  653 RNKSEMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 783          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000004000.1 (SMESG000004000.1)

HSP 1 Score: 154.836 bits (390), Expect = 8.551e-62
Identity = 88/99 (88.89%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1477 LFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 1770
            LFSQ ISVDEKNSL ACLRQLMEKSSGDQKEERCIRSTKY SAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  635 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIRSTKYTSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 733          

HSP 2 Score: 103.219 bits (256), Expect = 8.551e-62
Identity = 48/58 (82.76%), Postives = 52/58 (89.66%), Query Frame = 2
Query: 1772 VPSEELHWCHHSTHFSPNQRRKRKLLNSIAKSFQVQKNQLC*RDRNLKTFRTQKVQTK 1945
            +PSEELHWCHHSTHFSPNQRRK+KLLNSIAKSFQVQKNQLC    NLKTFRTQK  ++
Sbjct:  734 LPSEELHWCHHSTHFSPNQRRKKKLLNSIAKSFQVQKNQLC----NLKTFRTQKTSSE 787          

HSP 3 Score: 167.933 bits (424), Expect = 1.100e-42
Identity = 82/110 (74.55%), Postives = 92/110 (83.64%), Query Frame = 3
Query: 1239 RHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPYC-----LLEATNGE 1547
            R++ +MTKHKDRSIAEFAFFASLVYITAWIQCP PANASLNDLEFIKLLIDYKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+
Sbjct:  553 RNKSEMTKHKDRSIAEFAFFASLVYITAWIQCPTPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGD 662          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 155.606 bits (392), Expect = 1.274e-54
Identity = 88/99 (88.89%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1477 LFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 1770
            LFSQ ISVDEKNSL ACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  709 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 807          

HSP 2 Score: 78.1814 bits (191), Expect = 1.274e-54
Identity = 32/35 (91.43%), Postives = 35/35 (100.00%), Query Frame = 2
Query: 1772 VPSEELHWCHHSTHFSPNQRRKRKLLNSIAKSFQV 1876
            +PSEELHWCHHSTHFSPNQRRK+KLLNSIAKSFQ+
Sbjct:  808 LPSEELHWCHHSTHFSPNQRRKKKLLNSIAKSFQI 842          

HSP 3 Score: 110.923 bits (276), Expect = 1.143e-24
Identity = 62/104 (59.62%), Postives = 72/104 (69.23%), Query Frame = 3
Query: 1329 QCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPYC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 1601
            +CPIPANASLNDLEFIKLLIDYKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  657 ECPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 757          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 155.606 bits (392), Expect = 1.619e-54
Identity = 88/99 (88.89%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1477 LFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 1770
            LFSQ ISVDEKNSL ACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  735 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 833          

HSP 2 Score: 78.1814 bits (191), Expect = 1.619e-54
Identity = 32/35 (91.43%), Postives = 35/35 (100.00%), Query Frame = 2
Query: 1772 VPSEELHWCHHSTHFSPNQRRKRKLLNSIAKSFQV 1876
            +PSEELHWCHHSTHFSPNQRRK+KLLNSIAKSFQ+
Sbjct:  834 LPSEELHWCHHSTHFSPNQRRKKKLLNSIAKSFQI 868          

HSP 3 Score: 168.318 bits (425), Expect = 7.510e-43
Identity = 89/134 (66.42%), Postives = 101/134 (75.37%), Query Frame = 3
Query: 1239 RHQFKMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPYC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 1601
            R++ +MTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  653 RNKSEMTKHKDRSIAEFAFFASLVYITAWIQCPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 783          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000047115.1 (SMESG000047115.1)

HSP 1 Score: 155.606 bits (392), Expect = 3.415e-54
Identity = 88/99 (88.89%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1477 LFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFHNVTFKDFVXXXXXXXXXXXXXXXX-XPTDASTRQQTPSFQKATAMVSSLNVVND 1770
            LFSQ ISVDEKNSL ACLRQLMEKSSGDQKEERCI STKYPSAFHNVTFKDFVTSSFLLF   LL +   SPTDASTRQQTPSFQKATAMVSSLNVVND
Sbjct:  638 LFSQRISVDEKNSLAACLRQLMEKSSGDQKEERCIHSTKYPSAFHNVTFKDFVTSSFLLFFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNVVND 736          

HSP 2 Score: 77.0258 bits (188), Expect = 3.415e-54
Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 2
Query: 1772 VPSEELHWCHHSTHFSPNQRRKRKLLNSIAKSFQV 1876
            +PSEELHWCHHSTHFSPNQRRK+KLLNSIAKSFQ 
Sbjct:  737 LPSEELHWCHHSTHFSPNQRRKKKLLNSIAKSFQT 771          

HSP 3 Score: 111.309 bits (277), Expect = 9.454e-25
Identity = 62/104 (59.62%), Postives = 72/104 (69.23%), Query Frame = 3
Query: 1329 QCPIPANASLNDLEFIKLLIDYKDVSPSISETALKTIRRHLWYLNAEFIS--LFSKYLSG*EKQPYC-----LLEATNGEIFW*SERRKVHPQ------HKVSF 1601
            +CPIPANASLNDLEFIKLLIDYKDVSPSIS+TALKTIRRH WYLNAEFIS  LFS+ +S  EK         L+E ++G+     E R +H        H V+F
Sbjct:  586 ECPIPANASLNDLEFIKLLIDYKDVSPSISQTALKTIRRHFWYLNAEFISMVLFSQRISVDEKNSLAACLRQLMEKSSGDQ---KEERCIHSTKYPSAFHNVTF 686          
The following BLAST results are available for this feature:
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A4JD511.020e-3333.09Uncharacterized protein (Fragment) OS=Heliothis vi... [more]
A0A2S2PVY42.472e-3336.86Uncharacterized protein OS=Sipha flava OX=143950 G... [more]
T1FGT83.148e-3331.88Uncharacterized protein OS=Helobdella robusta OX=6... [more]
J9M4P22.057e-3234.67Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
T1EUJ23.254e-3233.21Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047115.14.365e-6288.89SMESG000047115.1[more]
SMESG000004000.18.551e-6288.89SMESG000004000.1[more]
SMESG000047115.11.274e-5488.89SMESG000047115.1[more]
SMESG000047115.11.619e-5488.89SMESG000047115.1[more]
SMESG000047115.13.415e-5488.89SMESG000047115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030259 ID=SMED30030259|Name=Reverse transcriptase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2296bp
TCTATTAACAGAAATAAATCAGAGGTAAAGTTATATATTTATTATTAAGA
TTAAGATTTATATTTTAATAAATCCACTGAAATATGTAGCGTATTTGAAA
CATGGTAATTATGATTTCATATCATAGAAGTTTAAATATCAAACTTACTA
TCCAATTGTAGCAATAGTTAAATTGAAACATACTGAAATCCAAAACTTGA
TTTTTCAACGCATTGTATTGTATAAGCGTGTTTTTGCATAACCTGATCGA
TAATAAACCGCATGCGCTCTATTAGAATCATGCCTGGTGACTGGGCTGTC
TGTCCATGGTAAACAAAGAATCCTTTTCTGCTGCAGCCAGAAAACGGTTG
CTCGTGCAGAGGCTGCTAGGGGCGCCATCCTGTATAAACAGACTGCCTTG
CTTGGATATGTCTCATCTGGCATAAAATGGAAGTAAACTTTTGTGTGGAA
TGTTATGATAAGCCTCTGATTGGATAGATAATTTTTTGATTAAAGATGAT
TTTAGAGTAATTATTAATAAAAATAACATTGAAAAAGCCTCATCTATAAT
GCGCATTCTCACAGGTGAATGGTATGCTCTGGAATGGTACAAAATGATCC
ATCAGGGACATATAGCTGCTATGGTTGTTATTAGGTGTTGGGAAGCTTTT
GGGTGTTCCAAAATTTGAACAAGGACAGGGAAACCTGTTTCAGAGGCGGC
TGCAAATATTTCAAAAGATTAGCGACTAACAGAAAAAATCTCTGTCATGT
TGTTCGACACAACTGCGGTTAATACAGGCCACCTCAATGGAGCATGTGCT
ATTCTTGAAAAGACATTGAGTAAGAAGCGGATTTGGTTAGCGTGCAGACA
TCATATACTAGAGGTGATATGCGAAGAAGTCTTCAAAACGACATTTGGTG
GTAGTACAACTGGATCGGATGGGCTGCTATTCAAGCGCTTTAAGGCGTTT
TAGTTAAAAAAAATAAGAGAGGCAGAATTTAGTATATGCCACTATGTTCG
ACTTGAGCAAGATCTCAAGCCATTAAAAGAAGAAATCATTATATTTTGTT
CAAATATCCTACAAATAAAAGATAACTGAAGATATTTGCCGCGTGAGGAT
CACAAAGATTTTCTGACTCTCAATCTAATCTTCCTGGGAAAAATTCTCCC
CTCGGGGTGCATTTTCGTGTTCCTGGAGCTTATCACCATACAAGGTGGAT
GTCTAAAATATATATATATCATGAATATTTATCTCTTCCGTCATCAATTC
AAGATGACTAAGCATAAAGACAGATCAATTGCAGAATTTGCTTTTTTTGC
ATCTTTGGTTTATATTACAGCTTGGATTCAGTGTCCTATTCCAGCAAACG
CATCTCTGAATGATCTGGAGTTCATCAAGCTTCTTATTGATTATAAGGAT
GTTTCTCCCTCCATTTCTGAGACCGCATTGAAAACGATTCGCCGACATCT
CTGGTACCTTAATGCAGAATTCATTTCTCTTTTCTCAAAGTATCTCAGTG
GATGAGAAAAACAGCCTTACTGCTTGCTTGAGGCAACTAATGGAGAAATC
TTCTGGTGATCAGAAAGAAGAAAGGTGCATCCGCAGCACAAAGTATCCTT
CAGCATTTCATAATGTGACATTTAAGGATTTTGTGACCTCGTCGTTTCTG
CTCTTTATTGCTCTTCTGCTTTCCACAATTTTTTCTCCGACCGATGCTTC
TACCAGGCAACAAACTCCATCCTTTCAGAAAGCAACAGCAATGGTCTCTT
CCTTGAATGTTGTCAATGACTGTGCCGAGCGAGGAATTGCACTGGTGTCA
TCATTCAACTCATTTCTCACCAAATCAAAGGAGGAAAAGGAAACTTTTGA
ACAGCATCGCAAAGAGTTTCCAGGTGCAAAAAAATCAACTGTGCTGAAGA
GATCGCAATTTGAAAACCTTCAGGACTCAGAAAGTTCAGACTAAAAAACT
TTAAAGTGTATTTTTAAATGGCCTACTTATATGTACTCTGCAATACAGTC
AGGTAAATGTGTCATGTAACTAGTATTATTTTACTGTTTATTTTCTACAT
TGTAATAAAATTGTTCTTTGTATCTAAAAAACAGCTTTTTAAACATTGCA
AAATTTTAATTTAATGCAACTGCCGAATGCCATAAAACACGAGATAACAA
ATGCGCTGAGGCAGTATTTATAGGAGCCGAAATGCTGTGAAATTTGGTAT
ATACACGTTTTAAATCCCAGTGAACCAGAAAACTAAAATGCTCATGATAA
AAAACCCTATTTATCTTTTTCTATTATAAAGTGAACCACCCAGATC
back to top

protein sequence of SMED30030259-orf-1

>SMED30030259-orf-1 ID=SMED30030259-orf-1|Name=SMED30030259-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MQNSFLFSQSISVDEKNSLTACLRQLMEKSSGDQKEERCIRSTKYPSAFH
NVTFKDFVTSSFLLFIALLLSTIFSPTDASTRQQTPSFQKATAMVSSLNV
VNDCAERGIALVSSFNSFLTKSKEEKETFEQHRKEFPGAKKSTVLKRSQF
ENLQDSESSD*
back to top