Ferritin

Overview
NameFerritin
Smed IDSMED30030240
Length (bp)816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ferritin (SMED30030240) t-SNE clustered cells

Violin plots show distribution of expression levels for Ferritin (SMED30030240) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ferritin (SMED30030240) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ferritin (SMED30030240) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030240

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030240SMESG000039456.1 SMESG000014076.1 Contig7703GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v4_443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030240SMESG000039456.1 SMESG000014076.1 dd_Smed_v6_443_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 195.282 bits (495), Expect = 3.369e-62
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 1
Query:  259 TSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            TSQVRQN+H + E  IN QIN EL+ASYVY +MS+YF+RDDVAL+ F+ +F  QS EEREHAEKLMK QN RGGRI L+DI KP   +W +   A E AL LEK+VNQSLL LHK+A   NDP + D++E  +L EQV ++KE+ DH+TN+R+ G   +G+  YL+DK TL
Sbjct:    6 TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 195.282 bits (495), Expect = 3.369e-62
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 1
Query:  259 TSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            TSQVRQN+H + E  IN QIN EL+ASYVY +MS+YF+RDDVAL+ F+ +F  QS EEREHAEKLMK QN RGGRI L+DI KP   +W +   A E AL LEK+VNQSLL LHK+A   NDP + D++E  +L EQV ++KE+ DH+TN+R+ G   +G+  YL+DK TL
Sbjct:    6 TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Human
Match: FTMT (ferritin mitochondrial [Source:HGNC Symbol;Acc:HGNC:17345])

HSP 1 Score: 176.022 bits (445), Expect = 8.039e-54
Identity = 94/171 (54.97%), Postives = 117/171 (68.42%), Query Frame = 1
Query:  259 TSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
             S+VRQNFH + E  IN QIN EL+ASYVY +M++YF+RDDVAL  FS +F  QS EE EHAEKLM+ QN RGGRI L+DI KP   +W     A E AL LEK+VNQSLL LH +A    DP + D+LE  +L EQV S+KE+ DH+ N+ + G    G+  YL+D  TL
Sbjct:   65 PSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTL 235          
BLAST of Ferritin vs. Ensembl Human
Match: FTL (ferritin light chain [Source:HGNC Symbol;Acc:HGNC:3999])

HSP 1 Score: 168.318 bits (425), Expect = 1.169e-51
Identity = 83/174 (47.70%), Postives = 124/174 (71.26%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW--TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTLK 759
            M+SQ+RQN+ ++ E  +N  +N  L ASY Y ++ FYF+RDDVAL+G S+FF + + E+RE  E+L+K QN RGGR + +DI KP+  EW  TP+ A ++A+ALEK +NQ+LL+LH +     DP + D+LE  FL+E+V  +K++ DH+TN+ R G    G+G YL+++LTLK
Sbjct:    1 MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPD-AMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLK 173          
BLAST of Ferritin vs. Ensembl Human
Match: FTHL17 (ferritin heavy chain like 17 [Source:HGNC Symbol;Acc:HGNC:3987])

HSP 1 Score: 161.77 bits (408), Expect = 4.546e-49
Identity = 82/170 (48.24%), Postives = 117/170 (68.82%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            SQVRQ + + C+  IN  I  EL+ SY+Y +M+FYFNRDDVAL+ F  +F + S ++ EHA+KLM+ QN+RGG I L DI KP    W +   A ESA  LEK+VNQSLL+L+++A    DPQ+  +LE  +L EQV ++KE+  +++N+R+  +   G+  YL+DKLTL
Sbjct:    7 SQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTL 176          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 187.963 bits (476), Expect = 7.016e-60
Identity = 95/164 (57.93%), Postives = 121/164 (73.78%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDK 747
            S  RQN+HSE E  +N QIN EL+ASYVY +MSFYF+RDDVAL   + FF +QS EEREHA +LM+ QN+RGGR+VL+DI KP   EW T   AFE+ALALEK  N+SLL LH  A  HND  +TD++E+ +L+EQV S+ E A  + N++R G GVG Y++DK
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDK 165          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 187.963 bits (476), Expect = 7.016e-60
Identity = 95/164 (57.93%), Postives = 121/164 (73.78%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDK 747
            S  RQN+HSE E  +N QIN EL+ASYVY +MSFYF+RDDVAL   + FF +QS EEREHA +LM+ QN+RGGR+VL+DI KP   EW T   AFE+ALALEK  N+SLL LH  A  HND  +TD++E+ +L+EQV S+ E A  + N++R G GVG Y++DK
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDK 165          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 174.866 bits (442), Expect = 7.984e-55
Identity = 89/164 (54.27%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYL-EDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDK 747
            S  RQN+H E E  +N QIN EL+ASYVY +MS +F+RDD+AL+  + FF +QS EER HA +LM+ Q +RGGR+ +++I KP   EW T   AFE+ALALE+  N SLL LH IAE  ND  +T+Y+ E +LEEQV S+ E A +I NI+R G G+G YL+DK
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDK 165          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 174.866 bits (442), Expect = 7.984e-55
Identity = 89/164 (54.27%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYL-EDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDK 747
            S  RQN+H E E  +N QIN EL+ASYVY +MS +F+RDD+AL+  + FF +QS EER HA +LM+ Q +RGGR+ +++I KP   EW T   AFE+ALALE+  N SLL LH IAE  ND  +T+Y+ E +LEEQV S+ E A +I NI+R G G+G YL+DK
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDK 165          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer3HCH (gene:FBgn0030449 transcript:FBtr0073745)

HSP 1 Score: 150.984 bits (380), Expect = 4.833e-45
Identity = 76/173 (43.93%), Postives = 110/173 (63.58%), Query Frame = 1
Query:  232 C*ISIHKIMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDK 747
            C   I + M   VRQNF   CE  +NDQIN EL AS+ Y AM+++F+R D++  G   FF K S+EEREHAEK+M Y N RGG I+L  + +P     +   A + A+ +E +VN+ LL+LH +A    DP + D++E +FL+EQVD  K +AD+I+ + +    VG +L+DK
Sbjct:    4 CFRDIRRHMCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVDGQKILADYISQLEKAQNQVGEFLFDK 176          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0344763)

HSP 1 Score: 91.2781 bits (225), Expect = 2.750e-22
Identity = 61/164 (37.20%), Postives = 92/164 (56.10%), Query Frame = 1
Query:  292 CEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRG----GRIVLKDIAKPSIVEWT-PETAFESALALEKDVNQSLLNLHKIAET--HNDPQMTDYLED-FLEEQVDSMKEIADHITNIRR----NGTGVGIYLYDK 747
            C  G+ +QI +E++ASY Y AM  YF+RD V   GF+  F K + EEREH  KL++Y ++RG    G   L ++   +  EWT    A   AL LE  V +S+  L +  E   +N   + DYL   +LEEQ+   +E+A  +T +++    NG  +G +L+DK
Sbjct:    5 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGE-LGEFLFDK 167          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085633)

HSP 1 Score: 91.6633 bits (226), Expect = 4.204e-22
Identity = 64/184 (34.78%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  232 C*ISIHKIMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRG----GRIVLKDIAKPSIVEWT-PETAFESALALEKDVNQSLLNLHKIAE--THNDPQMTDYLED-FLEEQVDSMKEIADHITNIRR----NGTGVGIYLYDK 747
            C +++ +I    V  +    C  G+ +QI +E++ASY Y AM  YF+RD V   GF+  F K + EEREH  KL++Y ++RG    G   L ++   +  EWT    A   AL LE  V +S+  L +  E   +N   + DYL   +LEEQ+   +E+A  +T +++    NG  +G +L+DK
Sbjct:   23 CSLAVPEITKDWV--DMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGE-LGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085632)

HSP 1 Score: 91.6633 bits (226), Expect = 4.204e-22
Identity = 64/184 (34.78%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  232 C*ISIHKIMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRG----GRIVLKDIAKPSIVEWT-PETAFESALALEKDVNQSLLNLHKIAE--THNDPQMTDYLED-FLEEQVDSMKEIADHITNIRR----NGTGVGIYLYDK 747
            C +++ +I    V  +    C  G+ +QI +E++ASY Y AM  YF+RD V   GF+  F K + EEREH  KL++Y ++RG    G   L ++   +  EWT    A   AL LE  V +S+  L +  E   +N   + DYL   +LEEQ+   +E+A  +T +++    NG  +G +L+DK
Sbjct:   23 CSLAVPEITKDWV--DMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGE-LGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085631)

HSP 1 Score: 91.6633 bits (226), Expect = 4.204e-22
Identity = 64/184 (34.78%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  232 C*ISIHKIMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRG----GRIVLKDIAKPSIVEWT-PETAFESALALEKDVNQSLLNLHKIAE--THNDPQMTDYLED-FLEEQVDSMKEIADHITNIRR----NGTGVGIYLYDK 747
            C +++ +I    V  +    C  G+ +QI +E++ASY Y AM  YF+RD V   GF+  F K + EEREH  KL++Y ++RG    G   L ++   +  EWT    A   AL LE  V +S+  L +  E   +N   + DYL   +LEEQ+   +E+A  +T +++    NG  +G +L+DK
Sbjct:   23 CSLAVPEITKDWV--DMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGE-LGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 206.838 bits (525), Expect = 4.913e-67
Identity = 103/172 (59.88%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M+SQVRQNF   CE  +N QIN EL+ASYVY +MS+YF+RDD AL  F+ FF  QS EEREHAEKLMK+QN RGGRI L+D+ KP   EW     A E AL LEK VN SLL LHK+A  HNDP M D++E  +L+EQV S+KE+ DH+TN+RR G    G+  Y++DKLTL
Sbjct:    1 MSSQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 206.838 bits (525), Expect = 4.913e-67
Identity = 103/172 (59.88%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M+SQVRQNF   CE  +N QIN EL+ASYVY +MS+YF+RDD AL  F+ FF  QS EEREHAEKLMK+QN RGGRI L+D+ KP   EW     A E AL LEK VN SLL LHK+A  HNDP M D++E  +L+EQV S+KE+ DH+TN+RR G    G+  Y++DKLTL
Sbjct:    1 MSSQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1b (ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040912-30])

HSP 1 Score: 189.504 bits (480), Expect = 3.447e-60
Identity = 99/172 (57.56%), Postives = 122/172 (70.93%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M+SQVRQNFH ECE  IN QI  EL+ASYVY +M +YF+RDD +L  F+ FF  QS EEREHAEKLM  QN RGGRI L+DI KP   EW +   A E ALALEK VN SLL LHK+A  HNDP + D+LE  +L+EQV S+KE++D + ++RR G     +  YL+D+ TL
Sbjct:    1 MSSQVRQNFHQECEAAINRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFRDQSKEEREHAEKLMSLQNQRGGRIFLQDIKKPDRDEWGSGLEALECALALEKSVNLSLLELHKVATQHNDPHVCDFLETHYLDEQVKSIKELSDWVGSLRRMGAPQNNMAEYLFDRHTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl27 (ferritin, heavy polypeptide-like 27 [Source:ZFIN;Acc:ZDB-GENE-040718-72])

HSP 1 Score: 188.348 bits (477), Expect = 9.911e-60
Identity = 96/172 (55.81%), Postives = 123/172 (71.51%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            M SQVRQN+  +CE  IN  IN EL+A Y Y +M+FYF+RDDVAL GF+ FF K S EEREHAEK M++QN RGGRIVL+DI KP   EW    TA + AL LEK+VNQ+LL+LHK+A    DP + D+LE  +L EQV+++K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    1 MDSQVRQNYDRDCEALINKMINLELYAGYTYTSMAFYFDRDDVALPGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPERDEWDNGLTAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl28 (ferritin, heavy polypeptide-like 28 [Source:ZFIN;Acc:ZDB-GENE-030131-7540])

HSP 1 Score: 181.8 bits (460), Expect = 3.347e-57
Identity = 92/171 (53.80%), Postives = 120/171 (70.18%), Query Frame = 1
Query:  259 TSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            T Q+RQN+ S+CE  IN  IN EL+A Y Y +M+ YF RDDVAL GF+ FF K S EEREHAEK M++QN RGGRIVL+DI KP    W     A + AL LEK+VNQ+LL+LHK+A    DP + D+LE  +L+EQV+++K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    3 TCQIRQNYDSDCEASINKMINLELYAGYTYTSMAHYFKRDDVALNGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPDRDVWDNGLIAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLETHYLDEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Xenopus
Match: nop53 (NOP53 ribosome biogenesis factor [Source:Xenbase;Acc:XB-GENE-853827])

HSP 1 Score: 208.764 bits (530), Expect = 1.475e-67
Identity = 106/174 (60.92%), Postives = 128/174 (73.56%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTLKE 762
            M SQVRQN+H ECE  IN Q+N EL+ASYVY +M++YF+RDDVAL+ FS +F  QS EEREHAEKLMK QN RGGRI L+D+ KP   EW     A E +L LEK VNQSLL LHK++  HNDP + D+LE  +L+EQV SMKE+ DHITN+RR G    G+  YL+DK TL E
Sbjct:    1 MNSQVRQNYHQECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKMQNQRGGRIFLQDVKKPDRDEWANGLEALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRRMGAPSNGMAEYLFDKHTLGE 174          
BLAST of Ferritin vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:NCBI gene;Acc:394604])

HSP 1 Score: 199.134 bits (505), Expect = 7.925e-64
Identity = 102/174 (58.62%), Postives = 129/174 (74.14%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTLKE 762
            M SQVRQNF+S+CE  IN  +N EL+ASYVY +MS+YF+RDDVAL   + FF +QS EEREHAEK +KYQN RGGR VL+DI KP   EW     A ++AL LEK VNQ+LL+LHK+A    DP + D+LE ++LEEQV +MKE+ D+ITN++R G    G+G YL+DK TL E
Sbjct:    1 MQSQVRQNFNSDCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRAVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEYLEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDKHTLGE 174          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC75752 (uncharacterized protein MGC75752 [Source:NCBI gene;Acc:394820])

HSP 1 Score: 186.037 bits (471), Expect = 1.394e-58
Identity = 95/170 (55.88%), Postives = 123/170 (72.35%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            SQ+RQN+H E E GIN   N EL  SYVY ++ +YF+RDDVAL  FS ++ + S ++R+HAE L+K+QN RGGR+VL+DI KP   EW   T A E AL LEK VNQ+LL+LHKIA  H DP M DYLE +FLEE+V  +K++ DH+TN++R      G+G YL+DKLTL
Sbjct:    5 SQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTL 174          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 179.104 bits (453), Expect = 5.039e-56
Identity = 94/172 (54.65%), Postives = 121/172 (70.35%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M SQVRQN+  +CE  +N  +N E++ASY Y +MS YF+RDDVAL   + FF +QS EERE AEKLMK QN RGGRIVL+DI KP   EW +   A ++AL LEK VNQ+LL+LH +A    DP + D+LE + L+EQV  MK+  DHITN++R G    G+G YL+DK +L
Sbjct:    1 MISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHSL 172          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 178.718 bits (452), Expect = 7.934e-56
Identity = 94/171 (54.97%), Postives = 120/171 (70.18%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLT 753
            M SQVRQN+  +CE  +N  +N E++ASY Y +MS YF+RDDVAL   + FF +QS EERE AEKLMK QN RGGRIVL+DI KP   EW +   A ++AL LEK VNQ+LL+LH +A    DP + D+LE + L+EQV  MK+  DHITN++R G    G+G YL+DK T
Sbjct:    1 MISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHT 171          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 190.66 bits (483), Expect = 1.456e-60
Identity = 100/170 (58.82%), Postives = 123/170 (72.35%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            SQVRQN+H + E  IN QIN EL+ASYVY +MS YF+RDDVAL+ F+ +F  QS EEREHAEKLMK QN RGGRI L+DI KP   +W +   A E AL LEK VNQSLL LHK+A   NDP + D++E  +L EQV S+KE+ DH+TN+R+ G    G+  YL+DK TL
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 190.66 bits (483), Expect = 1.456e-60
Identity = 100/170 (58.82%), Postives = 123/170 (72.35%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            SQVRQN+H + E  IN QIN EL+ASYVY +MS YF+RDDVAL+ F+ +F  QS EEREHAEKLMK QN RGGRI L+DI KP   +W +   A E AL LEK VNQSLL LHK+A   NDP + D++E  +L EQV S+KE+ DH+TN+R+ G    G+  YL+DK TL
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftmt (ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:1914884])

HSP 1 Score: 187.193 bits (474), Expect = 2.007e-58
Identity = 98/170 (57.65%), Postives = 121/170 (71.18%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            S+VRQNFH + E  IN QIN EL+ASYVY +M++YF+RDDVAL  FS +F +QSLEEREHAEKLMK QN RGGRI L+DI KP   +W     A E AL LEK+VNQSLL+LH +A    DP + D+LE  +L EQV S+KE+ DH+ N+   G    G+  YL+DK TL
Sbjct:   62 SRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLAEYLFDKHTL 231          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1 (ferritin light polypeptide 1 [Source:MGI Symbol;Acc:MGI:95589])

HSP 1 Score: 161.77 bits (408), Expect = 3.189e-49
Identity = 80/181 (44.20%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG------TG-----VGIYLYDKLTLK 759
            MTSQ+RQN+ +E E  +N  +N  L ASY Y ++ F+F+RDDVAL+G  +FF + + E+RE AE+L+++QN RGGR + +D+ KPS  EW   + A E+ALA+EK++NQ+LL+LH +     DP + D+LE  +L+++V  +K++ +H+TN+RR        TG     +G YL+++LTLK
Sbjct:    1 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLK 181          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1-ps1 (ferritin light polypeptide 1, pseudogene 1 [Source:MGI Symbol;Acc:MGI:3779109])

HSP 1 Score: 161.77 bits (408), Expect = 3.189e-49
Identity = 80/181 (44.20%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG------TG-----VGIYLYDKLTLK 759
            MTSQ+RQN+ +E E  +N  +N  L ASY Y ++ F+F+RDDVAL+G  +FF + + E+RE AE+L+++QN RGGR + +D+ KPS  EW   + A E+ALA+EK++NQ+LL+LH +     DP + D+LE  +L+++V  +K++ +H+TN+RR        TG     +G YL+++LTLK
Sbjct:    1 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLK 181          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P42577|FRIS_LYMST (Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 2.868e-70
Identity = 108/170 (63.53%), Postives = 133/170 (78.24%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTL 756
            +  SQ RQN+H+E E GIN QIN EL+ASY YQ+M++YF+RDDVAL GF  FF  QS EEREHAEKLMKYQN RGGRIVL+DI KP   EW T   A + AL LEK VNQSLL+LHK+  +H+D QM D+LE +FLEEQV S+KE++D+ITN++R G G+G Y++DK TL
Sbjct:    1 MSVSQARQNYHAESEAGINRQINMELYASYSYQSMAYYFDRDDVALPGFHKFFKHQSEEEREHAEKLMKYQNKRGGRIVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKLCTSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKRVGPGLGEYIFDKETL 170          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|Q7SXA6|FRIH3_XENLA (Ferritin heavy chain, oocyte isoform OS=Xenopus laevis OX=8355 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 8.252e-67
Identity = 105/174 (60.34%), Postives = 129/174 (74.14%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTLKE 762
            M SQ+RQNFH ECE  IN Q+N EL+ASYVY +MS+YF+RDDVAL+ F+ +F  QS EEREHAEKLMK QN RGGR+ L+DI KP   EW     A E +L LEK+VNQS+L LHK++  HNDP + D+LE  +L+EQV SMKE+ DHITN+RR G    G+  YL+DK TL E
Sbjct:    1 MNSQIRQNFHQECEAAINRQVNMELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKMQNQRGGRLFLQDIKKPERDEWANGLEALECSLQLEKNVNQSILELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRRMGAPSNGLAEYLFDKHTLGE 174          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85838|FRIH_PSEBE (Ferritin, heavy subunit OS=Pseudotrematomus bernacchii OX=40690 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.797e-66
Identity = 104/172 (60.47%), Postives = 130/172 (75.58%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M SQVRQNFH +CE  IN QIN EL+ASY Y +M++YF+RDDVAL GF++FF +QS EEREHAEKL+K+QN RGGRI L+D+ KP   EW +   A E AL LEK+VNQSLL+LHK+   HNDP M D+LE  +L+EQV S+KE+ D +TN+RR G    G+  YL+DK TL
Sbjct:    1 MESQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKQQSEEEREHAEKLLKFQNQRGGRIFLQDVKKPDRDEWGSGLDALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P49946|FRIH_SALSA (Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.920e-65
Identity = 104/172 (60.47%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            MTSQVRQNFH +CE  IN QIN EL+ASYVY +M++YF+RDD AL  F+ FF  QS EEREHAEKLMK QN RGGRI L+D+ KP   EW     A ES+L LEK VNQSLL+LHK+   HNDP M D++E  +L+EQV S+KE+ D +TN+RR G    G+  YL+DK TL
Sbjct:    1 MTSQVRQNFHQDCEAAINRQINLELYASYVYLSMAYYFDRDDQALHNFAKFFKNQSHEEREHAEKLMKVQNQRGGRIFLQDVKKPEKDEWGSGVEALESSLQLEKSVNQSLLDLHKVCSEHNDPHMCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85837|FRIH_TRENE (Ferritin, heavy subunit OS=Trematomus newnesi OX=35730 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.095e-65
Identity = 105/172 (61.05%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M SQVRQNFH +CE  IN QIN EL+ASY Y +M++YF+RDDVAL GF++FF  QS EEREHAEKLMK QN RGGRI L+D+ KP   EW +   A E AL LEK+VNQSLL+LHK+   HNDP M D+LE  +L+EQV S+KE+ D +TN+RR G    G+  YL+DK TL
Sbjct:    1 MESQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKHQSEEEREHAEKLMKQQNQRGGRIFLQDVKKPDRDEWGSGLDALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A2T7P6A6 (Ferritin OS=Pomacea canaliculata OX=400727 GN=C0Q70_11560 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.494e-72
Identity = 110/172 (63.95%), Postives = 139/172 (80.81%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            +  SQ RQN+H+ECE GIN QIN ELHASY YQ+M+FYF+RDDVAL GFS FF + S EEREHAEKLMK+QN RGGRIVL+DI KP   EW T   A + AL+LEK VNQSLL+LH++A +H+D QMTD+LE +FL+EQV ++KE+ DHITN++R G+G+G Y+YDK +L +
Sbjct:    1 MAVSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFSKFFSENSKEEREHAEKLMKFQNKRGGRIVLQDIKKPDRDEWGTGLDAMQVALSLEKSVNQSLLDLHELAASHSDGQMTDFLEGEFLQEQVKAIKELGDHITNLKRVGSGLGEYMYDKESLSD 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A1X9WEL1 (Ferritin (Fragment) OS=Conus litteratus OX=89445 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.645e-72
Identity = 110/172 (63.95%), Postives = 138/172 (80.23%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            +  SQ RQN+H+ECE GIN QIN ELHASY YQ+M+FYF+RDDVAL GF+ FF K S EEREHAEKLM +QN RGGRIVL+DI KP   EW +   A + ALALEK VNQSLL+LH++A +HND QMTD+LE ++L+EQV S+KE+ D+ITN++R G G+G Y++DK TL+E
Sbjct:    1 MAVSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATSHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETLQE 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A1S5WGT2 (Ferritin OS=Conus miles OX=69564 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.645e-72
Identity = 110/172 (63.95%), Postives = 138/172 (80.23%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            +  SQ RQN+H+ECE GIN QIN ELHASY YQ+M+FYF+RDDVAL GF+ FF K S EEREHAEKLM +QN RGGRIVL+DI KP   EW +   A + ALALEK VNQSLL+LH++A +HND QMTD+LE ++L+EQV S+KE+ D+ITN++R G G+G Y++DK TL+E
Sbjct:    1 MAVSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATSHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETLQE 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A1Q1NAC5 (Ferritin (Fragment) OS=Conus araneosus OX=101286 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.645e-72
Identity = 110/172 (63.95%), Postives = 138/172 (80.23%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            +  SQ RQN+H+ECE GIN QIN ELHASY YQ+M+FYF+RDDVAL GF+ FF K S EEREHAEKLM +QN RGGRIVL+DI KP   EW +   A + ALALEK VNQSLL+LH++A +HND QMTD+LE ++L+EQV S+KE+ D+ITN++R G G+G Y++DK TL+E
Sbjct:    1 MAVSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATSHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETLQE 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A346CIQ0 (Ferritin OS=Conus ermineus OX=55423 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.645e-72
Identity = 110/172 (63.95%), Postives = 138/172 (80.23%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            +  SQ RQN+H+ECE GIN QIN ELHASY YQ+M+FYF+RDDVAL GF+ FF K S EEREHAEKLM +QN RGGRIVL+DI KP   EW +   A + ALALEK VNQSLL+LH++A +HND QMTD+LE ++L+EQV S+KE+ D+ITN++R G G+G Y++DK TL+E
Sbjct:    1 MAVSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATSHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETLQE 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:103039853])

HSP 1 Score: 208.764 bits (530), Expect = 8.218e-68
Identity = 107/172 (62.21%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M+SQVRQNFH +CE  IN QIN EL+ASYVY +MS+YF+RDD AL  F+ FFHKQS EEREHAEKLMK QN RGGRI L+DI KP   EW     A E AL LEK VNQSLL+LHK+A   NDP M D++E  +L+EQV S+KE+AD ++N+RR G    G+  YL+DK TL
Sbjct:    1 MSSQVRQNFHQDCEAAINRQINLELYASYVYLSMSYYFDRDDQALPNFAKFFHKQSHEEREHAEKLMKLQNQRGGRIFLQDIRKPERDEWGSGVEALECALQLEKSVNQSLLDLHKVASERNDPHMCDFIETHYLDEQVKSIKELADWVSNLRRMGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033875.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029096])

HSP 1 Score: 189.889 bits (481), Expect = 2.087e-60
Identity = 93/172 (54.07%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            MTSQ+RQN+HS+CE  IN  +N E +ASY Y +M++YF+RDDVAL+GF++FF + S EEREHAEK +++QN RGGR+ L+DI KP   EW T   A + AL LEK VNQ+LL+LHKIA    DP + D+LE ++L EQV+ +K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    1 MTSQIRQNYHSDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHKIASEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000048516.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 187.193 bits (474), Expect = 2.541e-59
Identity = 94/172 (54.65%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            M SQVRQN+H +CE  IN  +N EL ASY Y +M++YF+RDDVAL+GF++FF + S EE+EHAEKL+ +QN RGGRI L+DI KP   EW T   A + AL LEK+VNQ+LL+LHKIA    DP + D+LE  +L EQV+++K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    1 MNSQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000042393.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 184.882 bits (468), Expect = 2.022e-58
Identity = 93/170 (54.71%), Postives = 124/170 (72.94%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            SQVRQN+H +CE  IN  +N EL ASY Y +M++YF+RDDVAL+GF++FF + S EE+EHAEKL+ +QN RGGRI L+DI KP   EW T   A + AL LEK+VNQ+LL+LHKIA    DP + D+LE  +L EQV+++K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    4 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000052792.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 178.333 bits (451), Expect = 6.451e-56
Identity = 89/170 (52.35%), Postives = 121/170 (71.18%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTG---VGIYLYDKLTL 756
            S VRQN+H +CE  IN  +N E +ASY Y +M++YF+RDDVAL+GF++FF + S EEREHAEK +++QN RGGR+ L+DI KP   EW T   A + AL LEK VNQ+LL+LH IA    DP + D+LE ++L EQV+ +K++ DHITN+ +   G   +  YL+DK TL
Sbjct:    4 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNKMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009047.1 (pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 gene:ENSPMAG00000008168.1 transcript:ENSPMAT00000009047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.601 bits (514), Expect = 5.229e-66
Identity = 103/170 (60.59%), Postives = 129/170 (75.88%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            S VRQNF  ECE  IN QIN+EL+ASYVY +M+FYF+RDDVAL+  S FF +QSLEER HAEKLM YQN RGGRI L+D+ KP   EW     A   AL LEK+VNQ+LL LH +A  HNDPQ+ D+L+  +LEEQV+S+K IADHIT++++ G   +G+G +L+DKLTL
Sbjct:    7 SLVRQNFSEECEAAINRQINQELYASYVYLSMAFYFDRDDVALKHLSKFFREQSLEERGHAEKLMGYQNRRGGRIFLQDVQKPERDEWGNALEALTLALQLEKNVNQALLELHALATEHNDPQLCDFLDSHYLEEQVESIKNIADHITSLKKMGVPQSGMGEFLFDKLTL 176          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009440.1 (pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 gene:ENSPMAG00000008472.1 transcript:ENSPMAT00000009440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 4.712e-65
Identity = 101/172 (58.72%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            MTSQVRQN+  + E  IN QIN EL ASYVY +M++YF+RDDVAL  F  FF +QS EEREHAEKLM YQN RGGR+VLKD+ KP   EW +   A + AL LEK+VNQSLL+LH +    NDPQ+ D+LE  +LEEQV+++K++ D +TN++R G   +G+G YL+DKLTL
Sbjct:    1 MTSQVRQNYAQDVEAAINRQINMELSASYVYLSMAYYFDRDDVALNNFFKFFKEQSHEEREHAEKLMAYQNKRGGRVVLKDVKKPERDEWGSGLEAVQLALQLEKNVNQSLLDLHALGSKENDPQLCDFLESHYLEEQVEAIKKLGDFVTNLKRLGASQSGMGEYLFDKLTL 172          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006438.1 (pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-1 gene:ENSPMAG00000005680.1 transcript:ENSPMAT00000006438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 1.406e-63
Identity = 99/172 (57.56%), Postives = 130/172 (75.58%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            MTSQ+RQNF  E E  IN Q+N+EL+ASYVY +++ YF+RDDVAL+ F  FF   S EEREHAEKL++YQN RGGR VL+DI KP   EW +   A + AL LEK VNQ+LL+LH +A    DPQ+ D+LE +FLEEQV+S+K++ DH+TN++R G   +G+G YL+DK+TL
Sbjct:    1 MTSQIRQNFSQEVEAAINRQVNQELYASYVYLSLASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKTDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPQSGMGEYLFDKMTL 172          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008696.1 (pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 gene:ENSPMAG00000007869.1 transcript:ENSPMAT00000008696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 1.677e-61
Identity = 93/172 (54.07%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  253 IMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWT-PETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            IM SQVRQN+  + E  IN Q+N  LHASYV+ +++ YF+RDDVAL+ F  FF + S +EREHA+KL+ YQN RGGR+VL+DI  P   +W     A ++AL L+K +NQSLL+LH  A   NDPQ+ ++L+DFLEEQV+S+K++ DHITN++R G   +G+G YLY++LTL
Sbjct:    4 IMASQVRQNYSPDVEAAINRQVNMTLHASYVFLSLASYFDRDDVALKNFRKFFKELSDKEREHADKLLAYQNKRGGRVVLRDIKTPERDDWGHILEAMQTALQLQKSINQSLLDLHGQAREKNDPQLCEFLKDFLEEQVESIKKLGDHITNLKRLGVPQSGLGEYLYERLTL 175          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006468.1 (pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1 gene:ENSPMAG00000005828.1 transcript:ENSPMAT00000006468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 4.846e-61
Identity = 100/174 (57.47%), Postives = 128/174 (73.56%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIA--KPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNG---TGVGIYLYDKLTL 756
            MTSQ+RQNF  E E  IN Q+N+EL+ASYVY +M+ YF+RDDVAL+ F  FF   S EEREHAEKL++YQN RGGR VL+DI   KP   EW +   A + AL LEK VNQ+LL+LH +A    DPQ+ D+LE +FLEEQV+S+K++ DH+TN++R G   +  G YL+DKLTL
Sbjct:    5 MTSQIRQNFSQEVEAAINRQVNQELYASYVYLSMASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKEQKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKKDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPHSTTGEYLFDKLTL 178          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO39948 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6])

HSP 1 Score: 202.216 bits (513), Expect = 8.093e-66
Identity = 102/167 (61.08%), Postives = 127/167 (76.05%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTL 756
            S  RQN+H ECE GIN QIN EL+ASY Y +M+F+F+RDDVAL GF  +F K S EEREHAEKLMK+QN RGGRIVL+DI KP   EW     + + AL LEK VNQ+LL+LHKIAE H D QMTD++E +FL EQV+++KE+A H+TN++R G G+G Y YD  T+
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQNERGGRIVLQDIKKPEKDEWGCGMDSIQVALDLEKHVNQALLDLHKIAEKHGDAQMTDFIEGNFLTEQVEAIKELAGHLTNLKRVGPGLGEYQYDHETI 168          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI7])

HSP 1 Score: 194.512 bits (493), Expect = 1.213e-62
Identity = 96/167 (57.49%), Postives = 127/167 (76.05%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTL 756
            S  RQN+H E E G+N QIN EL+ASYVY +M+++F+RDDVAL GF  +F K S EEREHAEKL K+Q  RGGRIVL+DI +P   +W   + A ++AL LEK VNQ+LL+LHK+AE H D QM D+LE  +L EQV+++KE+A H+TN++R G G+G + +DKLTL
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHLTNLKRVGPGLGEFQFDKLTL 170          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI8])

HSP 1 Score: 190.66 bits (483), Expect = 3.607e-61
Identity = 95/167 (56.89%), Postives = 126/167 (75.45%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTL 756
            S  RQN+H E E G+N QIN EL+ASYVY +M+F+F+RDDVAL GF  +F + S EEREHAEKL K+Q  RGGRIVL+DI +P   +W   + A ++AL LEK VNQ+LL+LHK+AE H D QM D+LE  +L EQV+++KE+A H+TN++R G G+G + +DK TL
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTL 170          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO32257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL1])

HSP 1 Score: 189.119 bits (479), Expect = 1.532e-60
Identity = 95/167 (56.89%), Postives = 125/167 (74.85%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTL 756
            S  RQN+H E E G+N QIN EL+ASYVY +M+F+F+RDDVAL GF  +F K S EEREHAEKL K+Q  RGGRIVL+DI +P   +W   + A ++AL LEK VNQ+L +LHK+AE H D QM D+LE  +L EQV+++KE+A H+TN++R G G+G + +DK TL
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALHDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTL 170          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO35374 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6])

HSP 1 Score: 188.734 bits (478), Expect = 1.905e-60
Identity = 94/169 (55.62%), Postives = 126/169 (74.56%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            S  RQN+H ECE GIN QIN EL+ASYVY +M+ YF+R+DV L GF  FF KQ+ EEREHAEKLMK+QN RGGRIVL+++ KP   EW +   A ++AL LEK VNQ+L+ L K AE + D QM+D++ED FL EQV+S++E++ +I  +++ G G+G+Y +D  TL E
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEKLMKFQNQRGGRIVLQNVKKPERDEWGSGLEAMQTALDLEKHVNQALIELEKTAEKNGDAQMSDFIEDHFLTEQVESIRELSGYIAVLKKVGPGLGVYQFDHETLGE 170          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000007389.2 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 192.586 bits (488), Expect = 1.915e-61
Identity = 100/172 (58.14%), Postives = 122/172 (70.93%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTLKE 762
            SQVR NFH +CE  IN QIN EL+ASYVY +M +YF+RDD AL  F+ FF KQS EE EHAEKLMK QN RGGRI L+DI KP   EW     A E AL LEK+VNQSLL++HK+    NDP + D++E  +L+EQV S+KE+ D +TN+RR G    G+  YL+DK TL E
Sbjct:    5 SQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGE 176          
BLAST of Ferritin vs. Ensembl Medaka
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:101155346])

HSP 1 Score: 192.971 bits (489), Expect = 2.184e-61
Identity = 100/176 (56.82%), Postives = 124/176 (70.45%), Query Frame = 1
Query:  244 IHKIMTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            I+  M SQ+RQNF+ +CE  IN QIN EL+ASYVY +M++YF RDD  L  F+ FF+ QS EEREHAEKLM  QN RGGRI L+DI KP   EW     A E AL LEK VNQSLL+L K+A  H DP M D++E  FL+EQV S+K++AD I+N+RR G    G+  YL+DK T+
Sbjct:   13 IYTKMNSQIRQNFNQDCEAAINRQINLELYASYVYLSMAYYFERDDKHLPNFAKFFNSQSKEEREHAEKLMSLQNKRGGRIFLQDIKKPDRDEWGSSLEALECALQLEKSVNQSLLDLQKLATDHGDPHMCDFIETHFLDEQVKSIKQLADWISNLRRMGAPQNGMAEYLFDKHTM 188          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000029876.1 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 192.586 bits (488), Expect = 2.253e-61
Identity = 100/172 (58.14%), Postives = 122/172 (70.93%), Query Frame = 1
Query:  262 SQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTLKE 762
            SQVR NFH +CE  IN QIN EL+ASYVY +M +YF+RDD AL  F+ FF KQS EE EHAEKLMK QN RGGRI L+DI KP   EW     A E AL LEK+VNQSLL++HK+    NDP + D++E  +L+EQV S+KE+ D +TN+RR G    G+  YL+DK TL E
Sbjct:    6 SQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGE 177          
BLAST of Ferritin vs. Ensembl Medaka
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:101155346])

HSP 1 Score: 191.43 bits (485), Expect = 4.726e-61
Identity = 99/172 (57.56%), Postives = 122/172 (70.93%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPET-AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRRNGT---GVGIYLYDKLTL 756
            M SQ+RQNF+ +CE  IN QIN EL+ASYVY +M++YF RDD  L  F+ FF+ QS EEREHAEKLM  QN RGGRI L+DI KP   EW     A E AL LEK VNQSLL+L K+A  H DP M D++E  FL+EQV S+K++AD I+N+RR G    G+  YL+DK T+
Sbjct:    1 MNSQIRQNFNQDCEAAINRQINLELYASYVYLSMAYYFERDDKHLPNFAKFFNSQSKEEREHAEKLMSLQNKRGGRIFLQDIKKPDRDEWGSSLEALECALQLEKSVNQSLLDLQKLATDHGDPHMCDFIETHFLDEQVKSIKQLADWISNLRRMGAPQNGMAEYLFDKHTM 172          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020971.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 191.43 bits (485), Expect = 6.073e-61
Identity = 96/172 (55.81%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEW-TPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLED-FLEEQVDSMKEIADHITNIRR---NGTGVGIYLYDKLTL 756
            M SQVRQN+H +CE  IN  +N EL ASY Y +M+FYF+RDDVAL GFS+FF + S EE+EHA+KL+ +QN RGGRI L+D+ KP   EW +   A + AL LEK+VNQ+LL+LHK+A  H DP M D+LE  +L EQV+S+K+I DHITN+ R   +   +  YL+DK TL
Sbjct:    1 MESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPERDEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTL 172          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000039456.1 (SMESG000039456.1)

HSP 1 Score: 351.288 bits (900), Expect = 3.270e-124
Identity = 168/169 (99.41%), Postives = 168/169 (99.41%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            MTSQVRQNFHSE EDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE
Sbjct:    1 MTSQVRQNFHSESEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 169          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000014076.1 (SMESG000014076.1)

HSP 1 Score: 351.288 bits (900), Expect = 3.270e-124
Identity = 168/169 (99.41%), Postives = 168/169 (99.41%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            MTSQVRQNFHSE EDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE
Sbjct:    1 MTSQVRQNFHSESEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 169          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068030.1 (SMESG000068030.1)

HSP 1 Score: 282.337 bits (721), Expect = 4.457e-97
Identity = 134/170 (78.82%), Postives = 154/170 (90.59%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            M SQVRQNFHSE E GIN QINKEL+ASYVYQAM FYF+RDDVAL+GFS FF  QS EEREHAEKL+KYQN RGGRIVL++I+KP+  EWTPETAFESALALEK+VNQSLL+LHKIAE HNDPQM D+LE ++L+EQVDS+KEI+DH+TNIRRNG GVG+YL+DKLTLK+
Sbjct:    1 MASQVRQNFHSESEAGINKQINKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAEKLIKYQNKRGGRIVLENISKPTASEWTPETAFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTLKD 170          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068027.1 (SMESG000068027.1)

HSP 1 Score: 282.337 bits (721), Expect = 4.457e-97
Identity = 133/170 (78.24%), Postives = 153/170 (90.00%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            M SQVRQNFHSE E GIN Q+NKEL+ASYVYQAM FYF+RDDVAL+GFS FF  QS EEREHA+KLM YQN RGGRIVL+DI+KP+  EWTPETAFESALALEK+VNQSLL+LHKIAE HNDPQM D+LE ++L+EQVDS+KEI+DH+TNIRRNG GVG+YL+DKLTLK+
Sbjct:    1 MASQVRQNFHSESEAGINKQVNKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAQKLMAYQNKRGGRIVLEDISKPTASEWTPETAFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTLKD 170          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000076636.1 (SMESG000076636.1)

HSP 1 Score: 280.411 bits (716), Expect = 3.123e-96
Identity = 129/170 (75.88%), Postives = 157/170 (92.35%), Query Frame = 1
Query:  256 MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 762
            MTSQ+RQNFHS+CE+GIN+QINKELHASYVYQAMSF+F+RDDVAL GFS FF +QSLEEREHAEKLMKYQN RGGR+VLKDI KP  +EWT E+AFESAL LEK VNQ+LL+LHK+AET++DPQM D++E ++LEEQV+SMK+I+D++TNIRRNG G+G+YL+DKLTLK+
Sbjct:    1 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVALSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTAESAFESALELEKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 170          
The following BLAST results are available for this feature:
BLAST of Ferritin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTH13.369e-6258.48ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH13.369e-6258.48ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTMT8.039e-5454.97ferritin mitochondrial [Source:HGNC Symbol;Acc:HGN... [more]
FTL1.169e-5147.70ferritin light chain [Source:HGNC Symbol;Acc:HGNC:... [more]
FTHL174.546e-4948.24ferritin heavy chain like 17 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftn-27.016e-6057.93Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-27.016e-6057.93Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-17.984e-5554.27Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
ftn-17.984e-5554.27Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
back to top
BLAST of Ferritin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer3HCH4.833e-4543.93gene:FBgn0030449 transcript:FBtr0073745[more]
Fer1HCH2.750e-2237.20gene:FBgn0015222 transcript:FBtr0344763[more]
Fer1HCH4.204e-2234.78gene:FBgn0015222 transcript:FBtr0085633[more]
Fer1HCH4.204e-2234.78gene:FBgn0015222 transcript:FBtr0085632[more]
Fer1HCH4.204e-2234.78gene:FBgn0015222 transcript:FBtr0085631[more]
back to top
BLAST of Ferritin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1a4.913e-6759.88ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1a4.913e-6759.88ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1b3.447e-6057.56ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZD... [more]
fthl279.911e-6055.81ferritin, heavy polypeptide-like 27 [Source:ZFIN;A... [more]
fthl283.347e-5753.80ferritin, heavy polypeptide-like 28 [Source:ZFIN;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop531.475e-6760.92NOP53 ribosome biogenesis factor [Source:Xenbase;A... [more]
fth1.17.925e-6458.62ferritin, heavy polypeptide 1, gene 1 [Source:NCBI... [more]
MGC757521.394e-5855.88uncharacterized protein MGC75752 [Source:NCBI gene... [more]
MGC797255.039e-5654.65MGC79725 protein [Source:NCBI gene;Acc:448524][more]
MGC797257.934e-5654.97MGC79725 protein [Source:NCBI gene;Acc:448524][more]
back to top
BLAST of Ferritin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fth11.456e-6058.82ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Fth11.456e-6058.82ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftmt2.007e-5857.65ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:... [more]
Ftl13.189e-4944.20ferritin light polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftl1-ps13.189e-4944.20ferritin light polypeptide 1, pseudogene 1 [Source... [more]
back to top
BLAST of Ferritin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42577|FRIS_LYMST2.868e-7063.53Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV... [more]
sp|Q7SXA6|FRIH3_XENLA8.252e-6760.34Ferritin heavy chain, oocyte isoform OS=Xenopus la... [more]
sp|P85838|FRIH_PSEBE5.797e-6660.47Ferritin, heavy subunit OS=Pseudotrematomus bernac... [more]
sp|P49946|FRIH_SALSA1.920e-6560.47Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=... [more]
sp|P85837|FRIH_TRENE2.095e-6561.05Ferritin, heavy subunit OS=Trematomus newnesi OX=3... [more]
back to top
BLAST of Ferritin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P6A62.494e-7263.95Ferritin OS=Pomacea canaliculata OX=400727 GN=C0Q7... [more]
A0A1X9WEL19.645e-7263.95Ferritin (Fragment) OS=Conus litteratus OX=89445 G... [more]
A0A1S5WGT29.645e-7263.95Ferritin OS=Conus miles OX=69564 GN=FTH1 PE=2 SV=1[more]
A0A1Q1NAC59.645e-7263.95Ferritin (Fragment) OS=Conus araneosus OX=101286 G... [more]
A0A346CIQ09.645e-7263.95Ferritin OS=Conus ermineus OX=55423 PE=2 SV=1[more]
back to top
BLAST of Ferritin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1b8.218e-6862.21ferritin, heavy subunit [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000033875.12.087e-6054.07ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000048516.12.541e-5954.65ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000042393.12.022e-5854.71ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000052792.16.451e-5652.35ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ferritin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009047.15.229e-6660.59pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 ... [more]
ENSPMAT00000009440.14.712e-6558.72pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 ... [more]
ENSPMAT00000006438.11.406e-6357.56pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-... [more]
ENSPMAT00000008696.11.677e-6154.07pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 g... [more]
ENSPMAT00000006468.14.846e-6157.47pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1... [more]
back to top
BLAST of Ferritin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399488.093e-6661.08Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6][more]
EDO315781.213e-6257.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315793.607e-6156.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322571.532e-6056.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353741.905e-6055.62Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6][more]
back to top
BLAST of Ferritin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007389.21.915e-6158.14ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
fth1b2.184e-6156.82ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000029876.12.253e-6158.14ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
fth1b4.726e-6157.56ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000020971.26.073e-6155.81ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ferritin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039456.13.270e-12499.41SMESG000039456.1[more]
SMESG000014076.13.270e-12499.41SMESG000014076.1[more]
SMESG000068030.14.457e-9778.82SMESG000068030.1[more]
SMESG000068027.14.457e-9778.24SMESG000068027.1[more]
SMESG000076636.13.123e-9675.88SMESG000076636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030240 ID=SMED30030240|Name=Ferritin|organism=Schmidtea mediterranea sexual|type=transcript|length=816bp
GTTTAATCTTATCGCAGGATAAAAAATATTTTTAAATATTTTTACTTTAT
TTGAATTCACTGAAATAGATTTCAAAAAAGTATTAGAAAAATGTGTCCAT
CAATAACTCGAAAAGATAAATGGCAAAATGAATTTTATTTTGTCATAAGT
ACGTATGTGAAAATTGTGCAATCGCATTCGTTGCACACATACAAAATTTG
GACACACACATACAGTATTTAAGCAACTGTATGTTGAATTTCAATTCATA
AAATTATGACTTCACAAGTGCGACAGAATTTTCACTCTGAATGTGAAGAT
GGTATTAATGATCAGATTAACAAAGAACTTCACGCAAGCTATGTGTATCA
AGCTATGAGTTTTTATTTTAATCGGGATGATGTGGCTCTTCAAGGTTTCA
GTAATTTTTTCCACAAACAATCGTTAGAAGAAAGAGAACATGCTGAAAAA
TTAATGAAATACCAAAACATACGAGGGGGTAGAATTGTTCTAAAAGATAT
TGCTAAACCTTCAATTGTCGAATGGACTCCGGAAACCGCTTTCGAGTCTG
CTCTCGCTCTTGAAAAAGACGTCAATCAATCATTGCTAAATTTGCACAAA
ATCGCTGAGACGCACAATGATCCACAAATGACTGATTATCTGGAGGACTT
TTTGGAAGAACAGGTAGATTCAATGAAAGAAATAGCTGATCATATAACAA
ATATTCGTCGAAATGGAACCGGAGTCGGAATTTATTTGTATGATAAGCTT
ACTCTTAAGGAGTAAATATGAAATGTGTTTATTAAATTAATAATAAAGTT
CCATTTTATACTGGAA
back to top

protein sequence of SMED30030240-orf-1

>SMED30030240-orf-1 ID=SMED30030240-orf-1|Name=SMED30030240-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MTSQVRQNFHSECEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSN
FFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESAL
ALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNI
RRNGTGVGIYLYDKLTLKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001519Ferritin
IPR012347Ferritin-like
IPR008331Ferritin_DPS_dom
IPR014034Ferritin_CS
IPR009040Ferritin-like_diiron
IPR009078Ferritin-like_SF
Vocabulary: biological process
TermDefinition
GO:0006879cellular iron ion homeostasis
GO:0006826iron ion transport
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0008199ferric iron binding
GO:0004322ferroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012347Ferritin-likeGENE3DG3DSA:1.20.1260.10coord: 1..169
e-value: 1.5E-72
score: 245.0
IPR008331Ferritin/DPS protein domainPFAMPF00210Ferritincoord: 16..152
e-value: 3.6E-39
score: 134.0
IPR001519FerritinPANTHERPTHR11431FERRITINcoord: 2..168
IPR014034Ferritin, conserved sitePROSITEPS00540FERRITIN_1coord: 58..76
IPR009040Ferritin-like diiron domainPROSITEPS50905FERRITIN_LIKEcoord: 7..154
score: 44.619
NoneNo IPR availableCDDcd01056Euk_Ferritincoord: 10..165
e-value: 3.34523E-78
score: 227.812
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 2..168