E3 ubiquitin-protein ligase CBL-B

Overview
NameE3 ubiquitin-protein ligase CBL-B
Smed IDSMED30030229
Length (bp)2644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase CBL-B (SMED30030229) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase CBL-B (SMED30030229) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase CBL-B (SMED30030229) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase CBL-B (SMED30030229) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030229

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030229SMESG000037136.1 Contig4279GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030229SMESG000006795.1 Contig4279GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30030229SMESG000019086.1 SMESG000006795.1 SMESG000044348.1 SMESG000042307.1 dd_Smed_v4_1035_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030229SMESG000019086.1 SMESG000006795.1 SMESG000044348.1 SMESG000042307.1 dd_Smed_v6_1035_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030229SMESG000019086.1 SMESG000006795.1 SMESG000044348.1 SMESG000042307.1 dd_Smed_v4_1035_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 154.836 bits (390), Expect = 3.207e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 155.221 bits (391), Expect = 3.338e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 155.606 bits (392), Expect = 3.376e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  261 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 444          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 155.606 bits (392), Expect = 3.523e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 155.221 bits (391), Expect = 3.638e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 129.028 bits (323), Expect = 5.069e-31
Identity = 65/186 (34.95%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  135 LYSPWERILEVWRVIY-SHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRK--EIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYD--KRNCPFCNQKIQSTTKIV 674
            L+ P++ +++ W+ +  +HP Y  F TY + K  L +   +PG+Y+FR+SC   G W IGYV    ++ Q      +LI+AL EG+K   Y+YPNG   + +LS L +  +   + V +E  +LY E    F+ CKIC ++EK++++E CGH +C  C    +  D     CPFC  +I+ T +++
Sbjct:  239 LFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLEKLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVI 424          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 129.028 bits (323), Expect = 6.455e-31
Identity = 65/186 (34.95%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  135 LYSPWERILEVWRVIY-SHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRK--EIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYD--KRNCPFCNQKIQSTTKIV 674
            L+ P++ +++ W+ +  +HP Y  F TY + K  L +   +PG+Y+FR+SC   G W IGYV    ++ Q      +LI+AL EG+K   Y+YPNG   + +LS L +  +   + V +E  +LY E    F+ CKIC ++EK++++E CGH +C  C    +  D     CPFC  +I+ T +++
Sbjct:  239 LFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLEKLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVI 424          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 129.028 bits (323), Expect = 7.537e-31
Identity = 65/186 (34.95%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  135 LYSPWERILEVWRVIY-SHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRK--EIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYD--KRNCPFCNQKIQSTTKIV 674
            L+ P++ +++ W+ +  +HP Y  F TY + K  L +   +PG+Y+FR+SC   G W IGYV    ++ Q      +LI+AL EG+K   Y+YPNG   + +LS L +  +   + V +E  +LY E    F+ CKIC ++EK++++E CGH +C  C    +  D     CPFC  +I+ T +++
Sbjct:  256 LFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLEKLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVI 441          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Fly
Match: Cbl (gene:FBgn0020224 transcript:FBtr0076614)

HSP 1 Score: 152.525 bits (384), Expect = 2.438e-39
Identity = 77/193 (39.90%), Postives = 117/193 (60.62%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLR-KYDKRNCPFCNQKIQSTTKI-VNVKDPSK 695
            L+ PW  +L  W+++  +HP Y+ F TY + K  L RY+ + G+YVFR+SC  LG W IGYV +  E+ Q      +L +AL++G++   YLYP+G++ NPDLS+  +   E  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C    +   + + CPFC  +I+ T +I V+  DP K
Sbjct:  235 LFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAGSYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRK 427          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Fly
Match: Cbl (gene:FBgn0020224 transcript:FBtr0076615)

HSP 1 Score: 154.836 bits (390), Expect = 2.735e-38
Identity = 77/193 (39.90%), Postives = 117/193 (60.62%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLR-KYDKRNCPFCNQKIQSTTKI-VNVKDPSK 695
            L+ PW  +L  W+++  +HP Y+ F TY + K  L RY+ + G+YVFR+SC  LG W IGYV +  E+ Q      +L +AL++G++   YLYP+G++ NPDLS+  +   E  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C    +   + + CPFC  +I+ T +I V+  DP K
Sbjct:  235 LFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAGSYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRK 427          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 157.147 bits (396), Expect = 7.714e-39
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y+N+PG+Y+FR+SC  LG W IGYV S   + Q       L +AL++G +   YL+P+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    +  D + CPFC  +I+ T  I+
Sbjct:  234 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDSDGQGCPFCRCEIKGTEPII 417          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 157.147 bits (396), Expect = 7.796e-39
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y+N+PG+Y+FR+SC  LG W IGYV S   + Q       L +AL++G +   YL+P+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    +  D + CPFC  +I+ T  I+
Sbjct:  234 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDSDGQGCPFCRCEIKGTEPII 417          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 157.147 bits (396), Expect = 7.958e-39
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y+N+PG+Y+FR+SC  LG W IGYV S   + Q       L +AL++G +   YL+P+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    +  D + CPFC  +I+ T  I+
Sbjct:  234 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDSDGQGCPFCRCEIKGTEPII 417          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Match: cbl (Cbl proto-oncogene, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041114-207])

HSP 1 Score: 154.066 bits (388), Expect = 6.893e-38
Identity = 74/193 (38.34%), Postives = 114/193 (59.07%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV----NVKDP 689
            L+ PW  +L  W  +  +HP Y+ F TY + K  L +++++PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G +   YL+P+G + NPDL+ L E   +  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ + + CPFC  +I+ T  IV    + KDP
Sbjct:  231 LFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFDPKDP 423          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Match: cblc (Cbl proto-oncogene C, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-080220-20])

HSP 1 Score: 145.206 bits (365), Expect = 2.809e-36
Identity = 69/184 (37.50%), Postives = 102/184 (55.43%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  ++  W  +  +HP Y+ F TY   K  L  Y + PG+Y+FR+SC  +G W IG+V S   + Q     + L +AL++G +   YLYP+G   NPDLS+L     +  + V  E  +LY E    F+ CKIC E +KD +++ CGH +CQ C    +K D   CP+C   I+ T  I+
Sbjct:  229 LFQPWSTLIRNWNHLAVTHPGYMAFLTYDQVKARLEHYRHRPGSYIFRLSCTQMGQWAIGHVTSDGSIVQTIPQNTPLYQALIQGFREGCYLYPDGRDVNPDLSSLCSPVHKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCQPCLTGWQKSDGHTCPYCRCDIRGTESIL 412          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Match: ENSXETT00000026451.1 (Cbl proto-oncogene C [Source:NCBI gene;Acc:100489764])

HSP 1 Score: 150.599 bits (379), Expect = 1.361e-38
Identity = 76/223 (34.08%), Postives = 120/223 (53.81%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLN--EFRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTNDLN 791
            L+ PW  +L+ W ++  +HP Y+ F TY + ++ L  ++ +PG+Y+FR+SC  LG W IGYV S  E+ Q       L  AL+EG K  +YL+PNG S NPDLS L+      ++ V  E   LY +    F+ CKIC ++EK+++++ CGH +C  C    +K D   CPFC  +IQ   ++  +  P  +     +    ++    P +     + T DL 
Sbjct:  166 LFQPWNTLLQNWMLLAVTHPGYMAFLTYDEVREHLKSHIQKPGSYIFRLSCTHLGQWAIGYVTSKGEILQTIPHNKPLYLALLEGQKEGLYLHPNGVSSNPDLSELSNPSTSPKVQVTQEQWDLYSQMGSAFELCKICVDNEKNVRIKPCGHLLCNDCLLAWQKSDGHTCPFCRCEIQGKEEVRVLSQPEAEEVGGMNGSFPWLPCIGPPKKGTFGKCTFDLT 388          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 154.836 bits (390), Expect = 2.869e-38
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  IV
Sbjct:  250 LFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCPFCRCEIKGTEPIV 433          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 155.606 bits (392), Expect = 3.413e-38
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  IV
Sbjct:  250 LFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCPFCRCEIKGTEPIV 433          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 155.606 bits (392), Expect = 3.580e-38
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  IV
Sbjct:  250 LFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCPFCRCEIKGTEPIV 433          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 155.606 bits (392), Expect = 3.712e-38
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  IV
Sbjct:  250 LFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCPFCRCEIKGTEPIV 433          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 155.992 bits (393), Expect = 1.528e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:   87 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 270          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 155.992 bits (393), Expect = 2.116e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 155.992 bits (393), Expect = 2.116e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 155.606 bits (392), Expect = 2.598e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 155.606 bits (392), Expect = 2.598e-38
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Match: sp|Q8K4S7|CBLB_RAT (E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus OX=10116 GN=Cblb PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.704e-37
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Match: sp|Q3TTA7|CBLB_MOUSE (E3 ubiquitin-protein ligase CBL-B OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=3)

HSP 1 Score: 155.606 bits (392), Expect = 1.817e-37
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Match: sp|Q6DFR2|CBLB_XENTR (E3 ubiquitin-protein ligase CBL-B OS=Xenopus tropicalis OX=8364 GN=cblb PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.966e-37
Identity = 76/184 (41.30%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  IV
Sbjct:  250 LFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCPFCRCEIKGTEPIV 433          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Match: sp|Q13191|CBLB_HUMAN (E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2)

HSP 1 Score: 155.606 bits (392), Expect = 1.966e-37
Identity = 75/184 (40.76%), Postives = 107/184 (58.15%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y  +PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G++   YLYP+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T  I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Match: sp|Q9ULV8|CBLC_HUMAN (E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens OX=9606 GN=CBLC PE=1 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 3.228e-37
Identity = 73/179 (40.78%), Postives = 107/179 (59.78%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLN--EFRKEIVVNNEDLQLYECFDD-FKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQS 659
            L+ PW  +L+ W+++  +HP Y+ F TY + ++ L    ++PG+Y+FR SC  LG W IGYV S   + Q       L + L+EG K   YLYP+G++ NPDL+ L   E ++ I V+ E LQLY   D  F+ CKIC ES KD+++E CGH +C  C    +  D + CPFC  +I+ 
Sbjct:  217 LFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKG 395          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Match: A0A0B6Y5X4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF13459 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.424e-40
Identity = 81/197 (41.12%), Postives = 118/197 (59.90%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMK 713
            L+ PW  +L  W V+  +HP Y+ F TY + K  L +Y+N+PG+YVFR+SC  LG W IGYV +  ++ Q      +L +AL++G +   +LYP+G S NPDLS L    +E  I V  E  +LY E    F++CKIC E++KD++LE CGH +C  C    +  D + CP+C  +I+ T ++  V DP  D   MK
Sbjct:   35 LFQPWVNLLRNWNVLAVAHPGYVAFLTYDEVKARLQKYINKPGSYVFRLSCTRLGQWAIGYVTNDGQILQTIPQNKSLCQALLDGQREGFFLYPDGRSINPDLSFLVADSEEDHIRVTQEQYELYCEMGSTFQQCKICAENDKDIRLEPCGHLLCTPCLTQWQDSDGQGCPWCRCEIKGTEQV--VVDPFDDRHVMK 229          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Match: A0A0P4W9Y5 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.033e-40
Identity = 81/209 (38.76%), Postives = 123/209 (58.85%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQST-TKIVNVKDPSKDVDAMKSAESVYMDMSE 746
            L+ PW  +L  W+++  +HP Y+ F TY + K  L +Y+N+PG+YVFR+SC  LG W IGYV S   + Q      +L +AL++G++   YLYP+G + NPDL+ + +   E  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C  L +  + + CPFC  +I+ T T +V+  DP K       +    +DM E
Sbjct:  233 LFQPWPTLLRNWQILAVTHPGYVAFLTYDEVKARLQKYINKPGSYVFRLSCTRLGQWAIGYVTSDGSILQTIPQNKSLCQALLDGHREGFYLYPDGRNLNPDLTWVAQATPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTLWQDSEGQGCPFCRAEIRGTETIVVDPFDPHKQHRTQSLSSGQLIDMEE 441          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Match: H9GEW4 (Uncharacterized protein OS=Anolis carolinensis OX=28377 GN=LOC100552102 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.635e-39
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 LYSPWERILEVWR-VIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEF--RKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L+ W  +  +HP Y+ F TY + K+ L  Y N+PG+Y+FR+SC  LG W IGYV  +  + Q       L +AL++G+K   Y+YPNG++ NPDLS L E   R  I V+ E  +LY +    F+ CKIC E+ KD+++E CGH +C+ C    +  +   CPFC +KI     IV
Sbjct:   51 LFQPWPTLLKNWSYLAVTHPGYMAFLTYDEVKERLQTYTNKPGSYIFRLSCTRLGQWAIGYVTENGTILQTIPQNKPLFQALIDGHKEGFYMYPNGKNTNPDLSELTEVVPRSRIRVSQEQFELYCQVGSTFQLCKICAENNKDVRIEPCGHLLCRGCLDAWQLSEAHTCPFCRRKICGHVDIV 234          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Match: A0A2J7RL16 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G12308 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 3.340e-39
Identity = 79/209 (37.80%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKI-VNVKDPSKDVDAMKSAESVYMDMSE 746
            L+ PW  +L  W+++  +HP Y+ F TY + K  L +Y+ +PG+YVFR+SC  LG W IGYV +  E+ Q      +L +AL++G +   YL+P+G + NPDLS   +   E  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C    +  + + CPFC  +I+ T +I V+  DP +   A  +   V +D  E
Sbjct:   26 LFQPWTTLLRNWQILAVTHPGYVAFLTYDEVKARLQKYITKPGSYVFRLSCTRLGQWAIGYVTADGEILQTIPQNKSLCQALLDGYREGFYLFPDGRNVNPDLSWAVQPTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQDSEGQGCPFCRAEIKGTEQIVVDPFDPKRQHKAGSTGNLVDLDEDE 234          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Match: A0A2P8YGR2 (E3 ubiquitin-protein ligase CBL OS=Blattella germanica OX=6973 GN=Cbl PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 6.721e-39
Identity = 79/209 (37.80%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKI-VNVKDPSKDVDAMKSAESVYMDMSE 746
            L+ PW  +L  W+++  +HP Y+ F TY + K  L +Y+ +PG+YVFR+SC  LG W IGYV +  E+ Q      +L +AL++G +   YL+P+G + NPDLS   +   E  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C    +  + + CPFC  +I+ T +I V+  DP +   A  +   V +D  E
Sbjct:   59 LFQPWTTLLRNWQILAVTHPGYVAFLTYDEVKARLQKYITKPGSYVFRLSCTRLGQWAIGYVTADGEILQTIPQNKSLCQALLDGYREGFYLFPDGRNVNPDLSWAVQPTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQDSEGQGCPFCRAEIKGTEQIVVDPFDPKRQHKAGSTGNLVDLDEDE 267          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Match: cblb (Cbl proto-oncogene B [Source:NCBI gene;Acc:103034711])

HSP 1 Score: 159.073 bits (401), Expect = 1.480e-39
Identity = 76/184 (41.30%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +Y+N+PG+Y+FR+SC  LG W IGYV S   + Q       L +AL++G +   YL+P+G S NPDL+ L E      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ D + CPFC  +I+ T +I+
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTERII 422          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:103032411])

HSP 1 Score: 152.91 bits (385), Expect = 1.061e-37
Identity = 71/184 (38.59%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L  W  +  +HP Y+ F TY + K  L +++++PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G +   YL+P+G + NPDL+ L E   +  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ + + CPFC  +I+ T  IV
Sbjct:  231 LFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIV 414          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:103032411])

HSP 1 Score: 153.295 bits (386), Expect = 1.114e-37
Identity = 71/184 (38.59%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L  W  +  +HP Y+ F TY + K  L +++++PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G +   YL+P+G + NPDL+ L E   +  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ + + CPFC  +I+ T  IV
Sbjct:  231 LFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIV 414          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Match: cblc (E3 ubiquitin-protein ligase CBL-like [Source:NCBI gene;Acc:103042889])

HSP 1 Score: 140.198 bits (352), Expect = 3.067e-34
Identity = 64/184 (34.78%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTL--NEFRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L  W ++  +HP Y+ F TY   +  L  + + PG+Y+FR+SC  +G W +G+V     + Q   + + L +AL++G +   YLYP+G   NPDL++L     +  + V  E  +LY E    F+ CKIC E +KD +++ CGH +C+ C    +K D   CP+C   I+ T  I+
Sbjct:  228 LFQPWSTLLRNWNQLAVTHPGYMAFLTYDQVRARLEHHRHRPGSYIFRLSCTRMGQWAVGHVTFDGSIVQTIPENTPLFQALIQGFREGCYLYPDGRDVNPDLTSLCMAPQKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCRPCLTGWQKSDGHTCPYCRCDIRGTESIL 411          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Match: cblc (E3 ubiquitin-protein ligase CBL-like [Source:NCBI gene;Acc:103042889])

HSP 1 Score: 140.198 bits (352), Expect = 3.067e-34
Identity = 64/184 (34.78%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTL--NEFRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L  W ++  +HP Y+ F TY   +  L  + + PG+Y+FR+SC  +G W +G+V     + Q   + + L +AL++G +   YLYP+G   NPDL++L     +  + V  E  +LY E    F+ CKIC E +KD +++ CGH +C+ C    +K D   CP+C   I+ T  I+
Sbjct:  228 LFQPWSTLLRNWNQLAVTHPGYMAFLTYDQVRARLEHHRHRPGSYIFRLSCTRMGQWAVGHVTFDGSIVQTIPENTPLFQALIQGFREGCYLYPDGRDVNPDLTSLCMAPQKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCRPCLTGWQKSDGHTCPYCRCDIRGTESIL 411          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Sea Lamprey
Match: cblc (Cbl proto-oncogene C, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-080220-20])

HSP 1 Score: 49.2914 bits (116), Expect = 1.953e-6
Identity = 18/47 (38.30%), Postives = 31/47 (65.96%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVF 272
            L+ PW  +L  W V+  +HP Y+ F TY + K  L +Y+++PG+Y++
Sbjct:  236 LFQPWSSLLRNWNVLAVTHPGYMAFLTYDEVKARLQKYISKPGSYIY 282          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Match: ENSORLT00000018206.2 (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101163758])

HSP 1 Score: 151.369 bits (381), Expect = 3.823e-37
Identity = 71/184 (38.59%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  +L  W  +  +HP Y+ F TY + K  L R++++PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G +   YL+P+G + NPDL+ L E   +  I V  E  +LY E    F+ CKIC E++KD+++E C H +C SC    ++ + + CPFC  +I+ T  IV
Sbjct:  230 LFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQRFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCRHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIV 413          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Match: cblb (Cbl proto-oncogene B [Source:NCBI gene;Acc:101157475])

HSP 1 Score: 150.984 bits (380), Expect = 4.983e-37
Identity = 75/190 (39.47%), Postives = 110/190 (57.89%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNE--FRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKI-VNVKDP 689
            L+ PW  IL  W  +  +HP Y+ F TY + K  L +++N+PG+Y+FR+SC  LG W IGYV     + Q       L +AL++G +   YL+P+G S NPDL+ L +      I V  E  +LY E    F+ CKIC E++KD+++E CGH +C  C    ++ D + CPFC  +I+ T  I V+  DP
Sbjct:  239 LFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLLKFINKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGFREGFYLFPDGRSYNPDLTDLCDPLPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTLCLTAWQESDGQGCPFCRCEIKGTAPITVDPFDP 428          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:101170289])

HSP 1 Score: 148.288 bits (373), Expect = 4.175e-36
Identity = 71/186 (38.17%), Postives = 110/186 (59.14%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKE--IVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKR--NCPFCNQKIQSTTKIV 674
            L+ PW  +L  W  +  +HP Y+ F TY + K  L +++++PG+Y+FR+SC  LG W IGYV +   + Q       L +AL++G +   YL+P+G + NPDL+ L E   +  I V  E  +LY E    F+ CKIC E++KD+++E CGH +C SC    ++ + +   CPFC  +I+ T  IV
Sbjct:  231 LFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIV 416          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Match: cblc (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101158476])

HSP 1 Score: 137.502 bits (345), Expect = 1.651e-33
Identity = 65/184 (35.33%), Postives = 105/184 (57.07%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEF--RKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  ++  W  +  +HP Y+ F TY    + L  YL++PG+Y+FR+SC  +G W +G+V +  ++ Q     + L +AL++G K   YLYP+G   NP+L+ L E   ++ + V  E   LY E    F+ CKIC E +KD +++ CGH +C+SC    +K     CP+C   I+ T  ++
Sbjct:  225 LFQPWSSLIRNWNHMAVTHPGYMAFLTYDQVVERLEHYLHKPGSYIFRLSCTRMGQWAVGHVTAEGDIIQTLPGDTPLYQALIQGFKEGCYLYPDGRDVNPELTCLCETAQKQTVQVTEEQYGLYCEIGSTFELCKICAEKDKDTRIKPCGHLLCKSCLFGWQKSVGNTCPYCRCDIKGTESVL 408          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Match: cblc (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101158476])

HSP 1 Score: 137.502 bits (345), Expect = 1.651e-33
Identity = 65/184 (35.33%), Postives = 105/184 (57.07%), Query Frame = 3
Query:  135 LYSPWERILEVW-RVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEF--RKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIV 674
            L+ PW  ++  W  +  +HP Y+ F TY    + L  YL++PG+Y+FR+SC  +G W +G+V +  ++ Q     + L +AL++G K   YLYP+G   NP+L+ L E   ++ + V  E   LY E    F+ CKIC E +KD +++ CGH +C+SC    +K     CP+C   I+ T  ++
Sbjct:  225 LFQPWSSLIRNWNHMAVTHPGYMAFLTYDQVVERLEHYLHKPGSYIFRLSCTRMGQWAVGHVTAEGDIIQTLPGDTPLYQALIQGFKEGCYLYPDGRDVNPELTCLCETAQKQTVQVTEEQYGLYCEIGSTFELCKICAEKDKDTRIKPCGHLLCKSCLFGWQKSVGNTCPYCRCDIKGTESVL 408          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Match: SMESG000006795.1 (SMESG000006795.1)

HSP 1 Score: 488.804 bits (1257), Expect = 0.000e+0
Identity = 234/237 (98.73%), Postives = 235/237 (99.16%), Query Frame = 3
Query:  135 LYSPWERILEVWRVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKEIVVNNEDLQLYECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTNDLNLRINSDSVYSNISDEGKS 845
            LYSPWERILEVWRVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKEIVVNNEDLQLYECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTNDLNLRINSDSVYSNISDE  +
Sbjct:  164 LYSPWERILEVWRVIYSHPAYLHFSTYGDTKDTLSRYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKEIVVNNEDLQLYECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTNDLNLRINSDSVYSNISDEATA 400          

HSP 2 Score: 486.108 bits (1250), Expect = 0.000e+0
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = 1
Query:  877 ATAGESLPSVPPRIINDHTWNSKRDKKCVVVYPAVTTKKQDQYERVDNNTGSSPIYSDMSLNESFKAVNKVDNKSLLDDTYCDINEPITEPNSSHLERNHKTPNYFDFRNRKNLKSPTQLESVFNSICINDDCYSCPNESVGLELQDNTIADDVYLIPNTSVNKISSVSQQFVVDEDVYCNPNDEITFEQLPDCSALKTEMLSLWNENDVERAIRVARNDESLAKDILVEFVGQKGK 1587
            ATAGESLPSVPPRIINDHTWNSKRDKKCVVVYPAVTTKKQDQYERVDNNTGSSPIYSDMSLNESFKAVNKVDNKSLLDDTYCDINEPITEPNSSHLERNHKTPNYFDFRNRKNLKSPTQLESVFNSICINDDCYSCPNESVGLELQDNTIADDVYLIPNTSVNKISSVSQQFVVDEDVYCNPNDEITFEQLPDCSALKTEMLSLWNENDVERAIRVARNDESLAKDILVEFVGQKGK
Sbjct:  398 ATAGESLPSVPPRIINDHTWNSKRDKKCVVVYPAVTTKKQDQYERVDNNTGSSPIYSDMSLNESFKAVNKVDNKSLLDDTYCDINEPITEPNSSHLERNHKTPNYFDFRNRKNLKSPTQLESVFNSICINDDCYSCPNESVGLELQDNTIADDVYLIPNTSVNKISSVSQQFVVDEDVYCNPNDEITFEQLPDCSALKTEMLSLWNENDVERAIRVARNDESLAKDILVEFVGQKGK 634          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Match: SMESG000056433.1 (SMESG000056433.1)

HSP 1 Score: 132.88 bits (333), Expect = 4.608e-32
Identity = 81/234 (34.62%), Postives = 121/234 (51.71%), Query Frame = 3
Query:  135 LYSPWERILEVWRVIYS-HPAYLHFSTYGDTKDTLSRYLNEPG--TYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGE---SCNPDLSTL--NEFRKEIVVNNEDLQLY-ECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTNDLNLRINSD 809
            LY PW  ILE W+ +   HP Y+ F TY D K  L  ++  PG  TYVFR SC  LG W IGY+   K++ Q  +   +L  AL++G K   Y YPNG    +    L +L  N  +  I V++E  ++Y E    F+ CKIC E++K+++LE C H +C+ C           CPFC  +I+S   IV      K  +  +SA+     ++ P  P   + ST+ ++   ++D
Sbjct:  243 LYQPWNNILETWKALAVLHPGYMSFMTYDDVKLVLMNFIENPGPGTYVFRSSCTKLGQWAIGYITEDKQILQTIIQNKSLARALLDGEKEGYYKYPNGSITYNAYQHLYSLVHNLTQTHIQVSHEQYKVYCEMDSTFELCKICSENDKNIRLEPCQHLLCRPCLVSWESSSGLTCPFCRLEIKSVEDIV-----VKPYEMKESADK----LTAPPLPPRPIMSTSTISTNSDND 467          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Match: SMESG000072524.1 (SMESG000072524.1)

HSP 1 Score: 117.472 bits (293), Expect = 5.104e-27
Identity = 69/195 (35.38%), Postives = 105/195 (53.85%), Query Frame = 3
Query:  135 LYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLS--RYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDL--STLNEFRKEIVVNNEDLQLYECFD-DFKECKICRESEKDLQLESCGHQICQSCYKLLRK-YDKRNCPFCNQKIQSTTKIVNVKDPSKD 698
            L+ PW  ILE W+VI   HP  + + TY      L   R    PG+YVFR SC   G W IGY+  S ++ Q  V   +L  AL EG +  +Y YPNG+  +     + ++   + I+V+ E+ + Y   D  F+ CKIC ++ K+++LE CGH +C  C    +K +  ++CPFC  +I+   KI  +   SK+
Sbjct:  238 LFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKN 432          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Match: SMESG000007981.1 (SMESG000007981.1)

HSP 1 Score: 48.521 bits (114), Expect = 6.706e-6
Identity = 26/86 (30.23%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  507 FDDFKECKICRESEKDLQLESCGHQICQSC---YKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSR 755
             +D+  C+ICRE      + +CGH  CQSC   + L  +Y   NCP C  +I+ T         S+++      E++   + E SR
Sbjct:  134 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYT---------SRNILIETCVEALLKQLPETSR 210          
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Match: SMESG000007981.1 (SMESG000007981.1)

HSP 1 Score: 48.521 bits (114), Expect = 6.778e-6
Identity = 26/86 (30.23%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  507 FDDFKECKICRESEKDLQLESCGHQICQSC---YKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSR 755
             +D+  C+ICRE      + +CGH  CQSC   + L  +Y   NCP C  +I+ T         S+++      E++   + E SR
Sbjct:  119 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYT---------SRNILIETCVEALLKQLPETSR 195          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBLB3.207e-3840.76Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB3.338e-3840.76Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB3.376e-3840.76Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB3.523e-3840.76Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB3.638e-3840.76Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sli-15.069e-3134.95Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
sli-16.455e-3134.95Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
sli-17.537e-3134.95Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cbl2.438e-3939.90gene:FBgn0020224 transcript:FBtr0076614[more]
Cbl2.735e-3839.90gene:FBgn0020224 transcript:FBtr0076615[more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cblb7.714e-3941.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb7.796e-3941.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb7.958e-3941.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cbl6.893e-3838.34Cbl proto-oncogene, E3 ubiquitin protein ligase [S... [more]
cblc2.809e-3637.50Cbl proto-oncogene C, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000026451.11.361e-3834.08Cbl proto-oncogene C [Source:NCBI gene;Acc:1004897... [more]
cblb2.869e-3841.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb3.413e-3841.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb3.580e-3841.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb3.712e-3841.30Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cblb1.528e-3840.76Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb2.116e-3840.76Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb2.116e-3840.76Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb2.598e-3840.76Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb2.598e-3840.76Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K4S7|CBLB_RAT1.704e-3740.76E3 ubiquitin-protein ligase CBL-B OS=Rattus norveg... [more]
sp|Q3TTA7|CBLB_MOUSE1.817e-3740.76E3 ubiquitin-protein ligase CBL-B OS=Mus musculus ... [more]
sp|Q6DFR2|CBLB_XENTR1.966e-3741.30E3 ubiquitin-protein ligase CBL-B OS=Xenopus tropi... [more]
sp|Q13191|CBLB_HUMAN1.966e-3740.76E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens ... [more]
sp|Q9ULV8|CBLC_HUMAN3.228e-3740.78E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6Y5X41.424e-4041.12Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A0P4W9Y56.033e-4038.76Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
H9GEW42.635e-3940.76Uncharacterized protein OS=Anolis carolinensis OX=... [more]
A0A2J7RL163.340e-3937.80Uncharacterized protein OS=Cryptotermes secundus O... [more]
A0A2P8YGR26.721e-3937.80E3 ubiquitin-protein ligase CBL OS=Blattella germa... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cblb1.480e-3941.30Cbl proto-oncogene B [Source:NCBI gene;Acc:1030347... [more]
cbl1.061e-3738.59Cbl proto-oncogene [Source:NCBI gene;Acc:103032411... [more]
cbl1.114e-3738.59Cbl proto-oncogene [Source:NCBI gene;Acc:103032411... [more]
cblc3.067e-3434.78E3 ubiquitin-protein ligase CBL-like [Source:NCBI ... [more]
cblc3.067e-3434.78E3 ubiquitin-protein ligase CBL-like [Source:NCBI ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cblc1.953e-638.30Cbl proto-oncogene C, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018206.23.823e-3738.59E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
cblb4.983e-3739.47Cbl proto-oncogene B [Source:NCBI gene;Acc:1011574... [more]
cbl4.175e-3638.17Cbl proto-oncogene [Source:NCBI gene;Acc:101170289... [more]
cblc1.651e-3335.33E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
cblc1.651e-3335.33E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL-B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006795.10.000e+098.73SMESG000006795.1[more]
SMESG000056433.14.608e-3234.62SMESG000056433.1[more]
SMESG000072524.15.104e-2735.38SMESG000072524.1[more]
SMESG000007981.16.706e-630.23SMESG000007981.1[more]
SMESG000007981.16.778e-630.23SMESG000007981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030229 ID=SMED30030229|Name=E3 ubiquitin-protein ligase CBL-B|organism=Schmidtea mediterranea sexual|type=transcript|length=2644bp
CCGACACCTTTCATACAATTTTATTATAATAATTAAATAAAAAAACTAAA
GTTTTCTAAGAAATTTCGTTTTTAATATATTTATTTGTACATTCATTTTG
TTTGAATAGATAATTAAATAAAGCTACTTTTAGTTTATATTCTCCATGGG
AACGAATTTTAGAAGTTTGGAGGGTAATATATTCCCACCCAGCCTATTTA
CACTTTAGCACTTATGGAGATACTAAAGATACACTCAGTAGATATTTAAA
TGAACCAGGAACATATGTATTTCGAATCAGTTGCAAAGATTTAGGGTTCT
GGACCATCGGCTATGTGAAATCATCCAAAGAAATGGGCCAAGTCAAAGTT
GACAAAAGTAATTTAATAGAGGCACTTGTGGAAGGAAATAAAAGAAATAT
GTATCTTTATCCAAACGGAGAAAGTTGTAATCCTGATTTGTCCACTCTAA
ATGAATTCAGGAAAGAAATTGTTGTAAATAATGAAGACCTTCAATTGTAT
GAATGTTTCGATGATTTCAAAGAATGTAAAATTTGTCGAGAATCAGAAAA
AGATCTTCAACTGGAAAGTTGTGGTCATCAAATTTGTCAAAGTTGTTACA
AACTATTGCGAAAATACGATAAAAGGAACTGTCCATTTTGTAACCAAAAG
ATTCAATCAACAACTAAAATCGTTAACGTAAAAGATCCTTCTAAAGATGT
TGATGCAATGAAATCTGCAGAAAGTGTTTATATGGATATGTCAGAGCCGT
CGAGACCAAACGTGGAAGTCAGGTCCACTAATGATCTAAATTTAAGAATA
AACTCTGATAGTGTATATTCAAATATTTCCGATGAAGGTAAGTCCATTCA
TTTTTGTGTGACTTTATTTTCCCTCAGCAACGGCCGGTGAATCCTTGCCC
TCAGTCCCTCCTCGAATAATAAATGATCATACATGGAATTCTAAACGCGA
TAAAAAATGTGTAGTAGTTTATCCGGCTGTAACCACTAAAAAGCAGGATC
AATATGAAAGAGTCGACAATAATACCGGATCATCTCCAATTTATTCCGAT
ATGTCGTTGAATGAGAGTTTTAAAGCAGTAAATAAAGTTGACAACAAATC
ATTATTAGATGATACGTATTGTGATATTAATGAACCGATCACAGAACCCA
ATTCCTCGCATTTGGAGAGAAATCACAAGACTCCGAACTATTTCGATTTC
CGTAATAGAAAGAATTTAAAAAGTCCCACTCAATTGGAAAGTGTTTTCAA
TTCCATCTGTATCAATGACGACTGTTACTCGTGTCCCAATGAATCTGTGG
GTTTAGAATTGCAGGATAACACAATAGCAGATGATGTCTATTTGATACCG
AATACCAGCGTAAATAAAATATCGAGTGTAAGTCAACAATTCGTTGTCGA
TGAAGATGTCTACTGCAATCCCAATGATGAGATCACCTTTGAGCAACTTC
CCGATTGCAGTGCTCTCAAAACAGAAATGCTTTCACTATGGAATGAAAAC
GATGTCGAAAGAGCGATTCGTGTTGCTCGGAATGATGAAAGTCTTGCTAA
AGATATTCTGGTGGAATTCGTCGGACAGAAGGGGAAATAATACTGCCTGT
GTTCTGATATTTTGATTTGAAATTTCTAACAGTGTTTCCGTTTCATATTC
AATTGCTATTTTGTGCATGTTTTAAACAAATGATTGCTATTTTTTACCAA
ATTTTAAATGATTACCAATTTTTTTTGGTATATTATATATTTGCAATTGT
TTTTTTTGTTGGATTTATTTTTTTATCGATAATTTATAATTTCCCAATGT
AATAATTATTGATGAATTTTTATTGGTTAAAAATTACTTTGGCCAGACCA
ATCAAATTTGTGTCATTATATTTCCTTCAATCAATTCAGCGGTTATCGGG
GAAGTTTCCAGTGGAGGCCATTTATAGATAGGATAAAATTTAATCGATGA
ATTTGACCAGGCCTATTTGATTCAGTACATTTACACAGTTGTATTTAAAA
ATCAGTAAATTCGTGTATGTACCAGTAGAAAAATCAATACAGGAATTTTT
AGGGATTTATTGTTTTCAAGTTGTAACAGTACAAATGCAGGAAATTTGGT
TAAATTAGAAAATGTGTTTGAATTCTTGAGTTAACAGAATTTTGTAACCT
TCGGTTTATTCAAATGTAATGTCATTTTGAACAAATAAAAACCCTTTGTA
TTTGAATTCATCTGAGGTTATCAGATTATGAAATTGGAATCAGACAAGAA
GTTAGAAACAATATAAATTACTTTGATCAGAGGATGAATTTAATTTCTTA
TACTAGTTTTATGGAATCAACACCAATGCAATTTGCGAACCAGGTAAATA
TAAAGTATTGTTGGGTTGTCGAAAATCGGTGCTTAGGTCTGACTACTTGG
TGTCCATATTTAATCAATTCAATTAACCCAGCACAATAATGTTTATTTCT
AATATATGTATTACAATTACACTTGAAATCTTTATTCACAACCTTCAAAT
ATATATATTCAGTTCACAAAACTTTACTCTTCACAAATCGCTGCGTAGTG
ATACGTGTTCCAAATGGAGACGTCCCTGTCTGTTGTGCAAAACTGTAATT
TGTTAGGTTGACACTAATGATACTTTCTGATATCGTTTCTCAAG
back to top

protein sequence of SMED30030229-orf-1

>SMED30030229-orf-1 ID=SMED30030229-orf-1|Name=SMED30030229-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDLSTLNEFRKEIVVNN
EDLQLYECFDDFKECKICRESEKDLQLESCGHQICQSCYKLLRKYDKRNC
PFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSRPNVEVRSTN
DLNLRINSDSVYSNISDEGKSIHFCVTLFSLSNGR*
back to top

protein sequence of SMED30030229-orf-2

>SMED30030229-orf-2 ID=SMED30030229-orf-2|Name=SMED30030229-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=180bp
MSLNESFKAVNKVDNKSLLDDTYCDINEPITEPNSSHLERNHKTPNYFDF
RNRKNLKSPTQLESVFNSICINDDCYSCPNESVGLELQDNTIADDVYLIP
NTSVNKISSVSQQFVVDEDVYCNPNDEITFEQLPDCSALKTEMLSLWNEN
DVERAIRVARNDESLAKDILVEFVGQKGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR024162Adaptor_Cbl
IPR001841Znf_RING
IPR000980SH2
IPR013083Znf_RING/FYVE/PHD
IPR014742Adaptor_Cbl_SH2-like
IPR017907Znf_RING_CS
IPR024159Cbl_PTB
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0001784phosphotyrosine binding
GO:0004842ubiquitin-protein transferase activity
GO:0004871signal transducer activity
GO:0005509calcium ion binding
GO:0016740transferase activity
GO:0017124SH3 domain binding
GO:0030971receptor tyrosine kinase binding
GO:0046872metal ion binding
GO:0061630ubiquitin protein ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0045121membrane raft
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007166cell surface receptor signaling pathway
GO:0007173epidermal growth factor receptor signaling pathway
GO:0007175negative regulation of epidermal growth factor-activated receptor activity
GO:0016567protein ubiquitination
GO:0023051regulation of signaling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 65..103
e-value: 1.0E-5
score: 35.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 65..104
score: 10.896
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 40..118
e-value: 3.3E-12
score: 47.6
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 63..109
e-value: 3.1E-11
score: 42.9
NoneNo IPR availablePANTHERPTHR23007:SF12E3 UBIQUITIN-PROTEIN LIGASE CBL-Ccoord: 10..130
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 44..114
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 1..39
e-value: 3.5E-6
score: 28.6
IPR024162Adaptor protein CblPANTHERPTHR23007CBLcoord: 10..130
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 80..89
IPR024159Adaptor protein Cbl, PTB domainPROSITEPS51506CBL_PTBcoord: 1..38
score: 10.675