flotillin-2

Overview
Nameflotillin-2 (AHD24750.1)
Smed IDSMED30030227
Length (bp)1645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of flotillin-2 (SMED30030227) t-SNE clustered cells

Violin plots show distribution of expression levels for flotillin-2 (SMED30030227) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of flotillin-2 (SMED30030227) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for flotillin-2 (SMED30030227) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030227

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030227SMESG000059332.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030227SMESG000059332.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030227SMESG000059332.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30030227SMESG000059332.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30030227SMESG000024114.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030227SMESG000024114.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30030227SMESG000024114.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30030227SMESG000024114.1 Contig5500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30030227SMESG000024114.1 dd_Smed_v4_927_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030227SMESG000024114.1 dd_Smed_v4_927_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030227SMESG000024114.1 dd_Smed_v4_927_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30030227SMESG000024114.1 dd_Smed_v4_927_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030227SMESG000024114.1 Contig48626newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030227SMESG000024114.1 Contig48626uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 503.056 bits (1294), Expect = 2.252e-175
Identity = 274/419 (65.39%), Postives = 342/419 (81.62%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q+ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSK 416          
BLAST of flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 498.049 bits (1281), Expect = 2.263e-173
Identity = 271/419 (64.68%), Postives = 342/419 (81.62%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q++SLEVMT+   CE++ET EGVPL VTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSK 416          
BLAST of flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 462.996 bits (1190), Expect = 1.019e-158
Identity = 272/474 (57.38%), Postives = 341/474 (71.94%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWG---WA----------------------------------------------------WWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+   + + GGW    W                                                     +W + QV +ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVPCPCLLDCKWGNSKGFWKLCQVCQISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSK 471          
BLAST of flotillin-2 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 328.561 bits (841), Expect = 4.248e-107
Identity = 194/419 (46.30%), Postives = 297/419 (70.88%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
             +T GPNEA+ +SG C     M  + GG  +    + Q+Q+ISL  +TLN   E V T+ GVP++VTG+AQVK+  +   +LA AC+ FLG+  +EI    L+TL+GH RAI+  +TVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V++DA IG AEA+RDAGIREA+ ++ ++  +Y ++ E+A A R Y+L+KA++D EV   RA+A+LA++LQ AK KQ+I  + +Q++VVER + + ++E+EI R EKELE  V+KPAEAE +K E LA+A +++ ++ A+ EA S+R++G AEA ++ A  +AEAE+M  KA A+  Y +AA L ++L+ LP+VA EI+ PL   N+I ++ SGS +   + +TGE+  +L  LP +V+ +TGV ISQ
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVM--VAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of flotillin-2 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 328.561 bits (841), Expect = 4.248e-107
Identity = 194/419 (46.30%), Postives = 297/419 (70.88%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
             +T GPNEA+ +SG C     M  + GG  +    + Q+Q+ISL  +TLN   E V T+ GVP++VTG+AQVK+  +   +LA AC+ FLG+  +EI    L+TL+GH RAI+  +TVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V++DA IG AEA+RDAGIREA+ ++ ++  +Y ++ E+A A R Y+L+KA++D EV   RA+A+LA++LQ AK KQ+I  + +Q++VVER + + ++E+EI R EKELE  V+KPAEAE +K E LA+A +++ ++ A+ EA S+R++G AEA ++ A  +AEAE+M  KA A+  Y +AA L ++L+ LP+VA EI+ PL   N+I ++ SGS +   + +TGE+  +L  LP +V+ +TGV ISQ
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVM--VAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 277/428 (64.72%), Postives = 354/428 (82.71%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M    LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          
BLAST of flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073950)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 277/428 (64.72%), Postives = 354/428 (82.71%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M    LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          
BLAST of flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 277/428 (64.72%), Postives = 354/428 (82.71%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M    LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          
BLAST of flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330216)

HSP 1 Score: 514.227 bits (1323), Expect = 7.623e-180
Identity = 278/441 (63.04%), Postives = 355/441 (80.50%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPS-------------LLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M   S             LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 437          
BLAST of flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073951)

HSP 1 Score: 514.227 bits (1323), Expect = 7.623e-180
Identity = 278/441 (63.04%), Postives = 355/441 (80.50%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPS-------------LLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M   S             LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 437          
BLAST of flotillin-2 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 506.138 bits (1302), Expect = 9.916e-177
Identity = 282/419 (67.30%), Postives = 347/419 (82.82%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN YTVGPNEAL +SGGCCG+      +GGW WAWWL++ +QKI+LE+MTL P CE VET EGV +TVTGVAQVKVMT+  LL  ACEQFLG+  +EI+  ILQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG++QTA V+RDADIGVAEAERDAGIREAEC+K  MDI+++ADT++A++ R  ++QKA+F+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEILR +KEL  TV++PAEAEAFK E LA+A++ K+VL AQ EAE I+  G AEA S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+A ++ APL +TNEIVIL SG   +  +TGE+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCYTVGPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVIL-SGDGGR--VTGEVNRLLAELPVSVNALTGVDLSK 416          
BLAST of flotillin-2 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 499.975 bits (1286), Expect = 3.030e-174
Identity = 281/430 (65.35%), Postives = 351/430 (81.63%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGAR 1383
            MG   TVGPNEAL +SG CCG+ +   ++GGW WAWWL+S  Q+I+LE+MTL P CE VET EGV +TVTGVAQVKVMT+  LLA ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ ADT++A++ R  +LQKA+F+ EV   +AE++LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEE+EI R EKEL  TVK+PAEAEA+K E LA+  + ++VL AQ EAE IR  G AEA S+S++GKAEAERMRLKA AY +YG+AA  +LVLDALPK+A +++APLA+TNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+S+   ++++ GA+
Sbjct:    1 MGCCLTVGPNEALVVSGACCGSDAKTYVVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTDKDLLAIACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELELQKAAFNQEVNTKKAESQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEREIERTEKELIATVKRPAEAEAYKMEQLAEGYKMQKVLTAQAEAEKIRKIGEAEAISISSVGKAEAERMRLKAEAYQQYGEAAKTALVLDALPKIAGKVSAPLARTNEIVIL-SGDGSR--VTGEVNRLLAELPVSVNALTGVDLSKMPLLQKLTGAQ 427          
BLAST of flotillin-2 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 330.872 bits (847), Expect = 3.655e-108
Identity = 197/422 (46.68%), Postives = 294/422 (69.67%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQAVR 1365
             YT GPNEA+ +SG C     M  I GG  + +  V Q+Q+ISL  +TLN   + V T+ GVP++VTG+AQ+K+  +   +LA AC+ FLG+  SEI    L+TL+GH RAI+  LTVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V++DA IG A+ +RDA IREA   + ++  +Y  + E+A A R Y+L+KA +D EVF  +AE+E+A++LQ AK KQ+I  E++Q+ VVER + I ++E+EI R EKELE  VKKPAEAE ++ E LA+A R + ++ A+ EAESIR++G AEA ++ A G+AEAE+M  KA A+  Y + A++ ++L+ LP +A EI+ PL+ TN++ ++ SG      + LTGE+  ++  LP  ++ +TGV+ISQ  R
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVM--ISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNISQVAR 421          
BLAST of flotillin-2 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 330.102 bits (845), Expect = 1.269e-107
Identity = 196/421 (46.56%), Postives = 294/421 (69.83%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQAV 1362
             YT GPNEA+ +SG C     M  I GG  + +  V Q+Q+ISL  +TLN   + V T+ GVP++VTG+AQ+K+  +   +LA AC+ FLG+  SEI    L+TL+GH RAI+  LTVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V++DA IG A+ +RDA IREA   + ++  +Y  + E+A A R Y+L+KA +D EVF  +AE+E+A++LQ AK KQ+I  E++Q+ VVER + I ++E+EI R EKELE  VKKPAEAE ++ E LA+A R + ++ A+ EAESIR++G AEA ++ A G+AEAE+M  KA A+  Y + A++ ++L+ LP +A EI+ PL+ TN++ ++ SG      + LTGE+  ++  LP  ++ +TGV+ISQ +
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVM--ISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNISQCI 420          
BLAST of flotillin-2 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 322.013 bits (824), Expect = 1.034e-104
Identity = 194/420 (46.19%), Postives = 292/420 (69.52%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQA 1359
             YT GPNEA+ +SG  CG      I GG  +    + Q+Q+I+L  +TLN   + V T+ GVP++VTG+AQVK+  +   +LA AC+ F+G+   EI    L+TL+GH RAI+  LTVE IYQDR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V+RDA IG A+ +RDA IREA   + ++  +Y+ + E+A A R ++L+KA++D EV   +AE+E+A++LQ AK KQ+I  E++Q++VVER + I ++E+EI R EKELE  ++KPAEAE ++ E LA+A R + ++ A+ EAESIR+KG AEA +L A G+AEAE+M  KA A+  Y + A++ ++L+ LP +A EI+ PL    ++ ++ SG      + LTGE+  ++  LP AV+ +TGV+ISQA
Sbjct:    2 FYTCGPNEAMVVSG--CGRAPPLMIAGGRVFVIPCIQQIQRITLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFMGKSEGEIANIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLSSLGKARTAQVQRDARIGEAQFKRDAVIREAHAMQEKVSAQYKNEIEMAKAQRDFELKKAAYDVEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVQVVERTQQIMLQEQEITRREKELEAKIRKPAEAERYRIEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKGYKEGAMVDMLLEKLPLMAEEISKPLCAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPGAVEKLTGVNISQA 419          
BLAST of flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 495.738 bits (1275), Expect = 1.979e-172
Identity = 273/419 (65.16%), Postives = 348/419 (83.05%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+ + + + GGW WAWW VS  Q+ISLE+MTL P C+ VET EGV LTVTGVAQVK+MTE  LLA A EQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V+RDADIGVAEAERDAGIREA C++  +D++Y ADT++A++ R +++QKA F  EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I+IEEKEI+R +KEL  TV++PAEAEA++ + +A+  + KQVL AQ EAE IR  G AEA+++ AIGKAEAE+M+LKA AY +YG+AA +++VL+ LP++AA+++APLAK +EIVIL SG +SK  +TGE+ RLL  +P +VQA+TGVD+++
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDTKQYVYGGWAWAWWCVSDTQRISLEIMTLQPKCDDVETAEGVALTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSK--ITGEMNRLLAEVPASVQALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 491.115 bits (1263), Expect = 1.191e-170
Identity = 271/419 (64.68%), Postives = 348/419 (83.05%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+ + + + GGW WAWW VS  Q++SLEVMT+   CE++ET EGVPL VTGVAQVK+MTE  LLA A EQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V+RDADIGVAEAERDAGIREA C++  +D++Y ADT++A++ R +++QKA F  EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I+IEEKEI+R +KEL  TV++PAEAEA++ + +A+  + KQVL AQ EAE IR  G AEA+++ AIGKAEAE+M+LKA AY +YG+AA +++VL+ LP++AA+++APLAK +EIVIL SG +SK  +TGE+ RLL  +P +VQA+TGVD+++
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDTKQYVYGGWAWAWWCVSDTQRLSLEVMTILCRCENIETSEGVPLYVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSK--ITGEMNRLLAEVPASVQALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 479.945 bits (1234), Expect = 5.769e-166
Identity = 272/444 (61.26%), Postives = 348/444 (78.38%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQK-------------------------ISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+ + + + GGW WAWW VS  Q+                         +SLE+MTL P C+ VET EGV LTVTGVAQVK+MTE  LLA A EQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V+RDADIGVAEAERDAGIREA C++  +D++Y ADT++A++ R +++QKA F  EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I+IEEKEI+R +KEL  TV++PAEAEA++ + +A+  + KQVL AQ EAE IR  G AEA+++ AIGKAEAE+M+LKA AY +YG+AA +++VL+ LP++AA+++APLAK +EIVIL SG +SK  +TGE+ RLL  +P +VQA+TGVD+++
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDTKQYVYGGWAWAWWCVSDTQRTQPAASYFCAIIELLCVTHNSLYILLSLEIMTLQPKCDDVETAEGVALTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSK--ITGEMNRLLAEVPASVQALTGVDLTK 441          
BLAST of flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 447.588 bits (1150), Expect = 9.069e-153
Identity = 266/462 (57.58%), Postives = 339/462 (73.38%), Query Frame = 1
Query:  124 PNEALAIS--------GGCCGTGSMKTIIGGWGWAWWLVSQVQK-------------------------------------------ISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            PNE   IS        GGCCG+ + + + GGW WAWW VS  Q+                                           ISLE+MTL P C+ VET EGV LTVTGVAQVK+MTE  LLA A EQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V+RDADIGVAEAERDAGIREA C++  +D++Y ADT++A++ R +++QKA F  EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I+IEEKEI+R +KEL  TV++PAEAEA++ + +A+  + KQVL AQ EAE IR  G AEA+++ AIGKAEAE+M+LKA AY +YG+AA +++VL+ LP++AA+++APLAK +EIVIL SG +SK  +TGE+ RLL  +P +VQA+TGVD+++
Sbjct:    9 PNEKPLISCIICVSLLGGCCGSDTKQYVYGGWAWAWWCVSDTQRLSLEVMTILCRCENIETSEGVPLYVTGVAQVIKCGGYWEKICLISLEIMTLQPKCDDVETAEGVALTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSK--ITGEMNRLLAEVPASVQALTGVDLTK 467          
BLAST of flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 408.297 bits (1048), Expect = 1.925e-138
Identity = 239/372 (64.25%), Postives = 308/372 (82.80%), Query Frame = 1
Query:  253 LNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQ 1368
            L+  C ++ET EGVPL VTGVAQVK+MTE  LLA A EQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V+RDADIGVAEAERDAGIREA C++  +D++Y ADT++A++ R +++QKA F  EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I+IEEKEI+R +KEL  TV++PAEAEA++ + +A+  + KQVL AQ EAE IR  G AEA+++ AIGKAEAE+M+LKA AY +YG+AA +++VL+ LP++AA+++APLAK +EIVIL SG +SK  +TGE+ RLL  +P +VQA+TGVD+++   Q
Sbjct:   24 LSGNCFNIETSEGVPLYVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSK--ITGEMNRLLAEVPASVQALTGVDLTKVSTQ 392          
BLAST of flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 504.982 bits (1299), Expect = 2.949e-176
Identity = 277/431 (64.27%), Postives = 349/431 (80.97%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q+ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I+APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+   ++   GA+V
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV 428          
BLAST of flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 499.59 bits (1285), Expect = 3.530e-174
Identity = 274/431 (63.57%), Postives = 349/431 (80.97%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q++SLEVMT+   CE++ET EGVPL VTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I+APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+   ++   GA+V
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV 428          
BLAST of flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 426.402 bits (1095), Expect = 3.958e-146
Identity = 247/382 (64.66%), Postives = 311/382 (81.41%), Query Frame = 1
Query:  247 MTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I+APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+   ++   GA+V
Sbjct:    1 MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV 379          
BLAST of flotillin-2 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 327.405 bits (838), Expect = 9.632e-107
Identity = 194/425 (45.65%), Postives = 297/425 (69.88%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIP 1374
             +T GPNEA+ +SG C     M  + GG  +    + Q+Q+ISL  +TLN   E V T+ GVP++VTG+AQVK+  +   +LA AC+ FLG+  +EI    L+TL+GH RAI+  +TVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V++DA IG AEA+RDAGIREA+ ++ ++  +  ++ E+A A R Y+L+KA++D EV   RA+A+LA++LQ AK KQ+I  + +Q++VVER + + ++E+EI R EKELE  V+KPAEAE ++ E LA+A + + ++ A+ EAES+R++G AEA ++ A  +AEAE+M  KA A+  Y +AA L ++L+ LP+VA EI+ PL   N+I ++ SGS +   + +TGE+  +L  LP +V+ +TGV ISQ     P
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVM--VAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVNHNKP 424          
BLAST of flotillin-2 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 263.848 bits (673), Expect = 9.590e-83
Identity = 172/424 (40.57%), Postives = 265/424 (62.50%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIP 1374
             +T GPNEA+ +SG C     M  + GG  +    + Q+Q+ISL  +TLN   E V T+ GVP++VTG+AQ                                                IY+DR +F+ QV +VA+ D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V++DA IG AEA+RDAGIREA+ ++ ++  +  ++ E+A A R Y+L+KA++D EV   RA+A+LA++LQ AK KQ+I  + +Q++VVER + + ++E+EI R EKELE  V+KPAEAE ++ E LA+A + + ++ A+ EAES+R++G AEA ++ A  +AEAE+M  KA A+  Y +AA L ++L+ LP+VA EI+ PL   N+I ++ SGS +   + +TGE+  +L  LP +V+ +TGV ISQ     P
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVM--VAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ-----------------------------------------------EIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVNHNKP 376          
BLAST of flotillin-2 vs. UniProt/SwissProt
Match: sp|O61492|FLOT2_DROME (Flotillin-2 OS=Drosophila melanogaster OX=7227 GN=Flo2 PE=2 SV=3)

HSP 1 Score: 514.227 bits (1323), Expect = 7.642e-179
Identity = 278/441 (63.04%), Postives = 355/441 (80.50%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPS-------------LLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGNI+T GPNEAL +SGGCCG+   +TI+GGW WAWWLV+ VQ++SL VMTLNP CE+VET +GVPLTVTGVAQ K+M   S             LL TA EQFLG+   EI++TILQTL+GHLRAILGTLTVE +Y+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD V+YL SLG+AQTA+VKRDAD GVAEA RDAGIREAECEK+ MD++Y  DT+I + TR Y+LQKA+FD E+   +AE++LA+ELQAAK +Q+IR+EEIQIEVVER+K IEIE +E+ R ++EL GTVK PAEAEAF+ + LA A++ + +  A+ EAE IR  G AEA ++  +GKAEAERMR+KA  Y +YGDAAI+++VL++LPK+AAE+ APLAKT+EIV++G G+D   ++T ++TRL+  LPP++ A+TGVD+S+ + +IPGA+
Sbjct:    1 MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG-GND---NITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 437          
BLAST of flotillin-2 vs. UniProt/SwissProt
Match: sp|Q98TZ8|FLOT2_DANRE (Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2)

HSP 1 Score: 506.138 bits (1302), Expect = 7.485e-176
Identity = 282/419 (67.30%), Postives = 347/419 (82.82%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN YTVGPNEAL +SGGCCG+      +GGW WAWWL++ +QKI+LE+MTL P CE VET EGV +TVTGVAQVKVMT+  LL  ACEQFLG+  +EI+  ILQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG++QTA V+RDADIGVAEAERDAGIREAEC+K  MDI+++ADT++A++ R  ++QKA+F+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEILR +KEL  TV++PAEAEAFK E LA+A++ K+VL AQ EAE I+  G AEA S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+A ++ APL +TNEIVIL SG   +  +TGE+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCYTVGPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVIL-SGDGGR--VTGEVNRLLAELPVSVNALTGVDLSK 416          
BLAST of flotillin-2 vs. UniProt/SwissProt
Match: sp|Q9Z2S9|FLOT2_RAT (Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2 PE=1 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 2.063e-175
Identity = 277/431 (64.27%), Postives = 349/431 (80.97%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q+ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I+APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+   ++   GA+V
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV 428          
BLAST of flotillin-2 vs. UniProt/SwissProt
Match: sp|Q60634|FLOT2_MOUSE (Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1 SV=2)

HSP 1 Score: 504.982 bits (1299), Expect = 2.063e-175
Identity = 277/431 (64.27%), Postives = 349/431 (80.97%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q+ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I+APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+   ++   GA+V
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV 428          
BLAST of flotillin-2 vs. UniProt/SwissProt
Match: sp|Q14254|FLOT2_HUMAN (Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2)

HSP 1 Score: 503.056 bits (1294), Expect = 1.082e-174
Identity = 274/419 (65.39%), Postives = 342/419 (81.62%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+   + + GGW WAWW +S  Q+ISLE+MTL P CE VET EGV LTVTGVAQVK+MTE  LLA ACEQFLG+   +I+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA+V+RDADIGVAEAERDAGIREAEC+K  +D+++ ADT+IA++ R ++LQK++F  EV    AEA+LA+ELQ A+E+QKIR EEI+IEVV+RKK I +E +EILR +KEL  TV++PAEAEA + + +A+  + KQVLLAQ EAE IR  G AEA+ + A+GKAEAERM+LKA AY KYGDAA ++LVL+ALP++AA+I APL K +EIV+L SG +SK  +T E+ RLL  LP +V A+TGVD+S+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSK--VTSEVNRLLAELPASVHALTGVDLSK 416          
BLAST of flotillin-2 vs. TrEMBL
Match: V9XMS7 (Flotillin-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 430/431 (99.77%), Postives = 431/431 (100.00%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 1392
            MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANAT+GYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS
Sbjct:    1 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATKGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          
BLAST of flotillin-2 vs. TrEMBL
Match: A0A068CL83 (Flotillin-2 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 422/431 (97.91%), Postives = 429/431 (99.54%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 1392
            MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMD+RYEADTEIANATRG+QLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKEL+GTVKKPAEAEAFKTE+LADARRTKQVLLAQGEAE+IRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAE+ APLAKTNEIVILGSGSDSKSD TGEIT+LLGNLPPAVQAMTGVDISQAVRQIPGARVIS
Sbjct:    1 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDVRYEADTEIANATRGFQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELDGTVKKPAEAEAFKTEILADARRTKQVLLAQGEAEAIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEVAAPLAKTNEIVILGSGSDSKSDFTGEITKLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          
BLAST of flotillin-2 vs. TrEMBL
Match: A9LYL3 (Putative flotillin OS=Heliocidaris tuberculata OX=7635 PE=2 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 300/428 (70.09%), Postives = 364/428 (85.05%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGN +TVGPNEAL +SGGCCG    K ++GGW WAW LV+ VQ++SLEVMTLNP CE VET +GVPLTVTGVAQVKVMTE  LLA ACEQF+GR  SEIE  +LQTL+GHLRAILGTLTVE IY+DRDQFA  VREVA+PDV +MG+EI+SFTIKDVYD V+YL+SLG+ QTA VKRDADIGVAEAERDAGIREAECEK+ MDI+++ADT++A++ R Y++ KA ++AEV   +AE+ELA+ LQ AKEKQKIRSEE+QIE+VER+K I++E KEI R E+EL  T+K+PAEAE+FK E LAD +R K VL A+GEAE IR  G AEAS++ AIGKAEAE MR+KAAAY +YGDAA++SLVL+ALPK+AAEI+APL+KTN+IV+LG   D ++  TGE+TRLLG+LPPAVQA+TG DIS+A+ QIPGAR
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGAAEKKYVMGGWAWAWCLVTDVQRLSLEVMTLNPRCESVETSKGVPLTVTGVAQVKVMTEEGLLAQACEQFIGRSISEIESVVLQTLEGHLRAILGTLTVEEIYRDRDQFAQLVREVASPDVGRMGLEIVSFTIKDVYDTVDYLDSLGKTQTAAVKRDADIGVAEAERDAGIREAECEKSMMDIKFDADTKVADSQRQYEMLKAGYEAEVNTKKAESELAYSLQGAKEKQKIRSEEVQIEIVERRKQIDVEAKEIERKERELIATIKRPAEAESFKVETLADGQRMKTVLAAKGEAEKIRNVGGAEASAIEAIGKAEAEMMRMKAAAYKQYGDAAMMSLVLEALPKLAAEISAPLSKTNDIVLLG---DDRT--TGELTRLLGSLPPAVQALTGTDISKALSQIPGAR 423          
BLAST of flotillin-2 vs. TrEMBL
Match: A0A4S2LG84 (PHB domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007464 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 300/439 (68.34%), Postives = 373/439 (84.97%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSK-----SDLTG---EITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 1392
            MGNI+TVGP+EAL ISGGCCGT +++TIIGGWGWAWW V+QVQKISL VMTLNP CE+VET EGVPLTVTGVAQVKVM +  LL  ACEQFLG++  EI+ TILQTL+GHLRAILGTLTVEAIY+DRDQFA  VREVAAPDV +MGIEILSFTIKDVYD+VEYL+SLGR+QTA+VKRDA IGVAEAERDAGIREAEC++AR+D+RY ADT+IAN+TR YQLQKASFD E+   RAEAELA++LQAAKE+QKIR+EE+ I +VER+K IE+EEKEIL +EK+++ TV++PAEAEA++ + +A+  RT++VL+AQ EA+ IR++G A A ++ A GKAEAERMRL+A AYNKYG+AA LSL+LDALPKVAAEI APLA+T EIV++G G         + LTG   +   ++G +P A++A+T VD+++ + QIPGA+V++
Sbjct:    1 MGNIHTVGPSEALVISGGCCGTDNVRTIIGGWGWAWWCVTQVQKISLSVMTLNPRCENVETSEGVPLTVTGVAQVKVMRDDKLLQAACEQFLGKQTREIQNTILQTLEGHLRAILGTLTVEAIYRDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDRVEYLDSLGRSQTAVVKRDAAIGVAEAERDAGIREAECDRARLDVRYTADTQIANSTRDYQLQKASFDQEINTARAEAELAYKLQAAKEQQKIRTEEVNITIVERRKQIEVEEKEILCSEKKMDATVRRPAEAEAYRLQQVAEGNRTRKVLIAQAEADGIRVRGQATAVAIQARGKAEAERMRLRADAYNKYGEAATLSLILDALPKVAAEIAAPLARTKEIVVMGGGCGEGTAGTINHLTGLGRDFATMMGTVPQAIRALTDVDLTKTIAQIPGAQVVT 439          
BLAST of flotillin-2 vs. TrEMBL
Match: R7UT48 (PHB domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_182829 PE=3 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 304/427 (71.19%), Postives = 364/427 (85.25%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGA 1380
            MGNI+TVGPNEAL ISGGCCG  S KTIIGGWGWAW +V+ VQ ISLEVMTLNP CE+VET EGVPLTVTGVAQ K++ E  LL  ACEQFLG+    IE  +LQTL+GHLRAILGTL+VEAIYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYD VEYL SLGRAQTA VKRDADIGVAEA RDAGIREAECEKARMD RY ADT+IA++ R +++QKA+FD EV   +AEAELA+ELQ AKEKQ+IRSEE++IEVVER+K IEIEEKEI R +KEL  T+K+PAEAEA+K ++LA+  RT+ V+ A+ ++ESIRL G AEASS+ A+GKAEAERM+LKA+AY +YG+AA+LSLVL+ LPKVAAE++APLAKT+EIV+LG   D ++  T E+TRLL N+PPA+QA+TGVD+++ + ++PGA
Sbjct:    1 MGNIHTVGPNEALVISGGCCGAQSKKTIIGGWGWAWCMVTDVQTISLEVMTLNPVCENVETSEGVPLTVTGVAQCKIIVEQELLGRACEQFLGKEVDHIERVVLQTLEGHLRAILGTLSVEAIYQDRDQFAQLVREVAAPDVGRMGIEILSFTIKDVYDNVEYLESLGRAQTANVKRDADIGVAEANRDAGIREAECEKARMDSRYAADTKIADSKRMFEMQKANFDMEVNARKAEAELAYELQGAKEKQRIRSEEMEIEVVERRKQIEIEEKEISRKDKELMATIKRPAEAEAYKMQILAEGSRTQTVMTAEADSESIRLIGAAEASSIEAVGKAEAERMKLKASAYKQYGEAAMLSLVLETLPKVAAEVSAPLAKTDEIVLLG---DDRT--TSEVTRLLSNMPPAIQALTGVDLTKVLAKVPGA 422          
BLAST of flotillin-2 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 494.582 bits (1272), Expect = 3.351e-172
Identity = 277/419 (66.11%), Postives = 346/419 (82.58%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+      +GGW WAW L++ +QKI+LE+MTL P CE VET EGV LTVTGVAQVKVMT+  LL+ ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ ADT++A++ R  ++QKASF+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEI+R +KEL  TVK+PAEAEA+K + LA+ ++ K+VL AQ EAE I+  G AEA+S+ A+GKAEAE+MR+KA AY +YG+AA  +LVL+ALPK+A ++ APLA+TNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+++
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKITLEIMTLQPKCEDVETAEGVALTVTGVAQVKVMTDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEGSR--VTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 489.96 bits (1260), Expect = 1.847e-170
Identity = 275/419 (65.63%), Postives = 346/419 (82.58%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MGN +TVGPNEAL +SGGCCG+      +GGW WAW L++ +QK+SLEVMT+   CE++ET EGVPL VTGVAQVKVMT+  LL+ ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRDQFA  VREVAAPDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ ADT++A++ R  ++QKASF+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEI+R +KEL  TVK+PAEAEA+K + LA+ ++ K+VL AQ EAE I+  G AEA+S+ A+GKAEAE+MR+KA AY +YG+AA  +LVL+ALPK+A ++ APLA+TNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+++
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKLSLEVMTILCRCENIETSEGVPLDVTGVAQVKVMTDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEGSR--VTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 484.567 bits (1246), Expect = 2.833e-168
Identity = 274/419 (65.39%), Postives = 339/419 (80.91%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MG+  TVGPNEAL +SGGC G+     ++GGW WAWW ++  Q+I+LE+MTL P CE VET EGV +TVTGVAQVKVMT+  LLA ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRD+FA  VREVAAPDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V+RDADIGVAEAERDAGI+EAEC+K  MD+ + ADT++AN+ R   LQKA+F+ EV   +AEA+LA+ELQAAKE QKIR EEI+IEVV+RKK I IE+KEI R EKEL   VK+PAEAEA+K   LA+ ++ K+VL AQ EAE IR  G AEA S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+AA+++APLA+TNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+++
Sbjct:    1 MGSCLTVGPNEALVVSGGCTGSDEKIYVVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVTGVAQVKVMTDKDLLAIACEQFLGKSVMEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDKFAQLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIKEAECKKEMMDVTFLADTKMANSKRELDLQKAAFNQEVNSKKAEAQLAYELQAAKELQKIRLEEIEIEVVQRKKQIVIEDKEINRTEKELIAIVKRPAEAEAYKMLQLAEGQKIKKVLTAQAEAEKIRKIGEAEAKSIEAVGKAEAEKMRLKADAYQQYGEAAKTALVLEALPKIAAKVSAPLARTNEIVIL-SGEGSR--VTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 483.411 bits (1243), Expect = 1.192e-167
Identity = 274/419 (65.39%), Postives = 339/419 (80.91%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            MG+  TVGPNEAL +SGGC G+     ++GGW WAWW ++  Q+I+LE+MTL P CE VET EGV +TVTGVAQVKVMT+  LLA ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE IYQDRD+FA  VREVAAPDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V+RDADIGVAEAERDAGI+EAEC+K  MD+ + ADT++AN+ R   LQKA+F+ EV   +AEA+LA+ELQAAKE QKIR EEI+IEVV+RKK I IE+KEI R EKEL   VK+PAEAEA+K   LA+ ++ K+VL AQ EAE IR  G AEA S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+AA+++APLA+TNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+++
Sbjct:    1 MGSCLTVGPNEALVVSGGCTGSDEKIYVVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVTGVAQVKVMTDKDLLAIACEQFLGKSVMEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDKFAQLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIKEAECKKEMMDVTFLADTKMANSKRELDLQKAAFNQEVNSKKAEAQLAYELQAAKELQKIRLEEIEIEVVQRKKQIVIEDKEINRTEKELIAIVKRPAEAEAYKMLQLAEGQKIKKVLTAQAEAEKIRKIGEAEAKSIEAVGKAEAEKMRLKADAYQQYGEAAKTALVLEALPKIAAKVSAPLARTNEIVIL-SGEGSR--VTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of flotillin-2 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 326.25 bits (835), Expect = 1.916e-106
Identity = 194/419 (46.30%), Postives = 292/419 (69.69%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
             YT GPNEA+ +SG  CG      I GG  +    + Q+Q+ISL  +TLN   + V T+ GVP++VTG+AQVK+  +   +LATAC+ FLG+  +EI +  L+TL+GH RAI+  LTVE IYQDR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YL SLG+A+TA V+RDA IG A+ +RD+ IREA   + ++  +Y  + E+A A R Y+L+KA++D E+   +AE+E+A++LQ AK KQ+I  E++Q+ VVER + I ++E+EI R EKELE  VKKPAEAE ++ E LA+A R + ++ A+ EAESIR+KG AEA +L A G+AEAE+M  KA A+ +Y + A++ ++L+ LP +A EI+ PL+   ++ ++ SG      + LTGE+  ++  LP  ++ +TG++ISQ
Sbjct:    2 FYTCGPNEAMVVSG--CGRSPPIMISGGRVFVLPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFLGKTETEISQIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLQSLGKARTAQVQRDARIGEAQYKRDSVIREAHAMQEKVSAQYVNEIEMAKAQRDYELKKAAYDIEINTKKAESEMAYQLQVAKTKQRIEEEKMQVMVVERTQQITLQEQEISRKEKELEAKVKKPAEAEKYRLEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKQYKEGAMVDMLLEKLPLMAEEISKPLSAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPATIEKLTGINISQ 418          
BLAST of flotillin-2 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 483.026 bits (1242), Expect = 2.147e-168
Identity = 277/420 (65.95%), Postives = 340/420 (80.95%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA 1359
            MGN  TVGPNEAL +SGG CG    K + GGW W W LVSQ Q+ISLE+MTLNP CE VET EGV LTVTGVAQVKVMT+  LLA ACEQFLGR   EI+  +LQTL+GHLR+ILGTLTVEA+YQDRDQFA  VREVA+PDV +MGIEILSFTIKDVYDKVEYL SLG+ Q A+VKRDA+IGVA+AERDAGIREAEC+K  MD+++ ADT+IAN+ R Y++QKA F+ E    +AEA+LA+ELQAAKE+QKIR EE QIEVV+R+K I++EE+EI R E+EL  TV+ PA+AEAF+ + +A+  + K+VL AQ +AE I+  G AEA+++ AIG+AEAE MRLKA AY +YG AAI+S+VLDALPK+AAE+ APL K +EIVIL SG  +++  T E+TRLL  LP  VQA+TGVD+S++
Sbjct:    1 MGNCETVGPNEALVVSGGWCGADEKKYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVTGVAQVKVMTDKDLLAVACEQFLGRTVDEIKSVVLQTLEGHLRSILGTLTVEAVYQDRDQFAQLVREVASPDVGRMGIEILSFTIKDVYDKVEYLASLGKTQAALVKRDAEIGVAQAERDAGIREAECKKNMMDVKFNADTKIANSKREYEMQKAFFNQESQTKKAEAQLAYELQAAKEQQKIRQEECQIEVVQRRKQIDVEEREIQRTERELIATVRCPAQAEAFRVQQIAEGDKIKRVLAAQADAERIKKIGDAEAAAIEAIGRAEAEEMRLKAEAYKQYGKAAIISMVLDALPKIAAEVAAPLQKIDEIVIL-SGEGNRT--TTEVTRLLAELPTTVQALTGVDLSKS 417          
BLAST of flotillin-2 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 299.286 bits (765), Expect = 1.109e-96
Identity = 195/416 (46.88%), Postives = 287/416 (68.99%), Query Frame = 1
Query:  139 AISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPG 1377
            A+    CG     TI GG  + W ++ Q+Q+ISL  MTLN   E V T++GVP++VTG+AQVK+  +   +LA AC+ FLG+   EI +  L+TL+GH RAI+G +TVE IY+DR +F+ +V  VA+ D+  MGI ++S+T+KDV D  +YL SLG+A+TA V+RDA IG AE +RDAGI+EA   + ++  +Y  + EIA A   ++L+ A++D EV   +A+A+LA++LQ AK KQKI  E++QI VVER + I ++E+EILR EKEL+  +KKPAEAE ++ E LA+A R + ++ A+ EAESI++KG AEA ++ A  KAEAE+M  KA A+  Y +AA++ L+L+ LPK+A E++ PL+K  ++ ++ SG      S LT E+  ++  LP +V+ +TGV ISQ VR  P 
Sbjct:    1 AVLSPGCGRSPPITITGGRVFVWPIIQQLQRISLNTMTLNVRSEKVYTRQGVPISVTGIAQVKIQGQNKDMLAAACQMFLGKGDEEISQIALETLEGHQRAIMGNMTVEEIYKDRKKFSQEVFRVASSDLLNMGISVVSYTLKDVRDDEDYLKSLGKARTAQVQRDARIGEAEMKRDAGIKEAMAVEQKVAAQYLNEIEIAKAQLEFELKTAAYDMEVNTQKAQADLAYQLQVAKTKQKIEEEKMQILVVERTQQILVQEQEILRREKELDAKIKKPAEAEKYRLEKLAEAGRARVIMEAEAEAESIKIKGEAEAYAIEAKAKAEAEQMLQKAQAFKDYEEAAMVDLLLETLPKIATEVSQPLSKARKVTMISSGGGEVGASKLTSEVLDIMSKLPESVERLTGVKISQ-VRSAPN 415          
BLAST of flotillin-2 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 291/428 (67.99%), Postives = 354/428 (82.71%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGAR 1383
            MGN YTVGPNEAL +SGGCCG+ + KT+IGGW +AW  V+ VQ ISLEVMTLNPTCE VET +GV +TVTGVAQVKVMTEP LL TACEQFLG+   +IE  +LQTL+GHLRAILGTL+VE IY+DR+ FA  VREVA+PDV +MGIEILSFTIKD+ D V+YLNSLG+ QTA VKRDADIGVAEA+RDAGIREAECEK +MD+ YE  T IA+++R YQ+QKA++D EV   +AEAEL++ELQ  KEKQKIRSEEIQIEVVER+K IE++EKEI R EKEL   VK+PAEAE++K E LA  +RT+ V LAQ +AE I+L G +EAS++ AIGKAEAERMR KAAAY  YGDAA+ +L+L+ALPKVAAE+ APLAKT EIVI+   +D  + ++GE+++LLG LPPA+QA+TG D+S  + +IPGAR
Sbjct:    1 MGNCYTVGPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVTGVAQVKVMTEPRLLKTACEQFLGKTTRQIESVVLQTLEGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDVVYETQTNIADSSREYQMQKAAYDQEVNTRKAEAELSYELQGNKEKQKIRSEEIQIEVVERRKQIEVQEKEIQRKEKELIAEVKRPAEAESYKVETLAQGKRTQTVFLAQADAERIKLIGSSEASAIEAIGKAEAERMRQKAAAYKMYGDAAMTALILEALPKVAAEVAAPLAKTGEIVII---NDDGNSVSGELSKLLGQLPPAIQALTGTDLSGVLNKIPGAR 425          
BLAST of flotillin-2 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 329.717 bits (844), Expect = 3.100e-108
Identity = 204/419 (48.69%), Postives = 300/419 (71.60%), Query Frame = 1
Query:  115 TVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPS-LLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVIL--GSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAV 1362
            T GPNEA+ +SG  C       + GG  + W +  ++Q+ISL  MTLN     V T+ GVP++VTG+AQVK+  +   +L  AC+QFLG+   +     L+TL+GH RAI+GT+TVE IY+DR +F+  V EVA+ D+  MGI I+S+TIKD+ D+  YL++LG ++TA VKRDA IG AEA+RD+GI+EA  E+AR+  +YE DT+IA A R ++L+KA +D EV    A +++A+ LQAA  KQKI+ EE+QI+VVER + I+++E+EI R E+ELE TV++PAEAE ++ E LA+A R + +L A+ ++E+I++KG AEA ++ A  KAEAE+M  KA A+ +Y +AAI+ +VL+ +PK+AAEI APL++ N+I ++  G G    S +TGEI  ++  LP AV+A+TG+DIS+A+
Sbjct:    6 TCGPNEAMVVSG--CFHARPALVSGGRIFVWPVFQKLQRISLNTMTLNVESPRVYTRHGVPISVTGIAQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEEIYRDRKKFSKSVFEVASSDLVNMGISIVSYTIKDIRDEEGYLHALGMSRTAQVKRDARIGEAEAKRDSGIKEAIAEEARLKAKYENDTQIAKAKRDFELKKAGYDIEVQTKNATSQMAYNLQAAVTKQKIKEEEMQIKVVERGQQIKVQEQEIARRERELEATVRQPAEAEKYRLEKLAEANRNRVILEAEAQSEAIKVKGDAEAFAIEAKAKAEAEQMAKKADAWKEYREAAIVDMVLETMPKIAAEIAAPLSQVNKITMVSNGKGEVGASKVTGEILDIVAKLPKAVEALTGIDISKAM 422          
BLAST of flotillin-2 vs. Ensembl Nematostella
Match: EDO25979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD74])

HSP 1 Score: 108.612 bits (270), Expect = 5.720e-29
Identity = 53/68 (77.94%), Postives = 60/68 (88.24%), Query Frame = 1
Query:  475 DRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIR 678
            DR+ FA  VREVA+PDV +MGIEILSFTIKD+ D V+YLNSLG+ QTA VKRDADIGVAEA+RDAGIR
Sbjct:    1 DREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIR 68          
BLAST of flotillin-2 vs. Ensembl Nematostella
Match: EDO37689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF44])

HSP 1 Score: 66.2402 bits (160), Expect = 1.179e-11
Identity = 33/62 (53.23%), Postives = 45/62 (72.58%), Query Frame = 1
Query: 1189 LPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIP 1374
            L +VAAE+ APLAKT EIVI+   +D  + ++GE+++LLG LPPAVQA+TG D+S      P
Sbjct:  382 LSEVAAEVAAPLAKTGEIVII---NDDGNSVSGELSKLLGQLPPAVQALTGTDLSGGSFLYP 440          
BLAST of flotillin-2 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 505.753 bits (1301), Expect = 1.519e-176
Identity = 283/417 (67.87%), Postives = 344/417 (82.49%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDI 1350
            MGN +TVGPNEAL +SGGCCG+     ++GGW WAWWL+S +Q+I+LE+MTL P CE VET EGV +TVTGVAQVKVMTE  LL  ACEQFLG+   EI+  ILQTL+GHLRAILGTLTVE IYQDRD+FA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ ADT++A++ R  ++QKASF+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEI R EKEL  TVK+PAEAEA+K + LA+ ++ K+VL AQ EAE IR  G AEA+S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+A ++ APL+KTNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVIL-SGDGSR--VTGEVNRLLAELPVSVNALTGVDL 414          
BLAST of flotillin-2 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 502.671 bits (1293), Expect = 1.739e-175
Identity = 282/417 (67.63%), Postives = 344/417 (82.49%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDI 1350
            MGN +TVGPNEAL +SGGCCG+     ++GGW WAWWL+S +Q++SLEVMT+   CE++ET EGVPL VTGVAQVKVMTE  LL  ACEQFLG+   EI+  ILQTL+GHLRAILGTLTVE IYQDRD+FA  VREVAAPDV +MGIEILSFTIKDVYDKVEYL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ ADT++A++ R  ++QKASF+ EV   +AEA+LA+ELQAAKE+QKIR EEI+IEVV+RKK I IEEKEI R EKEL  TVK+PAEAEA+K + LA+ ++ K+VL AQ EAE IR  G AEA+S+ A+GKAEAE+MRLKA AY +YG+AA  +LVL+ALPK+A ++ APL+KTNEIVIL SG  S+  +TGE+ RLL  LP +V A+TGVD+
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVTGVAQVKVMTERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVIL-SGDGSR--VTGEVNRLLAELPVSVNALTGVDL 414          
BLAST of flotillin-2 vs. Ensembl Medaka
Match: ENSORLT00000002428.2 (flotillin-2 [Source:NCBI gene;Acc:101164911])

HSP 1 Score: 463.766 bits (1192), Expect = 3.703e-160
Identity = 268/431 (62.18%), Postives = 339/431 (78.65%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQA--VRQIPGARV 1386
            MG+  TVGPNEAL +SG C        IIGG+ WA   V+ VQ+ISLEVMTLNP CE VET EGV +TVTGVAQV+V+TE  LLA ACEQFLG+   EI+  +LQTL+GHLR+ILGTLTVE I+QDRDQFA  VR+VAAPDV +MGIEILSFTIKDV+D+V YL+SLG+ QTA V+RDADIGVAEAERDAGIREAEC+K  MD+++ AD  +A++ R  +LQK +F+ E+   +AEA+LA+ELQAAKE QKIR EEI+IEVV+RKK I IEEKEI R EKEL   VK+PAEAEA+K   LA+ ++ K++L+AQ EAE IR  G A+A++  A+G+AEAE+M+LKA AY +YGDAA  +LVL+ALPK+A+ + APLAKTNEIVIL   S  +S +TGE+ RLL  LP +V A+TGVD+++   ++Q+  +R+
Sbjct:    1 MGSCLTVGPNEALVVSGSCSDGNKKSYIIGGFAWACCCVTDVQRISLEVMTLNPLCESVETAEGVAITVTGVAQVRVITEHDLLAVACEQFLGKTVDEIKLVLLQTLEGHLRSILGTLTVEQIFQDRDQFAKLVRDVAAPDVGRMGIEILSFTIKDVFDRVNYLSSLGKTQTAAVRRDADIGVAEAERDAGIREAECKKEMMDVKFVADIRMADSKRELELQKFAFNQEINTKKAEAQLAYELQAAKESQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELVAIVKRPAEAEAYKLRQLAEGQKLKKILIAQAEAERIRKIGEAQAATTEAVGRAEAEKMKLKAEAYQQYGDAAKTALVLNALPKIASVVAAPLAKTNEIVIL---SGDRSGVTGEVNRLLAELPVSVNALTGVDLTKIPLLQQLAPSRI 428          
BLAST of flotillin-2 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 329.717 bits (844), Expect = 7.605e-108
Identity = 193/418 (46.17%), Postives = 297/418 (71.05%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDIS 1353
             YT GPNEA+ +SG C     M  I GG  + +  + Q+Q+ISL  +TLN   + V T+ GVP++VTG+AQ+K+  +   +LA AC+ F+G+   EI +  L+TL+GH RAI+  LTVE IY+DR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V++DA IG A  +RDA IREA   + ++  +Y+ D E+A A R Y+L+KA++D EV   +AE+E+A++LQ AK KQ+I  E +Q++VVER + I ++++EI R EKELE  VKKPAEAE ++ E LA+A+R K ++ A+ EAESIR+KG AEA ++ A+G+AEAE+M  KA A+ +Y D A++ ++++ LP +A EI+ PL++ ++I ++ SG+     + L+GE+  ++  LP AV+ +TGV+IS
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPLM--IAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVNIS 417          
BLAST of flotillin-2 vs. Ensembl Medaka
Match: flot1b (flotillin-1 [Source:NCBI gene;Acc:101157726])

HSP 1 Score: 318.546 bits (815), Expect = 5.820e-103
Identity = 191/420 (45.48%), Postives = 294/420 (70.00%), Query Frame = 1
Query:  109 IYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQA 1359
             YT GPNEA+ +SG  CG      I GG  + +  + ++Q+ISL  +TLN   + V T+ GVP++VTG+AQVK+  +   +LATAC+ F+G+   EI E  L+TL+GH RAI+  LTVE IYQDR +F+ QV +VA+ D+  MGI ++S+T+KDV+D  +YLNSLG+A+TA V++DA IG A+ +RD+ I+EA   + ++  +Y+ + E+A A R Y+L+KA++D EV   +AE+E+A++LQ AK KQ I  E++Q+ VVER + I ++E+EI+R EKELE  V KPA+AE ++ E LA+A+R + ++ A+ EAESI++KG AEA ++ A G+AEAE+M  KA A+ +Y + A++ L+L+ LP +A  I+ PL+   +I ++ SG      + L GE+  ++  +P A++ +TG+DISQA
Sbjct:   40 FYTCGPNEAMVVSG--CGRAPPLMIAGGRVFVFPCIQKIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFMGKSEREISEIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLNSLGKARTAQVQKDARIGEAQYKRDSVIKEARAMQEKVSAQYKNEIEMAKAQRDYELKKAAYDKEVNAKKAESEMAYQLQVAKTKQCIEEEKMQVLVVERTQQIMLQEQEIIRKEKELEAKVMKPADAERYRLEKLAEAQRAQLIMEAEAEAESIKMKGEAEAFAMEAKGRAEAEQMAKKAEAFKQYKEGAMVDLLLEKLPLMAEAISEPLSHAQKITMVSSGGSEVGAAKLAGEVLDIMTRVPSALEKLTGIDISQA 457          
BLAST of flotillin-2 vs. Planmine SMEST
Match: SMESG000024114.1 (SMESG000024114.1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 431/431 (100.00%), Postives = 431/431 (100.00%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 1392
            MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS
Sbjct:    1 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          
BLAST of flotillin-2 vs. Planmine SMEST
Match: SMESG000017953.1 (SMESG000017953.1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 286/431 (66.36%), Postives = 356/431 (82.60%), Query Frame = 1
Query:  100 MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 1392
            MGNI+TVGPNEAL ISGGC G   +KTI+GGWGW+WWLV +VQ +SLEVMTL P CE VET EGVP+TVTGVAQVKVM E +LL  ACEQFLG++R +I  TILQTL+GHLRAILGTLTVEA+YQDRDQFA  VREVA+PDV+KMGIEILSFTIKDVYDKVEYLNSLGRAQTA VK+DADIGVAEAERDAGIREAECEK RM+IRY+A+TEIA+A R + +QKA F+ +V + +AE+ELA+ELQAAKEKQ+IR+EEIQIEVVE+ K I IEE E+LR E +L  +VKKPAE+EA+K E  A+  + +Q+ LA+ EA+ I LKG AEA  +  IGKAEA RM+L+A A+ KYG  AIL+ ++D++P++AAE+T+PL +T  I I+ SG+     L  E+ +LLG+LPP +QA+TG+DI+ A+ +IPGA +++
Sbjct:    1 MGNIHTVGPNEALIISGGCFGDKKVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVTGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQIEVVEKNKQIIIEENEVLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFLAKAEAKKIELKGEAEALVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 429          
BLAST of flotillin-2 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 319.316 bits (817), Expect = 9.252e-104
Identity = 192/417 (46.04%), Postives = 289/417 (69.30%), Query Frame = 1
Query:  115 TVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMT-EPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQ 1356
            T GPNEA+ ISG   G   +  I GG  +   L+ +V +ISL +MTL      + T+ GVP+TVTGVAQVK+ +    +LATACEQFLGR   +I +   +TL+GH RAI+G +TVE IY DR +F+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG A+TA VKRD  IG AEA+RDAGI++A+ E+A++  +   +T+IA A R +QL+KA +D E+   +A+++L++ LQ A  KQ+I+ EE+QI+VVER + ++++E EI R +KELE  V+KPAEAEA++ + +A+A + + +  A+GE+E+IRL G A A ++ A+ KAEAE++  KA A+  YG AA L + L+ LPK+AAE+ +PL+  ++I ++ SG+     + +TGE+  ++  LP  V+ MTG DI++
Sbjct:    7 TCGPNEAMVISGMFYGKPHL--ISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQVKIQSSNKEMLATACEQFLGRSVHQIMDVAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 421          
BLAST of flotillin-2 vs. Planmine SMEST
Match: SMESG000062944.1 (SMESG000062944.1)

HSP 1 Score: 296.975 bits (759), Expect = 3.818e-95
Identity = 188/418 (44.98%), Postives = 285/418 (68.18%), Query Frame = 1
Query:  121 GPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVM-TEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVIL--GSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVR 1365
            GPNEA+ +SG  C       I GG  + W ++ ++QKISL  MTL  T   + T+ GVP+TVTGVAQ+K+  ++  +LATACEQFLG+   EI +   +TL+ H RAI+G +TVE IY+DR +F+  V EVA+ D+  MGI ++S+T+KD+ D   YL +LG A+TA VKRDA IG AEA++D+GI+EA  E+ +   +   D EIA ++R Y+L+KA+F+ EV   RAE++ ++++QAAK +Q I+ E +QI+V+ER + IE+E  EILR +K LE TV+K A+AE ++ E L +A   +    A+ EAE I+LKG AEA ++    +A+A +M LKA A+ +Y +AA L++ LD LP++AAE+ AP++  ++I ++  GSG    S LT EI  ++  LP  +Q++TG +I ++++
Sbjct:    9 GPNEAMVVSG--CFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILLRAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTTEILEIMEKLPGVIQSITGFNIKESMQ 424          
BLAST of flotillin-2 vs. Planmine SMEST
Match: SMESG000063612.1 (SMESG000063612.1)

HSP 1 Score: 266.159 bits (679), Expect = 2.141e-83
Identity = 183/411 (44.53%), Postives = 266/411 (64.72%), Query Frame = 1
Query:  115 TVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTEP-SLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRXXXXXXXXXXXXXXXQKIRSEEIQXXXXXXXXXXXXXXXXXXXXXXXXXGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVIL--GSGSDSKSDLTGEITRLLGNLPPAVQAMT 1338
            T GPNE L +SG C G   M  IIGG  + W  V   QK+SL V T+      + TK GV LTVTGVAQ+K+  +   +L  ACEQFLG++  +I + +  TL+ H RAI+G +TVE IYQDR +F+ +V  V++ D+  MGI ++S+TIKD+ D+  YL +LG+ +TA V RDA IG AEA RDA I++A+ ++A+M  +   +T IA A R +QLQKA FD EV    A AE+A++LQ AK  Q I  E   I+V+ER+  I+++E E+ R E++L+ ++K  A AE ++ + LA+A +TK V  A+ E+E+I+LKG AEA ++  +GKA+A +M +KA A+ +Y  AA + +VL  LP +AAE+  PL    +I ++  G G    S LTGE+  ++ NL  AV  M+
Sbjct:    5 TSGPNEVLVVSGCCLGKPLM--IIGGKKFVWSGVQTYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQMHAKLANNTAIAKADRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 413          
The following BLAST results are available for this feature:
BLAST of flotillin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT22.252e-17565.39flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT22.263e-17364.68flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT21.019e-15857.38flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT14.248e-10746.30flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT14.248e-10746.30flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of flotillin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of flotillin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo20.000e+064.72gene:FBgn0264078 transcript:FBtr0073952[more]
Flo20.000e+064.72gene:FBgn0264078 transcript:FBtr0073950[more]
Flo20.000e+064.72gene:FBgn0264078 transcript:FBtr0330217[more]
Flo27.623e-18063.04gene:FBgn0264078 transcript:FBtr0330216[more]
Flo27.623e-18063.04gene:FBgn0264078 transcript:FBtr0073951[more]
back to top
BLAST of flotillin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2a9.916e-17767.30flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot2b3.030e-17465.35flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
flot1a3.655e-10846.68flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a1.269e-10746.56flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1b1.034e-10446.19flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
back to top
BLAST of flotillin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot21.979e-17265.16flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot21.191e-17064.68flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot25.769e-16661.26flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot29.069e-15357.58flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot21.925e-13864.25flotillin 2 [Source:NCBI gene;Acc:496443][more]
back to top
BLAST of flotillin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot22.949e-17664.27flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot23.530e-17463.57flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot23.958e-14664.66flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot19.632e-10745.65flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot19.590e-8340.57flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
back to top
BLAST of flotillin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61492|FLOT2_DROME7.642e-17963.04Flotillin-2 OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|Q98TZ8|FLOT2_DANRE7.485e-17667.30Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2... [more]
sp|Q9Z2S9|FLOT2_RAT2.063e-17564.27Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2... [more]
sp|Q60634|FLOT2_MOUSE2.063e-17564.27Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1... [more]
sp|Q14254|FLOT2_HUMAN1.082e-17465.39Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 ... [more]
back to top
BLAST of flotillin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9XMS70.000e+099.77Flotillin-2 OS=Schmidtea mediterranea OX=79327 PE=... [more]
A0A068CL830.000e+097.91Flotillin-2 OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A9LYL30.000e+070.09Putative flotillin OS=Heliocidaris tuberculata OX=... [more]
A0A4S2LG840.000e+068.34PHB domain-containing protein OS=Opisthorchis feli... [more]
R7UT480.000e+071.19PHB domain-containing protein OS=Capitella teleta ... [more]
back to top
BLAST of flotillin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2a3.351e-17266.11flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2a1.847e-17065.63flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2b2.833e-16865.39flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
flot2b1.192e-16765.39flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
flot1b1.916e-10646.30flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
back to top
BLAST of flotillin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot2a2.147e-16865.95flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot1b1.109e-9646.88flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
back to top
BLAST of flotillin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of flotillin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO376880.000e+067.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471823.100e-10848.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259795.720e-2977.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376891.179e-1153.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of flotillin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2a1.519e-17667.87flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a1.739e-17567.63flotillin 2 [Source:NCBI gene;Acc:101169802][more]
ENSORLT00000002428.23.703e-16062.18flotillin-2 [Source:NCBI gene;Acc:101164911][more]
flot1a7.605e-10846.17flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1b5.820e-10345.48flotillin-1 [Source:NCBI gene;Acc:101157726][more]
back to top
BLAST of flotillin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024114.10.000e+0100.00SMESG000024114.1[more]
SMESG000017953.10.000e+066.36SMESG000017953.1[more]
SMESG000004975.19.252e-10446.04SMESG000004975.1[more]
SMESG000062944.13.818e-9544.98SMESG000062944.1[more]
SMESG000063612.12.141e-8344.53SMESG000063612.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030227
GenBankAHD24750.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030227 ID=SMED30030227|Name=flotillin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1645bp
GATTATTATTGCAGCAAGCGCAGTTCGATTATAATGTGCCGTTTTTATAT
TTGTTTTAAAATTTGAACTATTTATTAAATAATATTTTAAAAGTTTAAGA
TGGGCAATATCTACACAGTTGGGCCTAACGAAGCGTTGGCAATATCTGGC
GGATGCTGTGGAACTGGTTCAATGAAAACAATTATCGGCGGTTGGGGATG
GGCTTGGTGGCTAGTAAGCCAAGTTCAAAAAATTTCATTAGAAGTCATGA
CATTGAATCCAACTTGTGAGCATGTTGAAACCAAAGAAGGTGTACCTTTA
ACAGTAACAGGTGTTGCACAAGTTAAAGTAATGACAGAGCCCAGTTTATT
GGCTACAGCCTGTGAACAATTTCTCGGCCGAAGAAGATCGGAAATAGAAG
AGACCATTTTACAAACCCTTGACGGTCATTTAAGAGCAATTCTTGGAACT
CTAACAGTTGAAGCTATTTACCAAGACAGAGATCAATTTGCCCATCAAGT
TCGAGAAGTAGCAGCACCCGATGTCGCTAAAATGGGGATCGAAATTTTGA
GCTTTACCATAAAAGATGTCTATGACAAAGTGGAATATCTTAATTCTTTG
GGCAGAGCTCAGACAGCTATTGTAAAGCGTGATGCTGATATAGGTGTGGC
TGAAGCTGAAAGAGATGCTGGCATAAGAGAAGCTGAGTGTGAAAAGGCTC
GAATGGATATACGGTATGAAGCTGATACTGAGATCGCTAATGCTACAAGA
GGCTACCAATTGCAAAAAGCGTCTTTTGACGCTGAAGTATTCAAAGTGAG
AGCTGAAGCTGAATTAGCTTTTGAATTACAGGCAGCTAAAGAAAAGCAAA
AAATTCGTTCAGAAGAAATCCAAATTGAAGTCGTTGAACGAAAAAAATTA
ATTGAAATAGAAGAAAAAGAAATTTTGAGGAACGAAAAAGAATTAGAAGG
AACAGTTAAGAAACCAGCGGAAGCTGAAGCCTTTAAAACTGAAGTTTTAG
CTGATGCCAGAAGAACAAAACAGGTTTTGTTAGCTCAAGGAGAAGCAGAA
TCGATTCGATTGAAAGGTCACGCAGAGGCCTCATCATTGAGTGCAATTGG
TAAGGCAGAGGCCGAAAGAATGAGATTAAAAGCAGCTGCCTACAATAAAT
ACGGCGATGCAGCTATACTCAGCTTAGTATTGGATGCTCTTCCGAAAGTC
GCAGCTGAGATCACTGCTCCATTGGCTAAAACTAATGAAATCGTTATACT
TGGTAGTGGTAGTGATTCCAAAAGTGATTTGACGGGAGAAATAACAAGAT
TATTGGGCAACCTTCCACCTGCTGTTCAGGCGATGACAGGAGTTGACATT
TCTCAGGCAGTTAGACAGATCCCGGGGGCTCGAGTTATCAGTTAATAGAT
ATTTGTTGATTGTGTAGACTTTTCGTGGTTTAATGAACTATTTATTATCC
TATGATTTTCTGTTCATTATTTCGATCTATATATAATCCCAAATTTGATT
ATCGTTTGTTGGATTTTCGATTACTTGTACTATTATAATTTTCTGTTCTT
TTTATTGCATAACTTATATTTGATATTGAATTTACTATTATTATTATTAT
TATTACTTAAATTTGTATGCAACGTGTCAAACTTTATTGTCTGGA
back to top

protein sequence of SMED30030227-orf-1

>SMED30030227-orf-1 ID=SMED30030227-orf-1|Name=SMED30030227-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
MGNIYTVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVM
TLNPTCEHVETKEGVPLTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIE
ETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEIL
SFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKA
RMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQ
KIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVL
ADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNK
YGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITR
LLGNLPPAVQAMTGVDISQAVRQIPGARVIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0030139endocytic vesicle
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0016600flotillin complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR031905Flotillin_C
IPR001107Band_7
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0035011melanotic encapsulation of foreign target
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 245..265
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 45..161
e-value: 3.5E-43
score: 148.4
NoneNo IPR availablePANTHERPTHR13806:SF39FLOTILLIN 2Bcoord: 1..420
NoneNo IPR availableCDDcd03399SPFH_flotillincoord: 34..178
e-value: 6.02035E-68
score: 210.823
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 87..269
e-value: 8.4E-8
score: 41.9
IPR001107Band 7 domainPFAMPF01145Band_7coord: 6..188
e-value: 1.3E-23
score: 83.9
IPR031905Flotillin, C-terminal domainPFAMPF15975Flotcoord: 315..387
e-value: 5.7E-9
score: 36.2
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 1..420
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 36..177