ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30030225
Length (bp)2874
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30030225) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30030225) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 176.022 bits (445), Expect = 4.463e-45
Identity = 143/532 (26.88%), Postives = 236/532 (44.36%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +V +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A++N N +LV+ L+   + ++ RA GT F                   R   +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++       W++  LT  +Y LT +DS     S D  S L  ++  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N     +N                D +R V E ++ + ++   L  V +I +     +           ++ + + F++L  M  RL+     +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+    + +  F D    + + F++ L    G     VDL F  S
Sbjct:   71 KVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAF------------------RRSPRNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLL-SYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDS-----SGDEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRP---LKPRTNNRTSPRDNTLLQQKLLQEAYVTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYS 556          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 176.407 bits (446), Expect = 5.015e-45
Identity = 143/532 (26.88%), Postives = 236/532 (44.36%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +V +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A++N N +LV+ L+   + ++ RA GT F                   R   +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++       W++  LT  +Y LT +DS     S D  S L  ++  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N     +N                D +R V E ++ + ++   L  V +I +     +           ++ + + F++L  M  RL+     +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+    + +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 KVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAF------------------RRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLL-SYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDS-----SGDEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRP---LKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYS 596          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 176.407 bits (446), Expect = 5.440e-45
Identity = 143/532 (26.88%), Postives = 236/532 (44.36%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +V +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A++N N +LV+ L+   + ++ RA GT F                   R   +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++       W++  LT  +Y LT +DS     S D  S L  ++  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N     +N                D +R V E ++ + ++   L  V +I +     +           ++ + + F++L  M  RL+     +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+    + +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 KVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAF------------------RRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLL-SYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDS-----SGDEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRP---LKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYS 596          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPV5 (transient receptor potential cation channel subfamily V member 5 [Source:HGNC Symbol;Acc:HGNC:3145])

HSP 1 Score: 167.933 bits (424), Expect = 1.946e-42
Identity = 142/513 (27.68%), Postives = 231/513 (45.03%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPN---------------NGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL 2105
            +V +RG LGE  LHI  + +  E    A +L+ A P L  +      + GQT LH+A++N N +LV+ L+   + ++ RA GT F           +P          +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   + S      L  VV +   +   +LE+  V  L+  KW  Y +  F +    Y+  +I        RP   L+    N  H+ +                 DI+R V E +S V +V   L  + +I +     Y          + I  G   +I+     LV  +V +V + T+T   +  +  A +     L W  ++++    ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + T F++ L
Sbjct:   71 DVRQRGALGETALHIAALYDNLE---AALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRRASVSARATGTAFRH---------SPR---------NLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS-YDGHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDSWGEELSF-----LELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRP---LKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRY--------FGKTILGGPFHVIIITYASLV--LVTMVMRLTNTNGEVVPMSFALV-----LGWCSVMYFTRGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFL 538          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPV5 (transient receptor potential cation channel subfamily V member 5 [Source:HGNC Symbol;Acc:HGNC:3145])

HSP 1 Score: 167.933 bits (424), Expect = 1.946e-42
Identity = 142/513 (27.68%), Postives = 231/513 (45.03%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPN---------------NGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL 2105
            +V +RG LGE  LHI  + +  E    A +L+ A P L  +      + GQT LH+A++N N +LV+ L+   + ++ RA GT F           +P          +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   + S      L  VV +   +   +LE+  V  L+  KW  Y +  F +    Y+  +I        RP   L+    N  H+ +                 DI+R V E +S V +V   L  + +I +     Y          + I  G   +I+     LV  +V +V + T+T   +  +  A +     L W  ++++    ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + T F++ L
Sbjct:   71 DVRQRGALGETALHIAALYDNLE---AALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRRASVSARATGTAFRH---------SPR---------NLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS-YDGHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDSWGEELSF-----LELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRP---LKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRY--------FGKTILGGPFHVIIITYASLV--LVTMVMRLTNTNGEVVPMSFALV-----LGWCSVMYFTRGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFL 538          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: osm-9 (Olfactory channel [Source:UniProtKB/TrEMBL;Acc:G5EBV8])

HSP 1 Score: 353.214 bits (905), Expect = 1.342e-106
Identity = 213/635 (33.54%), Postives = 346/635 (54.49%), Query Frame = 3
Query:  282 FD-DSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGT-LVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLI--IARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFL-QDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLS---CVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAK----------------GITSFDDVISTIVTIFQMTLGEF 2114
            FD D     L   + KN +YK++ ++  G+LI+     G   V +   ++L + +++ G+   LV   + +K      V L L                  +E V   QSR+  +  +  W++ +RG+ GENL+H  L+LN ++ +   IAR+LL  +P +  D ++G + FGQ+ LH+AI++ +   V LL+   + +  RA G FFL +DF +   I +    Q Y       +YGEYP++FAA  G+++ YD LI+ GA+PN+QD+FGNT+LH+ VIN  + MY  A+RH+   AD  V+N+ G TPL LA  LG++++F E++ +  V  W FS++TC  YPL  LD+I  DGS +++S LM V++  T +HL M+   V+ RLL +KW+ +A+RK   RL   I QLI   + +Y+RP+   + Y E+    P   D +R   E L+   C+  V      +  I  Q  + Y++ LK +    +  + +LFL+L +  RL               +   ++EEA  + A+P  W+ LLF+A + KLTGP V MI  ++ GD++RF+II +I ++ F QVFY + KD+ AK                 I +++    T +T+F+ ++G +
Sbjct:   21 FDPDEKWSNLYREREKNHLYKWVAVRKGGELINIYERDGEEGVLKFAEEKLLTILYDEGQNPKLVTYSDYIKWKKGVNVQLGLS-----------------EESVDMQQSRF--KEHYALWKLNKRGVEGENLIH--LLLNREQQVCYEIARILLKRFPGMANDIYLGDEQFGQSALHLAIVHDDYETVSLLLNSKADVNARACGNFFLPEDFKLTNKITD---YQGY------AYYGEYPLAFAACFGNKDIYDLLIQFGANPNLQDSFGNTILHMCVINYSSSMYSYAVRHWAKPADPHVVNHAGFTPLTLATKLGRKQIFEEMLEIMKVEFWRFSDMTCSAYPLNTLDTIQPDGSTNYDSALMTVINGSTPEHLDMIGSEVIQRLLADKWKAFAQRKLIERLVLLIVQLITLSIVVYIRPTELPRLYMED----PQWDDYIRTACELLTILNCIFFV--GYQQLGEIRTQGMRGYLRNLKTAPAKAVFCIANLFLLLCIPFRL---------------MKKHEIEEALFVFALPGSWIFLLFFARSAKLTGPFVQMIYSMIAGDMIRFAIISAIFLVSFSQVFYFVGKDMDAKQKLEDTNPHACRISGYTIYTYNTFPETFITLFRASMGGY 604          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: ocr-1 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:G5EDR9])

HSP 1 Score: 238.81 bits (608), Expect = 4.923e-66
Identity = 190/685 (27.74%), Postives = 333/685 (48.61%), Query Frame = 3
Query:  312 MAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVD-----ELASFMHNNGKGTLVPTINILKC-SITKYVDLSLRSRNSGK--------------ETQLPPDSRAIKEMVQTIQSRYEGQSEF--VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKL----------DTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSIN-TDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLR--LG--FYITQLIVAGMALYLRPSGDLQPY-------AENHIHAPNNGDIVRYVAEGLSC--------------------VMSVTSALYHV----ANIVKQTFKSYVKGLKYSALSEIIFLG-HLFLILAMACRLV-GFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF----------KDIKAKGITSFDDV----ISTIVTIFQMTLGEF 2114
            M++ K ++YK +++ G G LI  L  K       V++D     E+  +M+N GKG L+P   ++K  +  +   L   SR  GK              + ++  D +   +++       + +S++  + W V  RG +GENLL ICL+  +  H +IAR L+  +P L  D  +  +Y+G +PLH+AI+N +     LL+++G+ L +R  G FF        D    SR      +            + ++GEYP+SFA  +G  + +  L+ K A+ + QDT GNT LH+ VI+++ +M    L   +   +  + N   LT L LAA L ++ +FN+I+ L    +W++ +  C  YPLT +D+I+ T G ++  S L  VV   + QHL ++ +G++ ++L EKW+ Y  R   LR  LG  F+    + A M   LRPS     +        +    + N+ + +++ A    C                    +M++   L+ +     +I +  F+ +   LK +  ++++F G  LF+I+++ CRL   F  F ++           ++    II++ L+    L+Y  AI   GP V M+  ++  D+VRF++IYSI ++ F Q FY++F          K I   G + F+++    +  ++  F MT+GEF
Sbjct:   23 MSENK-VIYKMVDMHGGGILIK-LARKCKELNSFVLLDAYLDQEVRKYMYNGGKGKLMPVAELVKARNKERNAKLGAFSRKKGKGKSGPNILDEFDQGQAEMAGDLKKALKLLDGGGKGGKSESKYREMVWSVDERGSMGENLLAICLLQGSALHNLIARRLINFFPKLINDICVSEEYYGLSPLHLAIVNQDAQFTSLLLRLGADLNQRCYGAFFCA------DDQKASRTDSLEHEFVELTKNTNYTGSMYFGEYPLSFAICMGQHDLFRMLLAKKANLSAQDTNGNTALHLCVIHDKMDMLDAVL---EAGGNIRLANKQNLTALTLAARLAKKTMFNKILQLECEKVWTYGSSQCVAYPLTKIDTIDETTGEMNDTSALSLVVYGESIQHLELM-DGLIEQILDEKWKAYG-RALWLRSLLGFIFFYCCFVCAYM---LRPSSATTEHLTRGRINDDGETESTNSTNYLQWHAIDTQCHLMYYSAWPWYHGWFRLGCEIMTIIVMLFQILLDFGDIRRIGFQKWFNFLK-AFPAKLMFKGAFLFIIISIPCRLACSFHEFFLT-----------IDNTMAIISILLVTQHFLYYMRAIPFVGPFVLMVYTIIATDLVRFAMIYSIFLVGFSQSFYLIFTSCERDSTAIKKIDPMG-SEFNNIMENPVDALLRTFIMTIGEF 678          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: ocr-4 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:Q9N3Y9])

HSP 1 Score: 230.335 bits (586), Expect = 1.102e-63
Identity = 165/626 (26.36%), Postives = 280/626 (44.73%), Query Frame = 3
Query:  327 NLMYKYLNLQGNGKL----IDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHL-IIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDT----TFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSIN-TDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSG-DLQPYAENHIHAPNNGDIVRYVAEGLS----------CVMSVT----SALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF-----KDIKAKGITSFDDVISTIVTIFQMTLGEF 2114
            N + K  ++ G G L    +D +R      + + I++++   ++NNG+G ++P  +++                +G    +P  S                +  F+CW++  RG +GE LLH C +     H+ ++A  L+  +P +  D+++  +Y+G+T LHM I++ N   V+ L++ G+ +  R  G FF  D        +P  +     K        ++GEYP+SFAA +   E    L+  GA  N  DT GNT+LHI  I+   EM++MAL      AD  + N   LTPL LAA L ++++   I+     V W++       YPL  +DSI  T GS++  S L   V     +HL++L   ++ +L+  KW  Y ++    +L  +    I       LRPS  + Q +  N +    +    R+    +S          CV   T     AL H+ N+    +  YV GL       I     + +++    R+                 L + E+   I+ V L  +  LF+    K  GP V M+ K+++ D++RF +IY + ++ F Q FYV+F      D   +  +   +V  + V +F M+L EF
Sbjct:   21 NAINKLADMSGRGFLADLAMDAVRTGNHEELDKQILEKVQPMLYNNGQGEMIPLSDLIA---------QRHKERTGNTFAVPVPS---------------TECRFICWKLNSRGAVGETLLHTCFLAGLPNHMKLLAERLIAIFPKIINDFYLSDEYYGETVLHMGIVSENAEFVRYLLKSGADVHARCSGNFFTCDDQKGSRTDHPEVEHAIISKHTKYPGHIYWGEYPLSFAACLSQPECIRMLVAHGADVNAADTNGNTILHICTIHENYEMFKMAL---SLGADLHIQNRQNLTPLTLAAFLAKKEMMQRIVEEERTVNWTYGRTQSAAYPLEHVDSIEPTSGSINQKSVLTIAVYGEKVEHLSLLPH-LLEQLVHHKWIAYGRKTLFAQLSMFCIYFICVTSCFLLRPSPFERQQHIANDLICFYDFKTRRFNESAVSTIIYHLLHLICVTGATLYLVQALLHIKNV---GYHLYVLGLSGFPAKAIFLFSCILMVITFFLRI---------------FCLDEAEDIVWIVIVLLTSLKFLFFCRGFKSVGPFVLMLYKIIIRDLMRFFLIYLVIVVGFSQAFYVIFLGYKRSDSGNREPSIMSNVAESYVRMFIMSLTEF 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: ocr-3 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:Q22374])

HSP 1 Score: 230.335 bits (586), Expect = 2.700e-63
Identity = 184/684 (26.90%), Postives = 324/684 (47.37%), Query Frame = 3
Query:  333 MYKYLNLQGNGKL---IDGLRNKGVSHVHQVIVD-ELASFMHNNGKGTLVPT---INILKCSITKYVDLSLRSRNSGKE-----TQLPPDSRAIKEMVQT--------IQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGI----------WLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSIN-TDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENH-----IHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEII-FLGHLFLILAMACR---------------------------LVGFIVFIVSKSTSTRISLFKLEEAFIIIA-------VPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDI--------KAKGITSFDDVI-----------STIVTIFQMTLGEF 2114
            +Y  ++ QG G L   I   R+ G   + +  +D  + S+++N GKG LVP    + I        +    R +  GK        +  D+ +  + ++         I+ R   +   + W++ +RG LGENLLH+C++LNT +   + + +   +P +  D F+  +Y+G +PLH AI+N +  +V  L + G+ + +R  G+FF  D             W+D+   ++  Y  Q     ++GEYP+SFAA     + +  L    A PN+ DT GNTVLH+ VI++  EM+ +A+   +  A+  V N   LTPLALAA L ++ +++ I+  +  + W +  + C+ YPL  +D+IN +DGS++ NS +  VV      HL    +G++  +L+ KW  + K++  + L  YI  L V  +A   R +  L P  E+      +   +  +    ++EGLS  +    A+  +A   ++   ++     YS  S+ I  +  +  +LA+  R                           L  F   +V  +   R+  + L+++F++I        V +  +  LFY  ++K  GP V M+ K++V D++RF +IYS  ++ F Q F+V+FK          KA   T  D+ I             ++ +F M++GEF
Sbjct:   12 LYSLVDEQGGGILSPWIKYARSSGDYSILEEYLDTAVKSYLYNGGKGKLVPISQLVTIRNKQRNALLGALRRKKGRGKSGPNILEHIDQDALSSGDFLKALKVLDGGMIKGRRSFKYRELVWDMDQRGRLGENLLHVCMLLNTADMNELVKQMTYRFPKIVNDIFLSEEYYGLSPLHQAIVNEDLEMVYFLCRKGADVHQRCYGSFFCADDQKASRTDSLEHEWVDLVQSTK--YTGQ----MYWGEYPLSFAACTNQVDCFRLLRAMKADPNMPDTNGNTVLHLTVIHDLPEMFMLAV---ELGANLHVRNNLKLTPLALAARLAKKHIYDLILECDMDISWRYGPVVCKAYPLNDVDTINESDGSLNPNSVIANVVYGDKVDHLEFF-DGLIEEVLESKWETFGKKQLFMSLAGYIYFLAVFYLAFMTRDAHIL-PSDEDENEKFGMIELDFSNFTNILSEGLS--LREHLAIARMAE--REALPAHCHLWDYSGPSQQIRMISEILCLLAVVIRTFKDCIDAHRTGVSRWWNSIKAFPEKVLHKFCQILVLCTVPLRVGCY-LDDSFLVIENLLVVCIVIMSTLHFLFYCRSLKFVGPFVLMVYKIIVRDMLRFLLIYSFFLMGFAQAFFVIFKSCERAEIAYQKAHNYTEDDEYIEKFENIMEDGWEAVMRMFIMSVGEF 679          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: ocr-2 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:O61220])

HSP 1 Score: 194.512 bits (493), Expect = 5.972e-51
Identity = 175/642 (27.26%), Postives = 293/642 (45.64%), Query Frame = 3
Query:  306 LGMAQRKNLM--YKYLNLQGNGKLIDGLR----NKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVD-LSLRSRNSGKETQLP---PDSRAIKEMVQTIQS------------RYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTT-----FYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSIN-TDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSG-DLQPYAENHIHAPNNGDIVRY----VAEGLSCVMSVTS-ALYHVANIVKQT-FKSYVKGLKYSALSEIIFLGHLFLILAMACR-------------------LVGFIVFIVSKST--------STRIS------LFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF 2027
            +GM + +  M  Y+ +++ G G+L+  LR    +   S +   +  ++  F++N GKG LV    ++K    +  + L   SR  GK    P    D     E V  ++             R E +   + W++  RG +GE ++  CL+  +  H  +   +L  YP L  D  I   ++G +PLH AIIN +  LV   +++G+ +  R  G FF  D        +    +Y    L T      + GEYP+SFAA +   ES+  L+   A+PN QDT GN+VLH+ VI+    M+++AL   +C A    +N   L+PL LAA L ++++F+EI+ L    +W++ + +   YPL  +D+IN T G ++  S L  VV  +T +HL +L+  ++  LL+ KW  +AKR   +    +    I    A  LRP G   +   E  I+  +     RY      + +  V++ TS  L   +  + Q   ++Y       A S I  +  LF+++ +  +                   L  F   I  K T         TR++      L  ++   I + +    +  L+Y   I+  GP V M+  ++  DI RF +IY I ++ F Q F ++F
Sbjct:   15 VGMGRLREDMKIYQLVDMHGGGELLPWLRYAIISSDTSFIDAYLETKVKDFLYNGGKGKLVTVTELVKLRNKERNERLGAFSRKKGKGKSGPNVLDDFNQEGENVGDLKKALKLLDGGGKGGRNESKYREISWKLEERGSMGETIIGCCLLHASDIHNALVLKILDYYPKLLNDIHISEDFYGLSPLHQAIINTDCKLVYKFLKLGADVNSRCYGAFFCAD-DQKASRTDSLEHEYVELSLKTNYTGNMYLGEYPLSFAACLNQPESFRLLLAFKANPNAQDTNGNSVLHMCVIHENMAMFKLAL---ECGASLRTVNKQSLSPLTLAAKLAKKEMFDEILELEGDSVWAYGDASSTAYPLAKIDTINETTGELNEASALSLVVYGQTVEHLELLDG-LLDTLLEAKWEAFAKRNMIVSFTAFTLYYICFVTAFTLRPIGFSTEMLTEGWINRYSEPFPGRYGKNSTLQQVKPVINATSRGLVEWSEPLSQCHLRNYWDPDIPFANSYIRLVFELFVVIGICVQVFLDFRDIKRIGRKKWWNVLTAFPAKITFKLTYFLVLAMIPTRLACDLSPVLLVVDNVLITVTMIFTTVHYLYYCRVIRFVGPFVLMVYTIIATDIFRFMLIYGIFLMGFSQSFSLIF 651          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: iav (gene:FBgn0086693 transcript:FBtr0070969)

HSP 1 Score: 360.533 bits (924), Expect = 1.115e-107
Identity = 210/642 (32.71%), Postives = 342/642 (53.27%), Query Frame = 3
Query:  255 KADFNENGDFDDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHA-----------PNNGD----------IVRYVAEGLSCVMSVTSALYHVANIVK-QTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEF 2114
            KA   + G   D+ + Q      K L+YK  + +  G LID + + G+  V Q+I ++   FM+N+GKG ++     L+    KY D +        E  +P     I+  +       + +    CW++  RG LGE+LLH+ ++ ++K H  +AR+LL  +PNL  D   G +Y G + LH++I   N  LV  L++ G+ + +RA+G+FFL          NP++   Y       + GEYP+++AA   ++  Y+ L++ G+ P+ QD+FGN +LH+VV+ ++ +M+  ALRH K  A + ++N  GLTPL LA  LG+ +VF E++ L+    W +SN+TC  YPL  LD++  DG  +WNS L  +++    +HL ML+ G++ RLL+EKW+ +A+ +F  RL    T L+   +++YLRP+ D +   E+   +            + GD          + RY AE  + V  ++  ++   + +K Q   +++K L ++    I    +L ++  +  RL+G         T T       EEA +I AVP  W  L+F+A AI+LTGP VTMI  ++ GD+  F IIY I +  F Q FY L+K       T F+   ST + +FQ TLG++
Sbjct:   12 KAPEMKPGAILDAVISQSSATACKCLLYKLADYKRGGDLIDAINSGGLIAVEQLIREQFGVFMYNDGKGQVINRAEFLRW---KYRDHT--------EVTIP-----IEASLSIHDPLGKWEDHKACWQMQYRGALGESLLHVLIICDSKVHTKLARVLLRVFPNLALDVMEGEEYLGASALHLSIAYSNNELVADLIEAGADIHQRAIGSFFLPRDQ---QRANPAKSTDYE---GLAYMGEYPLAWAACCANESVYNLLVDCGSDPDAQDSFGNMILHMVVVCDKLDMFGYALRHPKTPAKNGIVNQTGLTPLTLACKLGRAEVFREMLELSAREFWRYSNITCSGYPLNALDTLLPDGRTNWNSALFIILNGTKPEHLDMLDGGIIQRLLEEKWKTFAQNQFLKRLLILSTHLLCLSVSVYLRPAHDGEAEDEDSEGSDASAAALLDIQSDEGDSGGGDYNAQTVARYCAEFATLVGVLSYVIFQQGDEIKNQGLSAFLKQLSHAPAKAIFLFSNLLILACIPFRLIG--------DTDT-------EEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMIYSMITGDMFTFGIIYCIVLCGFSQAFYFLYKGHPQVQSTMFNTYTSTWMALFQTTLGDY 616          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nan (gene:FBgn0036414 transcript:FBtr0321258)

HSP 1 Score: 244.202 bits (622), Expect = 6.880e-68
Identity = 178/676 (26.33%), Postives = 328/676 (48.52%), Query Frame = 3
Query:  333 MYKYLNLQGNGKLIDGLR----NKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKE----------MVQTIQSRYEGQS---EFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDT----TFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTD-GSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPN-NGDIVR------YVAEGLSCVMSVTSALYHV----------ANIVKQTFKSYVKG---------LKYSALSEII-FLGH-LFLILAM-ACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMG--------------------LLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF-----------KDIKAKGITSFDDVISTIVTIFQMTLGEF 2114
            +YK++NL+G G L+D ++     K  + +   I  ++  F++N G G   P        I+K V   LR+R+  +  QLP + RA++             +  ++ Y        FVCW++  RG +GE +LH+CL+  +  H  +A+ LL  YP L  D ++  +Y+G++ LH+AI+N + ++VK L+   + +  R  G F   +   +    +P  +      +       ++GEYP+SFAA +  +E +  ++ +GA P+ QDT GNTVLH++VI  + EM+ +    Y+   +  + N   LTPL LAA LG+ ++F  ++++   + W   ++TC  YPL  +D+IN + G+++ +S L  VV     +HL +L +GVV  LL+ KW  + K +F  +   +    +++  +  LRP  D +   E+  ++     D+ R      Y        M+     + +            ++   ++SY +           K   ++E++ F+G  L+L++A+   R +G  +FI +  T+    +F    A +++ +P L +                      LF+    K  GP V MI ++++GD++RF  IY + ++ F Q FY++F           +D ++  + S    + +IV +F M+L  F
Sbjct:   23 LYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVEPFLYNKGAGRYFP--------ISKLV--LLRNRDRPRTRQLP-EIRALENPDDDFNIHDYCPEVSEAEYISNPTAYRFVCWDLNMRGAVGETILHLCLLNASSLHADLAKRLLKFYPKLILDIYMSDEYYGESVLHIAIVNEDPAMVKYLLDANADVQERCCGAFMSAEDTKFSRTDSPDHEYVALCPMTNYDGYVYWGEYPLSFAACLSQEECFRLVLARGADPDFQDTNGNTVLHMLVIYEKIEMFDVG---YEVGTNIHIKNIQNLTPLTLAAKLGRVEMFFHVMSIEREIYWQLGSITCAAYPLLMIDTINEETGNINKDSVLNFVVFGDKLEHLELL-DGVVIDLLKTKWDTFCKSRFYKQFYMFALYFLISLFSFILRPGPDAKDEDEDGANSTTAKSDLYRQNGSDSYHLHSKRATMTTEYKTFWLNFTEYYDPSEVEVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVALREARFLGLKMFIENLMTAPSRVMFLFSCA-LMMTIPWLRVSCLTEIDDHVTVVIMLTTAPYFLFFCRGFKTVGPFVVMIYRMVMGDLLRFVSIYLVFVMGFSQAFYIIFLTFDNPSSPEDQDAESNPMPS---PMESIVAMFLMSLTNF 679          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nan (gene:FBgn0036414 transcript:FBtr0089524)

HSP 1 Score: 243.817 bits (621), Expect = 9.154e-68
Identity = 178/676 (26.33%), Postives = 328/676 (48.52%), Query Frame = 3
Query:  333 MYKYLNLQGNGKLIDGLR----NKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKE----------MVQTIQSRYEGQS---EFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDT----TFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTD-GSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPN-NGDIVR------YVAEGLSCVMSVTSALYHV----------ANIVKQTFKSYVKG---------LKYSALSEII-FLGH-LFLILAM-ACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMG--------------------LLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF-----------KDIKAKGITSFDDVISTIVTIFQMTLGEF 2114
            +YK++NL+G G L+D ++     K  + +   I  ++  F++N G G   P        I+K V   LR+R+  +  QLP + RA++             +  ++ Y        FVCW++  RG +GE +LH+CL+  +  H  +A+ LL  YP L  D ++  +Y+G++ LH+AI+N + ++VK L+   + +  R  G F   +   +    +P  +      +       ++GEYP+SFAA +  +E +  ++ +GA P+ QDT GNTVLH++VI  + EM+ +    Y+   +  + N   LTPL LAA LG+ ++F  ++++   + W   ++TC  YPL  +D+IN + G+++ +S L  VV     +HL +L +GVV  LL+ KW  + K +F  +   +    +++  +  LRP  D +   E+  ++     D+ R      Y        M+     + +            ++   ++SY +           K   ++E++ F+G  L+L++A+   R +G  +FI +  T+    +F    A +++ +P L +                      LF+    K  GP V MI ++++GD++RF  IY + ++ F Q FY++F           +D ++  + S    + +IV +F M+L  F
Sbjct:   23 LYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVEPFLYNKGAGRYFP--------ISKLV--LLRNRDRPRTRQLP-EIRALENPDDDFNIHDYCPEVSEAEYISNPTAYRFVCWDLNMRGAVGETILHLCLLNASSLHADLAKRLLKFYPKLILDIYMSDEYYGESVLHIAIVNEDPAMVKYLLDANADVQERCCGAFMSAEDTKFSRTDSPDHEYVALCPMTNYDGYVYWGEYPLSFAACLSQEECFRLVLARGADPDFQDTNGNTVLHMLVIYEKIEMFDVG---YEVGTNIHIKNIQNLTPLTLAAKLGRVEMFFHVMSIEREIYWQLGSITCAAYPLLMIDTINEETGNINKDSVLNFVVFGDKLEHLELL-DGVVIDLLKTKWDTFCKSRFYKQFYMFALYFLISLFSFILRPGPDAKDEDEDGANSTTAKSDLYRQNGSDSYHLHSKRATMTTEYKTFWLNFTEYYDPSEVEVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVALREARFLGLKMFIENLMTAPSRVMFLFSCA-LMMTIPWLRVSCLTEIDDHVTVVIMLTTAPYFLFFCRGFKTVGPFVVMIYRMVMGDLLRFVSIYLVFVMGFSQAFYIIFLTFDNPSSPEDQDAESNPMPS---PMESIVAMFLMSLTNF 679          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 54.6842 bits (130), Expect = 3.820e-7
Identity = 45/149 (30.20%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIGSPL---TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLD-TTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLG 1220
            G TPLH A  +G++ +V +L++ G+P+   T+  L    +   G  +D        Y+R  +D  T      +  AA  G       L+++ A  N +   G T LHI    NR ++  + LRH    A  S     GLTPL +AA +G
Sbjct:  271 GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL--YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRH---GASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 54.299 bits (129), Expect = 6.317e-7
Identity = 45/150 (30.00%), Postives = 70/150 (46.67%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIGSPL---TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEY--PVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLG 1220
            G TPLH A  +G++ +V +L++ G+P+   T+  L    +   G  +D        Y+R  +D     +Y   +  AA  G       L+++ A  N +   G T LHI    NR ++  + LRH    A  S     GLTPL +AA +G
Sbjct:  271 GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAAR--ILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRH---GASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 139.813 bits (351), Expect = 1.302e-33
Identity = 134/527 (25.43%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRTEMYRM--ALRHYKCSADSS-----VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLK---------------------YSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
            ++  RG LGE  LH+ +M +  E    A  L+   P L  +      Y G T LH+A+IN N +L+  +++ G+ +T  R  G +F              RK+  R+ L   +YGE+ ++FAA VG+++    LI+ GA+   QD+ GNT+LH++V+  N+T   ++   L       DS+     V NY GLTP  LAA  G   VF  ++N   VV WS   ++  +Y LT +DS      VD +S L  +  +  ++   +LE   V +L+  KW LY K  F   +  Y+  + +  +    RP   L+   EN+  A N+  I                    +    K++++SY   L+                       A+    F G   L       L+ +   +V      R++  + E   +  ++ L W  L+++A   ++ GP V +I K + GDI +F  +  I ++      ++ +   +   +  +     T+ + F++++G+    VD
Sbjct:   68 DIFERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYF--------------RKR--REGL--FYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLDMVPNYKGLTPFKLAARDGNVVVFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYFRSLMVIYLVYISIFTVCCINRP---LKGIPENYTKAGNDHTI-------------------KIKKTFKESYQSYTDQLRLIGEIISLIGAIIILLIEIPGILAVGVKRFFGQTALGGLFHVTLISY-ALLVLLLCGLRVTGIQGELIPMAFSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVD 545          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 139.813 bits (351), Expect = 1.500e-33
Identity = 134/527 (25.43%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRTEMYRM--ALRHYKCSADSS-----VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLK---------------------YSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
            ++  RG LGE  LH+ +M +  E    A  L+   P L  +      Y G T LH+A+IN N +L+  +++ G+ +T  R  G +F              RK+  R+ L   +YGE+ ++FAA VG+++    LI+ GA+   QD+ GNT+LH++V+  N+T   ++   L       DS+     V NY GLTP  LAA  G   VF  ++N   VV WS   ++  +Y LT +DS      VD +S L  +  +  ++   +LE   V +L+  KW LY K  F   +  Y+  + +  +    RP   L+   EN+  A N+  I                    +    K++++SY   L+                       A+    F G   L       L+ +   +V      R++  + E   +  ++ L W  L+++A   ++ GP V +I K + GDI +F  +  I ++      ++ +   +   +  +     T+ + F++++G+    VD
Sbjct:   68 DIFERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYF--------------RKR--REGL--FYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLDMVPNYKGLTPFKLAARDGNVVVFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYFRSLMVIYLVYISIFTVCCINRP---LKGIPENYTKAGNDHTI-------------------KIKKTFKESYQSYTDQLRLIAEIISLIGAIIILLIEIPGILAVGVKRFFGQTALGGLFHVTLISY-ALLVLLLCGLRVTGIQGELIPMAFSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVD 545          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 139.813 bits (351), Expect = 1.500e-33
Identity = 134/527 (25.43%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRTEMYRM--ALRHYKCSADSS-----VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLK---------------------YSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
            ++  RG LGE  LH+ +M +  E    A  L+   P L  +      Y G T LH+A+IN N +L+  +++ G+ +T  R  G +F              RK+  R+ L   +YGE+ ++FAA VG+++    LI+ GA+   QD+ GNT+LH++V+  N+T   ++   L       DS+     V NY GLTP  LAA  G   VF  ++N   VV WS   ++  +Y LT +DS      VD +S L  +  +  ++   +LE   V +L+  KW LY K  F   +  Y+  + +  +    RP   L+   EN+  A N+  I                    +    K++++SY   L+                       A+    F G   L       L+ +   +V      R++  + E   +  ++ L W  L+++A   ++ GP V +I K + GDI +F  +  I ++      ++ +   +   +  +     T+ + F++++G+    VD
Sbjct:   68 DIFERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYF--------------RKR--REGL--FYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLDMVPNYKGLTPFKLAARDGNVVVFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYFRSLMVIYLVYISIFTVCCINRP---LKGIPENYTKAGNDHTI-------------------KIKKTFKESYQSYTDQLRLIAEIISLIGAIIILLIEIPGILAVGVKRFFGQTALGGLFHVTLISY-ALLVLLLCGLRVTGIQGELIPMAFSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVD 545          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 137.117 bits (344), Expect = 1.077e-32
Identity = 134/527 (25.43%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRTEMYRM--ALRHYKCSADSS-----VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLK---------------------YSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
            ++  RG LGE  LH+ +M +  E    A  L+   P L  +      Y G T LH+A+IN N +L+  +++ G+ +T  R  G +F              RK+  R+ L   +YGE+ ++FAA VG+++    LI+ GA+   QD+ GNT+LH++V+  N+T   ++   L       DS+     V NY GLTP  LAA  G   VF  ++N   VV WS   ++  +Y LT +DS      VD +S L  +  +  ++   +LE   V +L+  KW LY K  F   +  Y+  + +  +    RP   L+   EN+  A N+  I                    +    K++++SY   L+                       A+    F G   L       L+ +   +V      R++  + E   +  ++ L W  L+++A   ++ GP V +I K + GDI +F  +  I ++      ++ +   +   +  +     T+ + F++++G+    VD
Sbjct:   68 DIFERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYF--------------RKR--REGL--FYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLDMVPNYKGLTPFKLAARDGN--VFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYFRSLMVIYLVYISIFTVCCINRP---LKGIPENYTKAGNDHTI-------------------KIKKTFKESYQSYTDQLRLIAEIISLIGAIIILLIEIPGILAVGVKRFFGQTALGGLFHVTLISY-ALLVLLLCGLRVTGIQGELIPMAFSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVD 543          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpv4 (transient receptor potential cation channel, subfamily V, member 4 [Source:ZFIN;Acc:ZDB-GENE-030912-7])

HSP 1 Score: 123.635 bits (309), Expect = 2.422e-28
Identity = 120/485 (24.74%), Postives = 209/485 (43.09%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKG---ASPNVQDTFGNTVLHIVV--INNRTEMYRMALRHY-----KCS---AD---SSVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKY----SALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF-----KDIKAKGITSFDDVIST------IVTIFQMTLG 2108
            Y GQ  LH+AI    K  V+LLV+ G+ +  +A G FF            P  +  Y       ++GE P+S AA     +    L E G   A    QD+ GNTVLH +V   +N  +  R   + +     KC+    D    +++N DG++PL +AA LG+  VF  II                  W++  +   +Y L+ LD+   + SV      + V +++ E    ML    +  LL+ KW+ +A   F + +  Y+  +I+  +  Y RPS    PYA +        D VR   E    +++V S L+     +K  F     G+       +   + F+  + ++++ A  L G   ++                + ++ A+ L WM  L++   +KLTG    MI K+L+ D+ RF ++Y + ++ +      L      KD   +   ++ +   T      ++ +F++T+G
Sbjct:  243 YRGQMALHIAIERRCKQYVELLVEKGADVHAQARGRFF-----------QPRDEGGY------FYFGELPLSLAACTNQPDMVHYLTENGHKKADLRRQDSRGNTVLHALVHIADNTRDNTRFVTKMFDLLLIKCAKLYPDCNLENILNNDGMSPLMMAAKLGKIGVFQHIIRREIKDEEARHLSRKFKDWAYGPVYSNLYDLSSLDTCGEEVSV----LEILVYNSKIENRHEMLAVEPINELLRAKWQKFAAVTFYISVFSYLVTMIIFTLVAYYRPSVGKPPYAYDTTE-----DKVRLAGE----IITVGSGLFFFVTNIKDLFLKKCPGVNSIFVDGSFQLLYFIYSVLVLVSAALYLSGIEAYV----------------SVMVFALTLGWMNTLYFTRGLKLTGTYSIMIQKILIKDLFRFLLVYVLFMIGYASALVSLLTICPDKDTCKENCPTYPECRDTNTFSEFLLDLFKLTIG 681          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rbm19 (RNA binding motif protein 19 [Source:Xenbase;Acc:XB-GENE-922190])

HSP 1 Score: 156.762 bits (395), Expect = 1.672e-39
Identity = 144/515 (27.96%), Postives = 230/515 (44.66%), Query Frame = 3
Query:  660 LGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRK-QYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHY----------KCSADSSVMNYDGLTPLALAASLGQ-QKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLL-------------------WMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
            LGEN+LHI  + N  E L+    LL A+P L         Y G+T LH+AI+N N  +V+ L+   + +   RA G FF            P RK Q+Y        YGEY  SFAA VG+QE    L+E  A    QD+ GNTV HI+V++    M   A + Y          + S   ++ N DG+TP  LAA  G  Q +F   I      + SF  L   +Y LTG+DS +     D  S +  +  +       +LE   +  LL  KW  +  + F L   FYI   ++  +    RP      Y +       N     YV       +++T     +A I+++ +++    L+ S    I+ +G +  ++ +  ++     F+ S+  +  I +F+L  A  IIAV +L                   W  ++++A   +L GP   MI K+++GD+++F I+    ++ F   F V F+ +    + SF+       T+FQ+ +G
Sbjct:   18 LGENVLHIAALYNNNEILV---ELLDAFPFLINKPIECDAYKGETALHIAIVNQNAEMVRELIARKADMENARATGNFF-----------APRRKGQHY--------YGEYVTSFAAYVGNQEILQTLVENEAPLETQDSQGNTVFHILVLHQNKSM---ACKMYDFLAAIIPKKQLSYLETITNNDGMTPFKLAAQQGDVQVMFEYFIKKRRHTILSFGPLGSTLYDLTGIDSWD-----DRLSVIDIICTSNNNAARNLLEITPLKELLHYKWTAFGYKYFLLCTIFYIMYTVILTLCCLYRPIMHTFTYQDGK----GNTRKPLYV----RIFITIT-----IAEILQEAYQTRNDYLRLSG-EIIVVVGGILCLVEIPKKMCK--TFLSSREFNREIFIFRLLYACFIIAVVILRFLSSDGETIMMSLALISAWCNVIYFARGFRLLGPLCIMIQKMVLGDLLKFCILLIAVLIGFAAAFNVHFQAMNTTAVPSFNGFPDITFTLFQLMMG 486          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rbm19 (RNA binding motif protein 19 [Source:Xenbase;Acc:XB-GENE-922190])

HSP 1 Score: 154.836 bits (390), Expect = 9.889e-39
Identity = 144/513 (28.07%), Postives = 227/513 (44.25%), Query Frame = 3
Query:  660 LGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRK-QYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHY----------KCSADSSVMNYDGLTPLALAASLGQ-QKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRP----------SGDL-----QPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIV--FIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
            LGEN+LHI  + N  E L+    LL A+P L         Y G+T LH+AI+N N  +V+ L+   + +   RA G FF            P RK Q+Y        YGEY  SFAA VG+QE    L+E  A    QD+ GNTV HI+V++    M   A + Y          + S   ++ N DG+TP  LAA  G  Q +F   I      + SF  L   +Y LTG+DS +     D  S +  +  +       +LE   +  LL  KW  +  + F L   FYI   ++  +    RP           G+      + Y   + +   +G+I+  V  G+ C++S    +    N + +TF      L     +  IF+  L      AC ++  ++  F+ S   +  +SL          A+   W  ++++A   +L GP   MI K+++GD+++F I+    ++ F   F V F+ +    + SF+       T+FQ+ +G
Sbjct:   10 LGENVLHIAALYNNNEILV---ELLDAFPFLINKPIECDAYKGETALHIAIVNQNAEMVRELIARKADMENARATGNFF-----------APRRKGQHY--------YGEYVTSFAAYVGNQEILQTLVENEAPLETQDSQGNTVFHILVLHQNKSM---ACKMYDFLAAIIPKKQLSYLETITNNDGMTPFKLAAQQGDVQVMFEYFIKKRRHTILSFGPLGSTLYDLTGIDSWD-----DRLSVIDIICTSNNNAARNLLEITPLKELLHYKWTAFGYKYFLLCTIFYIMYTVILTLCCLYRPIMHTFTYQDGKGNTRKPLYEAYQTRNDYLRLSGEII-VVVGGILCLVSEVCLIEQHNNRMCKTF------LSSREFNREIFIFRLL----YACFIIAVVILRFLSSDGETIMMSL----------ALISAWCNVIYFARGFRLLGPLCIMIQKMVLGDLLKFCILLIAVLIGFAAAFNVHFQAMNTTAVPSFNGFPDITFTLFQLMMG 471          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tulp2 (TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991735])

HSP 1 Score: 152.525 bits (384), Expect = 8.340e-38
Identity = 130/507 (25.64%), Postives = 227/507 (44.77%), Query Frame = 3
Query:  651 RGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSP-LTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQE-SYDCLIEKGASPNVQDTFGNTVLHIVVINNRTE----MYRMALRHYKCSADSSV---MNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHA------------PNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
            RG LGE +LHI + LN K  L  A+++L   P L  +      Y G+T LH+AI+  +   VKLL++ G+  +  RA GT F+           P +K          ++GEYP+SFAA  G +E +   L++  A  N QD+ GNTVLHI+V+    E    MY M L          V    N DG T L LAA+ G  ++FN +I     + W+   ++  +Y LT +D+ +T+ SV     L  +   ++ +   +++   +  LL  KW+L+ ++ F + +  Y+  ++V       RP   +     N+ H                GD +R   E ++ + ++   +  +  ++K   K Y+          ++ +G+  LI + A                 R+   + E   + +A+ + W   +++A   K+ G    MI K++  D+  +  +  I I+ F   FYV+ + ++    +   D   TI    +M +G
Sbjct:   60 RGSLGETILHIAV-LNGKREL--AKVILENVPTLVNNAMTSDMYKGETALHIAILKEDIESVKLLLKYGADVINARATGTCFV-----------PGKKSL-------CYFGEYPLSFAACTGHKEITKLILVDHNAPVNAQDSLGNTVLHILVLQPNKELACLMYEMILALVPLKDSHCVEHLQNNDGFTTLNLAANEGDMEMFNYLIKKQKAIYWTIGTVSYSIYNLTDIDTWDTERSV-----LDIITSNKSSKVCKLIDVTPIKELLNLKWKLFGRKNFLIWMISYLLYMLVFTTVSMFRPFNTVTTNQFNNTHVTVLVSIICQGSQSCKGDFLRLTGELITLLGALVIFISEIPLLIKLGPKIYIGNASTGGPFSLLMVGYSILIFSAAI---------------LRVLCHEGEVIPLSLALIIGWCNSIYFARGFKMLGQFSIMIQKIIFADLFPWFCLVFIIIVGFSSAFYVMCQTLELDSNSHLKDYPMTIYAAIEMMMG 525          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rbm19 (RNA binding motif protein 19 [Source:Xenbase;Acc:XB-GENE-922190])

HSP 1 Score: 150.984 bits (380), Expect = 1.279e-37
Identity = 139/506 (27.47%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  654 GILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTR-RALGTFFLQDFGIWLDIGNPSRK-QYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHY----------KCSADSSVMNYDGLTPLALAASLGQ-QKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLI------LAMACRLVGFIV--FIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
            G LGEN+LHI  + N  E L+    LL A+P L         Y G+T LH+AI+N N  +V+ L+   + +   RA G FF            P RK Q+Y        YGEY  SFAA VG+QE    L+E  A    QD+ GNTV HI+V++       MA + Y          + S   ++ N DG+TP  LAA  G  Q +F   I      + SF  L   +Y LTG+DS +     D  S +  +  +       +LE   +  LL  KW  +  + F L   FYI   ++  +    RP                           +   +++T     +A I+++ +++    L+ S    ++  G L L+      L  AC ++  ++  F+ S   +  +SL          A+   W  ++++A   +L GP   MI K+++GD+++F I+    ++ F   F V F+ +    + SF+       T+FQ+ +G
Sbjct:   30 GALGENVLHIAALYNNNEILV---ELLDAFPFLINKPIECDAYKGETALHIAIVNQNAEMVRELIARKADMENARATGNFF-----------APRRKGQHY--------YGEYVTSFAAYVGNQEILQTLVENEAPLETQDSQGNTVFHILVLHQNKS---MACKMYDFLAAIIPKKQLSYLETITNNDGMTPFKLAAQQGDVQVMFEYFIKKRRHTILSFGPLGSTLYDLTGIDSWD-----DRLSVIDIICTSNNNAARNLLEITPLKELLHYKWTAFGYKYFLLCTIFYIMYTVILTLCCLYRP---------------------------IMHTITIT-----IAEILQEAYQTRNDYLRLSGEIIVVVGGILCLVEIFIFRLLYACFIIAVVILRFLSSDGETIMMSL----------ALISAWCNVIYFARGFRLLGPLCIMIQKMVLGDLLKFCILLIAVLIGFAAAFNVHFQAMNTTAVPSFNGFPDITFTLFQLMMG 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tulp2 (TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991735])

HSP 1 Score: 139.043 bits (349), Expect = 9.099e-34
Identity = 129/497 (25.96%), Postives = 211/497 (42.45%), Query Frame = 3
Query:  651 RGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSP-LTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQE-SYDCLIEKGASPNVQDTFGNTVLHIVVINNRTE----MYRMALRHYKCSADSSV---MNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLL--WMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
            RG LGE +LHI + LN K  L  A+++L   P L  +      Y G+T LH+AI+  +   VKLL++ G+  +  RA GT F+           P +K          ++GEYP+SFAA  G +E +   L++  A  N QD+ GNTVLHI+V+    E    MY M L          V    N DG T L LAA+ G  ++FN +I     + W+   ++  +Y LT +D+ +T+ SV     L  +   ++ +   +++   +  LL  KW+L+ ++ F + +  Y+  ++V       RP   +     N+ H          V +   C                       KG       E+I L    +I  M C                       E   I +++ L+  W   +++A   K+ G    MI K++  D+  +  +  I I+ F   FYV+ + ++    +   D   TI    +M +G
Sbjct:   60 RGSLGETILHIAV-LNGKREL--AKVILENVPTLVNNAMTSDMYKGETALHIAILKEDIESVKLLLKYGADVINARATGTCFV-----------PGKKSL-------CYFGEYPLSFAACTGHKEITKLILVDHNAPVNAQDSLGNTVLHILVLQPNKELACLMYEMILALVPLKDSHCVEHLQNNDGFTTLNLAANEGDMEMFNYLIKKQKAIYWTIGTVSYSIYNLTDIDTWDTERSV-----LDIITSNKSSKVCKLIDVTPIKELLNLKWKLFGRKNFLIWMISYLLYMLVFTTVSMFRPFNTVTTNQFNNTHVT--------VLDSYQC-----------------------KGDFLRLTGELITLLGALVIFIMLCH----------------------EGEVIPLSLALIIGWCNSIYFARGFKMLGQFSIMIQKIIFADLFPWFCLVFIIIVGFSSAFYVMCQTLELDSNSHLKDYPMTIYAAIEMMMG 477          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:MGI Symbol;Acc:MGI:1927259])

HSP 1 Score: 182.956 bits (463), Expect = 2.617e-47
Identity = 150/530 (28.30%), Postives = 239/530 (45.09%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            EV +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A+IN N +LV+ L+  G+ ++ RA G+ F                 +YR   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   D S+     L  +V  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N  +  +N                D +R V E +S V +V   L  + +I +     +           +I + + F++L  M  RL      +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 EVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVF-----------------HYRPH-NLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSL-----LELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRP---LKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNVDGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYS 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:MGI Symbol;Acc:MGI:1927259])

HSP 1 Score: 182.57 bits (462), Expect = 2.764e-47
Identity = 150/530 (28.30%), Postives = 239/530 (45.09%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            EV +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A+IN N +LV+ L+  G+ ++ RA G+ F                 +YR   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   D S+     L  +V  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N  +  +N                D +R V E +S V +V   L  + +I +     +           +I + + F++L  M  RL      +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 EVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVF-----------------HYRPH-NLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSL-----LELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRP---LKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNVDGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYS 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpv5 (transient receptor potential cation channel, subfamily V, member 5 [Source:MGI Symbol;Acc:MGI:2429764])

HSP 1 Score: 173.326 bits (438), Expect = 2.289e-44
Identity = 149/527 (28.27%), Postives = 238/527 (45.16%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNG---------------DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLI-LAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +RG LGE  LH+  + +   +L  A +L+ A P L  +  +   + GQT LH+A++N N +LV+ L+  G+  + RA G+ F                  +R   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+V+  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + WSF  LT  +Y LT +DS   + S      L  VV ++ ++   +LE+  V  L+  KW+ Y +  F L    YI  ++        RP   L+    N  H  +N                D +R V E ++ + +V   L  + +I +     Y           +I + +  L+ L MA RL      +V  S                +A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D  + + + F++ L    G     VDL F  S
Sbjct:   68 QRGALGETALHVAALYD---NLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVMNQNVNLVRALLARGASASARATGSAF------------------HRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSF-----LELVVSSKKKEARQILEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRP---LKFRDANRTHVRDNTIMEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHVIIITYASLVLLTMAMRLTNVNGEVVPMS----------------MALVLGWCSVMYFARGFQMLGPFTIMIQKMIFGDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANYRVDLPFMYS 549          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpv5 (transient receptor potential cation channel, subfamily V, member 5 [Source:MGI Symbol;Acc:MGI:2429764])

HSP 1 Score: 132.494 bits (332), Expect = 2.246e-31
Identity = 139/527 (26.38%), Postives = 217/527 (41.18%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNG---------------DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLI-LAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +RG LGE  LH+  + +   +L  A +L+ A P L  +  +   + GQT LH+A++N N +LV+ L+  G+  + RA G+ F                  +R   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+V+  N+T   +MY + L +       S   V N  GLTP  LA   G           NTV                                      AR      +LE+  V  L+  KW+ Y +  F L    YI  ++        RP   L+    N  H  +N                D +R V E ++ + +V   L  + +I +     Y           +I + +  L+ L MA RL      +V  S                +A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D  + + + F++ L    G     VDL F  S
Sbjct:   68 QRGALGETALHVAALYD---NLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVMNQNVNLVRALLARGASASARATGSAF------------------HRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEG-----------NTV--------------------------------------ARQ-----ILEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRP---LKFRDANRTHVRDNTIMEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHVIIITYASLVLLTMAMRLTNVNGEVVPMS----------------MALVLGWCSVMYFARGFQMLGPFTIMIQKMIFGDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANYRVDLPFMYS 500          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:MGI Symbol;Acc:MGI:1341787])

HSP 1 Score: 117.472 bits (293), Expect = 2.250e-26
Identity = 138/550 (25.09%), Postives = 224/550 (40.73%), Query Frame = 3
Query:  618 QSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIG-----SQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASP---NVQDTFGNTVLHIV-------------VINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTF---KSYVKGLKYSALSEII-FLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGI-----------------TSFDDVISTIVTIFQMTLG 2108
             SEF   E G+       LL   L L+  ++  IA LL +A        F+      S Y GQT LH+AI   N +LV LLV+ G+ +   A G FF +  G         R  +Y        +GE P+S AA          L++    P   + +D+ GNTVLH +             V N   E+  +  + +       + N  GLTPLALAAS G+  V   I+                  W++  +   +Y L+ +D+   +  ++    ++    + T     ML    + RLLQ+KW  + KR F      Y   +I+   A Y RP   L PY  N+      GD  R   E    ++SV+  +Y     + Q F   +  +K L   + SEI+ F+  LF+       LV  +++   +         K   A ++ ++ + W  +L+Y    +  G    MI K+++ D+ RF  +Y + +  F      L +D K   +                  S++ + ST + +F+ T+G
Sbjct:  146 DSEFKDPETGKTC-----LLKAMLNLHNGQNDTIALLLDIARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFKKTKG---------RPGFY--------FGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTADNTKFVTNMYNEILILGAKLHPTLKLEELTNKKGLTPLALAASSGKIGVLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLE----VIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMIIFTTAAYYRPVEGLPPYKLNNTV----GDYFRVTGE----ILSVSGGVYFFFRGI-QYFLQRRPSLKSLFVDSYSEILFFVQSLFM-------LVSVVLYFSHR---------KEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGKNNSLPVESPPHKCRGSACRPGNSYNSLYSTCLELFKFTIG 644          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91WD2|TRPV6_MOUSE (Transient receptor potential cation channel subfamily V member 6 OS=Mus musculus OX=10090 GN=Trpv6 PE=1 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.831e-46
Identity = 150/530 (28.30%), Postives = 239/530 (45.09%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            EV +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A+IN N +LV+ L+  G+ ++ RA G+ F                 +YR   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   D S+     L  +V  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N  +  +N                D +R V E +S V +V   L  + +I +     +           +I + + F++L  M  RL      +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 EVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVF-----------------HYRPH-NLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSL-----LELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRP---LKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNVDGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYS 595          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R186|TRPV6_RAT (Transient receptor potential cation channel subfamily V member 6 OS=Rattus norvegicus OX=10116 GN=Trpv6 PE=1 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.971e-46
Identity = 147/529 (27.79%), Postives = 242/529 (45.75%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            EV ++G +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A+IN N +LV+ L+  G+ ++ RA G+ F                 +YR   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + W++  LT  +Y LT +DS   D S+     L  +V  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N  +  +N                D +R V E +S V +V   L  + +I +     +           +I + + F++L          V +V + T++   +  +  A +     L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 EVHQKGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVF-----------------HYRPH-NLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSL-----LELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRP---LKPRITNRTNPRDNTLLQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIVTYAFMVL----------VTMVMRLTNSDGEVVPMSFALV-----LGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYS 595          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H1D0|TRPV6_HUMAN (Transient receptor potential cation channel subfamily V member 6 OS=Homo sapiens OX=9606 GN=TRPV6 PE=1 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 2.408e-44
Identity = 143/532 (26.88%), Postives = 236/532 (44.36%), Query Frame = 3
Query:  639 EVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSAD-----SSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNN---------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLIL-AMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +V +RG +GE  LHI  + +  E    A +L+ A P L  +      Y GQT LH+A++N N +LV+ L+   + ++ RA GT F                   R   +  ++GE+P+SFAA V  +E    LIE GA    QD+ GNTVLHI+++  N+T   +MY + L  Y    D       V N+ GLTP  LA   G   +F  ++       W++  LT  +Y LT +DS     S D  S L  ++  +  +   +L++  V  L+  KW+ Y +  F +    Y+  +I   M    RP   L+P   N     +N                D +R V E ++ + ++   L  V +I +     +           ++ + + F++L  M  RL+     +V  S                 A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+    + +  F D    + + F++ L    G     VDL F  S
Sbjct:  111 KVHQRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAF------------------RRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLL-SYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDS-----SGDEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRP---LKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGEVVPMS----------------FALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYS 596          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JIP0|TRPV5_RAT (Transient receptor potential cation channel subfamily V member 5 OS=Rattus norvegicus OX=10116 GN=Trpv5 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.502e-43
Identity = 149/523 (28.49%), Postives = 237/523 (45.32%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNG---------------DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLF 2138
            +RG LGE  LH+  + +   +L  A +L+   P L  +  +   + GQT LH+AI+N N +LV+ L+  G+  + RA G+ F                  +R   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+V+  N+T   +MY + L H       S   V N  GLTP  LA   G   +F  ++     + WS   LT  +Y LT +DS   D S      L  VV ++ ++   +LE+  V  L+  KW+ Y +  F L    YI  +I        RP   L+    N  H  +N                D VR V E ++ + +V   L  + +I +     Y            +  G   +I+     LV  I+ +       R++    E   I +A+ L W  +++++   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+    + +  F D  + + + F++ L    G     VDL F
Sbjct:   68 QRGALGETALHVAALYD---NLDAAIMLMETAPYLVTESTLCEPFVGQTALHIAIMNQNVNLVRALLARGASASARATGSAF------------------HRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSHDGGDHLKSLELVPNNQGLTPFKLAGVEGNTVMFQHLMQKRKHIQWSLGPLTSSIYDLTEIDSWGEDLSF-----LELVVSSKKKEARQILEQTPVKELVSLKWKKYGQPYFCLLGMLYIFYMICFTTCCVYRP---LKFRDANRTHVRDNTVLEQKPLQEAYVTYQDKVRLVGELVTVIGAVVILLIEIPDIFRVGASRY--------FGHTVLGGPFHVIIITYASLVLLIMVM-------RLTSMNGEVVPISMALVLGWCSVMYFSRGFQMLGPFTIMIQKMIFGDLLRFCWLMAMVILGFASAFYIIFQTEDPESLGEFSDYPTAMFSTFELFLTIIDGPANYSVDLPF 546          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P69744|TRPV5_MOUSE (Transient receptor potential cation channel subfamily V member 5 OS=Mus musculus OX=10090 GN=Trpv5 PE=1 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.601e-43
Identity = 149/527 (28.27%), Postives = 238/527 (45.16%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT---EMYRMALRHYKCSADSS---VMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNG---------------DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLI-LAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTL----GEFKKIVDLLFQLS 2147
            +RG LGE  LH+  + +   +L  A +L+ A P L  +  +   + GQT LH+A++N N +LV+ L+  G+  + RA G+ F                  +R   +  +YGE+P+SFAA VG +E    LIE GA    QD+ GNTVLHI+V+  N+T   +MY + L +       S   V N  GLTP  LA   G   +F  ++     + WSF  LT  +Y LT +DS   + S      L  VV ++ ++   +LE+  V  L+  KW+ Y +  F L    YI  ++        RP   L+    N  H  +N                D +R V E ++ + +V   L  + +I +     Y           +I + +  L+ L MA RL      +V  S                +A+ L W  ++++A   ++ GP   MI K++ GD++RF  + ++ IL F   FY++F+      +  F D  + + + F++ L    G     VDL F  S
Sbjct:   68 QRGALGETALHVAALYD---NLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVMNQNVNLVRALLARGASASARATGSAF------------------HRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSF-----LELVVSSKKKEARQILEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRP---LKFRDANRTHVRDNTIMEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHVIIITYASLVLLTMAMRLTNVNGEVVPMS----------------MALVLGWCSVMYFARGFQMLGPFTIMIQKMIFGDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANYRVDLPFMYS 549          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DQR1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012503g1 PE=3 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 3.107e-137
Identity = 226/621 (36.39%), Postives = 370/621 (59.58%), Query Frame = 3
Query:  327 NLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKY---------------VDLSLRSRNSGKETQL---PPDSRAIKEMVQTIQSRYEGQ-SEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAEN----HIHAPNNG-DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK 2117
            N +Y  +++ G G+L+D    +GV+ V Q+I +E+A +++  G G  +   ++++  +TKY                 L+ +S      +QL    P       +  +  + ++      VCW++ +RGI GE LLH+CL+  T  H  +A +L+  +PNL KD+FIG +YFGQ+ LHMA +N +  +VK+L+Q G+ + +RA G FF  D   W+     +  Q +      ++YGEYP+SFA  +G  E YD LI  GA P+ +D  GN+VLH++VI+N+TE+YR+ALRHYK  AD + +N+ GL P++LAA LG+++VFNEII L+   +W + ++ C++YPLTG+D+I  +G  DW+S  M +++ +T +HL ML+EGV+ +LL EKW  Y +++F  RL   I  L +  +A+YLRP  +    + +     +    NG ++VRY+ E ++ + S  +  + +  I +Q F+++ + L ++    +  +    + L +  RL G + +  +  T T +     EE+ +I+A+P +W  LLF+AS   L G  VT+I K+L GD++ F IIY +    FGQ FY LF++I+   I SF DV++T++T+FQMT GEFK
Sbjct:   29 NPIYSLVDIYGGGRLVDCYEREGVAAVRQIIKEEVAPYLYKGGDGIEISGSDLIRKPVTKYEVPDEDPLKTRSAMVSTLAAQSVEKSTASQLFREQPRKNVPMRLFASAAAVFDNNIKHLVCWDITKRGIYGETLLHLCLLHKTPAHRQLAIILVGMFPNLAKDFFIGWEYFGQSALHMATLNNDLEIVKILIQAGADIHQRAAGDFFQPDDQRWIKKAKATNYQGH------SYYGEYPLSFACCIGSPEIYDYLIVSGADPSNRDQLGNSVLHMLVIHNQTEVYRLALRHYKRPADPTAVNHAGLNPISLAAKLGRRRVFNEIIGLSATEMWRYGDIACKLYPLTGVDTIGPNGHTDWDSAFMHIINGQTSEHLDMLDEGVIRQLLYEKWNKYVRKRFLQRLALTIAYLSIMTLAVYLRPQENWNVSSNSTGIVRVSLQVNGQNVVRYICEIITVINSGLTIYFMINEIREQGFRAFTRSLSHAPPRAVYIVACFLITLVLPARL-GVLFWSDNWQTMTLV-----EESLLILAIPCVWTYLLFFASGTNLYGTFVTLIYKMLSGDVLTFGIIYCVLSTCFGQAFYFLFRNIEQITIGSFQDVLTTVMTVFQMTHGEFK 637          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GDK8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012503g2 PE=3 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 2.069e-136
Identity = 226/621 (36.39%), Postives = 369/621 (59.42%), Query Frame = 3
Query:  327 NLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKY---------------VDLSLRSRNSGKETQL---PPDSRAIKEMVQTIQSRYEGQ-SEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAEN----HIHAPNNG-DIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK 2117
            N +Y  +++ G G L+D    +GV+ V Q+I +E+A +++  G G  +   ++++  +TKY                 L+ +S      +QL    P       +  +  + ++      VCW++ +RGI GE LLH+CL+  T  H  +A +L+  +PNL KD+FIG +YFGQ+ LHMA +N +  +VK+L+Q G+ + +RA G FF  D   W+     +  Q +      ++YGEYP+SFA  +G  E YD LI  GA P+ +D  GN+VLH++VI+N+TE+YR+ALRHYK  AD + +N+ GL P++LAA LG+++VFNEII L+   +W + ++ C++YPLTG+D+I  +G  DW+S  M +++ +T +HL ML+EGV+ +LL EKW  Y +++F  RL   I  L +  +A+YLRP  +    + +     +    NG ++VRY+ E ++ + S  +  + +  I +Q F+++ + L ++    +  +    + L +  RL G + +  +  T T +     EE+ +I+A+P +W  LLF+AS   L G  VT+I K+L GD++ F IIY +    FGQ FY LF++I+   I SF DV++T++T+FQMT GEFK
Sbjct:   29 NPIYSLVDIYGGGCLVDCYEREGVAAVRQIIKEEVAPYLYKGGDGIEISGSDLIRKPVTKYEVPDEDPLKTRSAMVSTLAAQSVEKSTASQLFREQPRKNVPMRLFASAAAVFDNNIKHLVCWDITKRGIYGETLLHLCLLHKTPAHRQLAIILVGMFPNLAKDFFIGWEYFGQSALHMATLNNDLEIVKILIQAGADIHQRAAGDFFQPDDQRWIKKAKATNYQGH------SYYGEYPLSFACCIGSPEIYDYLIVSGADPSNRDQLGNSVLHMLVIHNQTEVYRLALRHYKRPADPTAVNHAGLNPISLAAKLGRRRVFNEIIGLSATEMWRYGDIACKLYPLTGVDTIGPNGHTDWDSAFMHIINGQTSEHLDMLDEGVIRQLLYEKWNKYVRKRFLQRLALTIAYLSIMTLAVYLRPQENWNVSSNSTGIVRVSLQVNGQNVVRYICEIITVINSGLTIYFMINEIREQGFRAFTRSLSHAPPRAVYIVACFLITLVLPARL-GVLFWSDNWQTMTLV-----EESLLILAIPCVWTYLLFFASGTNLYGTFVTLIYKMLSGDVLTFGIIYCVLSTCFGQAFYFLFRNIEQITIGSFQDVLTTVMTVFQMTHGEFK 637          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2T7NVZ7 (ANK_REP_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15824 PE=3 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 5.707e-116
Identity = 209/600 (34.83%), Postives = 344/600 (57.33%), Query Frame = 3
Query:  381 LRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILK-CSITK------YVDLSLRSRNSGKETQLP------PDSRAIKEMVQTIQ----SRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFL-QDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDI---KAKGITSFDDVISTIVTIFQMTLGEFK 2117
            L ++G   V ++   ++ ++++N GKG ++     +K C+  K        +  L  ++   E +L       P+ +  +E+++  Q    +++E      CW++ +RG +GE   H+C ++++  H  + + LL  +P L  D + G +YFG++ LH+A++  +  +V+LLVQ G+ + +RA G FFL +D     D    +    Y       +YGEYP++FAA  G+Q+ YD LI+ GA+PN QD+FGNTVLH+VVI+ +  M+R A++H    A + ++N   LTPL LA+ LG+  +F ++++L +V  W FS++TC  YPL  +DSI  +G  +W+S LM +VD  +++HL MLE GVV++LL+EKW+ +AKR+F  RL      L++  +A+Y+RPSG   P   ++  A    D VRY  E + C+    +    +  I  + F S++K   ++    +  +  L ++  +  R                + L+++E+  +IIA P  W  LLF+A  ++LTGP VTMI K+L GD++RF IIY I ++ F Q FY LF+D+     KG   F+    TI+T+FQMTLGEFK
Sbjct:   37 LSDQGPDRVKEIAKTKMMTYLYNCGKGAVIEKSEYIKWCNNRKAKFKAFQEESELPGKSEKSEWELKHKLESKPEEKTEEELLREFQEDPINKFEPHE--ACWDLNKRGGVGETPFHLCYLMDSPVHFEVGKALLEVFPKLACDVYEGEEYFGESALHIAVMLDDLDIVQLLVQNGANVNQRATGRFFLPEDLKKNPDPTAATNYDGY------AYYGEYPLAFAACRGNQDIYDYLIDHGANPNFQDSFGNTVLHMVVIHCQPGMFRYAVQHNIAPAQTDILNKQNLTPLTLASKLGRSDIFRDMLDLGSVEFWRFSHVTCSAYPLAAIDSIGPNGEHNWHSALMIIVDGESDEHLEMLEGGVVWQLLKEKWKTFAKRRFLERLAIACVHLVLFSVAIYIRPSG---PSLLDYTGAV---DAVRYFCEVIVCLSCTATIAMEIIEISSRGFWSFLKNCSHAPAHTVNLVSCLLILACIPFRF---------------LQLYEVEDILLIIAAPCSWFFLLFFARGVQLTGPFVTMIYKMLRGDLIRFGIIYLIFLIGFTQGFYFLFRDVTDDDDKGAKKFETFPETILTLFQMTLGEFK 607          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267EZD3 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000062g1 PE=3 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 3.038e-114
Identity = 201/524 (38.36%), Postives = 311/524 (59.35%), Query Frame = 3
Query:  630 VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRP--------------------------SGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKA--KGITSFDDVISTIVTIFQMTLGEFK 2117
            VCW++ +RG+ GE LLH+CL+ ++  H  +A+ LL  +PNL  D+FIG +YFG + LHMA++N +  LVKLLV+ G+ + +RA+G FF  +    +   N +    YR +   ++ GEYP++FA  VG  E YD L+  GA P+ +D FGN+VLH++VI+N TE+YR+A++H+K  A+  + N  GL P++LAA LG++ VFNEII+L++  +W F+N+TC+VYPLTG+D+I   G  DWNS  M +++  T+QHL MLE+G++ +LL EKW+ YA+ +F  RL      +I+   A+YLRP                                 A       +  ++ RYV E ++ V S+ +   H+  + +Q    +++GL  +       +  L + LA+  R++  +       TS   +L   EE  +IIA P +W+ LLF+A   +L G  VTMI K++ GD+ RF IIYSI ++ F Q +Y LF+DI      + SF    +T++T+ QMTLG+FK
Sbjct:  108 VCWDIEQRGMYGETLLHLCLVCDSPLHRQLAKALLSVFPNLAVDFFIGWEYFGHSSLHMAVMNKDLELVKLLVKCGAVIDQRAVGDFFRPEDQRQV---NKAAITDYRGQ---SYLGEYPLAFACCVGSAEIYDFLLSCGAHPDSKDQFGNSVLHMLVIHNNTEIYRLAVKHHKKPANPKLTNSAGLNPISLAAKLGRKDVFNEIIDLSSSEMWRFANITCKVYPLTGVDTIGQSGRTDWNSAFMYIINGTTDQHLDMLEQGLINQLLYEKWQKYARARFLQRLLMLTIHIIIMSAAIYLRPLKSSSDTSATSSSLESDNSSLTTTVSYVASTTTAAAAAVTISTQEVFRYVFECITVVNSLVTLFMHIDEVREQGVLDFLRGLGDAPPKTSFLIACLLISLALPVRIMSLLW------TSNLETLTNAEETLLIIAAPCVWIYLLFFAGGTQLNGTFVTMIYKMIKGDMARFGIIYSIILVCFAQTYYFLFRDIDPNVSSVLSFSQPHTTVMTLLQMTLGDFK 619          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267H5B1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006500g1 PE=3 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 3.935e-113
Identity = 202/524 (38.55%), Postives = 312/524 (59.54%), Query Frame = 3
Query:  630 VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRP--------------------------SGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKA--KGITSFDDVISTIVTIFQMTLGEFK 2117
            VCW++ +RG+ GE LLH+CL+ ++  H  +A+ LL  +PNL  D+FIG +YFG + LHMA++N +  LVKLLV+ G+ + +RA+G FF  +    +   N +    YR +   ++ GEYP++FA  VG  E YD L+  GA P+ +D FGN+VLH++VI+N TE+YR+A++H+K  A+  + N  GL P++LAA LG++ VFNEII+L++  +W F+N+TC+VYPLTG+D+I   G  DWNS  M +++  T+QHL MLE+G++ +LL EKW+ YA+ +F  RL      +I+   A+YLRP                          S      A       +  ++ RYV E ++ V S+ +   H+  + +Q    +++GL  +       +  L + LA+  R++  +       TS   +L   EE  +IIA P +W+ LLF+A   +L G  VTMI K++ GD+ RF IIYSI ++ F Q +Y LF+DI      + SF    +T++T+ QMTLG+FK
Sbjct:  286 VCWDIEQRGMYGETLLHLCLVCDSPLHRQLAKALLSVFPNLAVDFFIGWEYFGHSSLHMAVMNKDLELVKLLVKCGAVIDQRAVGDFFRPEDQRQV---NKAAITDYRGQ---SYLGEYPLAFACCVGSAEIYDFLLSCGAHPDSKDQFGNSVLHMLVIHNNTEIYRLAVKHHKKPANPKLTNSAGLNPISLAAKLGRKDVFNEIIDLSSSEMWRFANITCKVYPLTGVDTIGQSGRTDWNSAFMYIINGTTDQHLDMLEQGLINQLLYEKWQKYARARFLQRLLMLTIHIIIMSAAIYLRPLKSSSDTSATSSSLESDNSSLTTTASSVASTTTAAAAAVTISTQEVFRYVFECITVVNSLVTLFMHIDEVREQGVLDFLRGLGDAPPKTSFLIACLLISLALPVRIMSLLW------TSNLETLTNAEETLLIIAAPCVWIYLLFFAGGTQLNGTFVTMIYKMIKGDMARFGIIYSIILVCFAQTYYFLFRDIDPNVSSVLSFSQPHTTVMTLLQMTLGDFK 797          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpv6 (transient receptor potential cation channel subfamily V member 6-like [Source:NCBI gene;Acc:103028240])

HSP 1 Score: 151.369 bits (381), Expect = 2.982e-37
Identity = 140/516 (27.13%), Postives = 231/516 (44.77%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPL-TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNR----TEMYRMALRHYKCSADS----SVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDL-QPYAENHIHAP------------NNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
             RG LGE  LH+ +M ++ E    A  L+   P L  +   G  Y G T LH+A+IN N +LV+ L++ G+ + T RA G +F +  G                     +YGE+ ++FA+ +G+      LI  GA+   QD+ GNT+LHI+V+        +++ + L + + +  +     + NY GLTP  LAA  G    F  ++N   +V W+   LT  +Y LT +DS   D SV     L  +V ++  +  ++L+   V  L+  KW LY K  F L L  Y+  +    +    RP  D+ + Y ++ I                  D +R V E +S V ++   L  + +I++   K Y      SAL      G     L     +V F+  +       R +    E   + + + L W  +L++A   ++ GP V +I K+L GD+ +F  +  IA++ F    +  +       I S+     T  T F++T+G     VD
Sbjct:   94 ERGALGETALHVAVMHDSYE---AAVALMEGAPELINEPMTGELYEGLTALHIAVINQNSNLVQELIERGADVSTPRATGMYFRKRRG------------------GLFYYGEHILAFASCIGNTPIISMLISAGANIRAQDSLGNTILHILVMQPNKIISCQIFDLLLTNDEKTDPTIPLDKIPNYRGLTPFKLAAKKGNVVAFQHMVNSRRIVQWNLGCLTSYLYDLTEIDSRTDDMSV-----LELIVCSQKREARSILQVTPVQELITLKWNLYGKYYFRLLLLVYLLYIGTFTLCCMHRPLKDIPENYTKSEIDQTVKIQKTVKESYVTYADHLRLVGEIISVVGALIILLLEIPDILRVGAKRY---FGQSALG-----GPFHATLITYAVMVVFLCIL-------RTTEMPGETVLMALCLVLGWCNVLYFARGFEMLGPYVIVIQKILFGDLTKFMWLSLIALVGFSTALWTWYMTQDHLSIPSYRSFPITFFTEFELTIGLIDLPVD 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpv6 (transient receptor potential cation channel subfamily V member 6-like [Source:NCBI gene;Acc:103028240])

HSP 1 Score: 150.984 bits (380), Expect = 3.555e-37
Identity = 140/516 (27.13%), Postives = 231/516 (44.77%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPL-TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNR----TEMYRMALRHYKCSADS----SVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDL-QPYAENHIHAP------------NNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
             RG LGE  LH+ +M ++ E    A  L+   P L  +   G  Y G T LH+A+IN N +LV+ L++ G+ + T RA G +F +  G                     +YGE+ ++FA+ +G+      LI  GA+   QD+ GNT+LHI+V+        +++ + L + + +  +     + NY GLTP  LAA  G    F  ++N   +V W+   LT  +Y LT +DS   D SV     L  +V ++  +  ++L+   V  L+  KW LY K  F L L  Y+  +    +    RP  D+ + Y ++ I                  D +R V E +S V ++   L  + +I++   K Y      SAL      G     L     +V F+  +       R +    E   + + + L W  +L++A   ++ GP V +I K+L GD+ +F  +  IA++ F    +  +       I S+     T  T F++T+G     VD
Sbjct:   75 ERGALGETALHVAVMHDSYE---AAVALMEGAPELINEPMTGELYEGLTALHIAVINQNSNLVQELIERGADVSTPRATGMYFRKRRG------------------GLFYYGEHILAFASCIGNTPIISMLISAGANIRAQDSLGNTILHILVMQPNKIISCQIFDLLLTNDEKTDPTIPLDKIPNYRGLTPFKLAAKKGNVVAFQHMVNSRRIVQWNLGCLTSYLYDLTEIDSRTDDMSV-----LELIVCSQKREARSILQVTPVQELITLKWNLYGKYYFRLLLLVYLLYIGTFTLCCMHRPLKDIPENYTKSEIDQTVKIQKTVKESYVTYADHLRLVGEIISVVGALIILLLEIPDILRVGAKRY---FGQSALG-----GPFHATLITYAVMVVFLCIL-------RTTEMPGETVLMALCLVLGWCNVLYFARGFEMLGPYVIVIQKILFGDLTKFMWLSLIALVGFSTALWTWYMTQDHLSIPSYRSFPITFFTEFELTIGLIDLPVD 549          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpv4 (transient receptor potential cation channel, subfamily V, member 4 [Source:ZFIN;Acc:ZDB-GENE-030912-7])

HSP 1 Score: 107.842 bits (268), Expect = 1.946e-23
Identity = 114/432 (26.39%), Postives = 182/432 (42.13%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIE---KGASPNVQDTFGNTVLHIVV-------INNR--TEMYRMAL----RHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVL-----------WSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKY----SALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIY 1982
            Y GQT LH+AI    K   +LLV+ G+ +  +A G FF            P  +  Y       ++GE P+S AA     +    L E   K A    QD+ GNTVLH +V        N R  T+MY + L    R Y       V+N DG++PL +AA LG+  VF  II     V            W++  +   +Y L+ LD+   D SV      + V ++R E    ML    +  LL+ KW+ +A   F + +  Y+  +I+  +         + PY    +      D +R   E    ++++ S ++     VK  F     G+       +   + F+  + +++  A  L G   +I                + ++ A+ L WM  L++   +KLTG    MI K+L  D+ RF ++Y
Sbjct:  202 YRGQTALHIAIERRCKQYAELLVEKGADVHAQARGRFF-----------QPRDEGGY------FYFGELPLSLAACTNQPDMVHYLTENSHKKADMRRQDSRGNTVLHALVHIADNTRDNTRFLTKMYDLLLIKCARLYPECNLEQVLNNDGMSPLMMAAKLGKIGVFQHIIRREVQVEEARHLCRKFKDWAYGPVYSSLYDLSSLDTCGEDVSV----LEILVYNSRIENRHEMLAVEPINELLRAKWQKFAAVTFYISVISYLITMIIFTL---------VPPYPYVTLE-----DKLRLTGE----IITLASGVFFFLTNVKDLFLKKCPGVNSLFIDGSFQLLYFIYSVLVLVTAALYLSGIEAYI----------------SVMVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILFKDLFRFLLVY 578          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 97.0561 bits (240), Expect = 4.156e-20
Identity = 106/449 (23.61%), Postives = 190/449 (42.32%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFY-GEYPVSFAASVGDQESYDCLIEKGASP---NVQDTFGNTVLH--IVVINNRTEM--YRMALRHYKCSADS----------SVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVV-DARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQL-IVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKD 2033
            Y GQTPLH+AI   +K    LL+Q G+ +  +A G+FF Q  G                  +T FY GE P+S AA    +E  D L++   S      +D+ GNTVLH  + V +N  E   + + +  Y  + D+           + N  GLT + LAA  G+  +F  I++                 W++  +   +Y L  +D+         NS L  VV        L ML+   + +LL++KW  +A R F      Y+  L I   +  + R      P              + +  E ++C  SV   +  + +++++  +  +K L     S++ F            + V F++ +V  +  ++  L     AF+++ +   W+ LL+++   +  G    MI ++++ D++RF  +Y + ++ F      L K+
Sbjct:  134 YKGQTPLHVAIERRSKHFADLLIQKGANVHAKACGSFF-QPHG------------------ETCFYFGELPLSLAACTNQKEIVDLLMDNPVSKADVREKDSQGNTVLHALVAVADNSPENTDFVICMYDYILTKDAHMNPKRQKLEDIQNNQGLTTIKLAAKTGKIGLFEHILHREFQQEECRHLSRKFTEWAYGPIYSSLYDLASVDTYEK------NSVLEIVVYGTEIPNRLEMLQVEPLNKLLEDKWNRFAHRIFLFNFICYLIYLFIFTAICSHHREGQAFLP-------EKTTSGYLFFTGEIITCAASVYFFIKGLMDMMRKPPR--MKTLLIDGYSDLNFF----------FQAVCFLLCVVLYAFDSKAYL-----AFLVVCLAFSWVNLLYFSRGSRHMGIYSVMIQRMILSDMLRFLFVYIVFLVGFSAAVNTLLKE 533          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 95.1301 bits (235), Expect = 1.458e-19
Identity = 108/450 (24.00%), Postives = 187/450 (41.56%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFY-GEYPVSFAASVGDQESYDCLIEKGASP---NVQDTFGNTVLH--IVVINNRTEM--YRMALRHYKCSADS----------SVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVV-DARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQL-IVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKS-YVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKD 2033
            Y GQTPLH+AI   +K    LL+Q G+ +  +A G+FF Q  G                  +T FY GE P+S AA    +E  D L++   S      +D+ GNTVLH  + V +N  E   + + +  Y  + D+           + N  GLT + LAA  G+  +F  I++                 W++  +   +Y L  +D+         NS L  VV        L ML+   + +LL++KW  +A R F      Y+  L I   +  + R      P              + +  E ++C  SV   +  V  ++    K   +K L     S++ F            + V F++ +V  +  ++  L     AF+++ +   W+ LL+++   +  G    MI ++++ D++RF  +Y + ++ F      L K+
Sbjct:  128 YKGQTPLHVAIERRSKHFADLLIQKGANVHAKACGSFF-QPHG------------------ETCFYFGELPLSLAACTNQKEIVDLLMDNPVSKADVREKDSQGNTVLHALVAVADNSPENTDFVICMYDYILTKDAHMNPKRQKLEDIQNNQGLTTIKLAAKTGKIGLFEHILHREFQQEECRHLSRKFTEWAYGPIYSSLYDLASVDTYEK------NSVLEIVVYGTEIPNRLEMLQVEPLNKLLEDKWNRFAHRIFLFNFICYLIYLFIFTAICSHHREGQAFLP-------EKTTSGYLFFTGEIITCAASVYFFIKGVRILMDMMRKPPRMKTLLIDGYSDLNFF----------FQAVCFLLCVVLYAFDSKAYL-----AFLVVCLAFSWVNLLYFSRGSRHMGIYSVMIQRMILSDMLRFLFVYIVFLVGFSAAVNTLLKE 530          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 129.798 bits (325), Expect = 3.726e-32
Identity = 104/409 (25.43%), Postives = 191/409 (46.70%), Query Frame = 3
Query:  969 TFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVI----NNRTEMYRMAL---RHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENH-----IHAPNNGDIV-----------------RYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLG 2108
             F GE+ ++FAA  G+++    L+E     + QD+ GNTVLH++V+    N    M+++ L   R    +A  +V N+DGLTP+ +AA+ G   +F  ++     V W F ++T  +Y L+G+DS + + SV     +  +  +R  +   +L+   V  L+  KW LY +R F L    Y+  +++  +    RP   L+ YA+ +     +  P+ GD V                 R   E +  V +V   ++ V ++++   K Y           II          M C     ++ ++ + T+T       E   + +A+ L W   +F+A   ++ GP   MI K+L GD++RF  +  + +L +   F++ F+ ++ +    F    + + T+FQ+ LG
Sbjct:    1 VFAGEHVLTFAACTGNEDIMRILLENHVPVHAQDSLGNTVLHVLVLQPNKNQACAMHQLLLSCDRSGAAAALEAVQNHDGLTPIKMAAANGNTVMFQNLVTRRRAVQWVFGSVTSSIYDLSGIDSWDDEQSV-----IELIASSRRREARRILDITPVKELVSLKWSLYGRRYFWLWALIYMCYIVIFTLCCIYRP---LELYADYNASSATLQPPSLGDFVMVQRPLAACYDSYDDFLRLSGEIVVVVGAVMMLVFEVRDMIRTGVKRYFGSTVTGGPFHII----------MICYSCLVMLLLLMRLTNTHG-----EYVPMAVALVLGWCNTMFFARGFEMLGPFTIMIQKMLFGDLLRFCWLMLMVLLGYASAFHICFQLLRREDFLHFAGFETVLFTMFQLFLG 386          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007740.1 (pep scaffold:Pmarinus_7.0:GL478934:8361:25408:-1 gene:ENSPMAG00000007001.1 transcript:ENSPMAT00000007740.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.384e-30
Identity = 87/298 (29.19%), Postives = 146/298 (48.99%), Query Frame = 3
Query:  663 GENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINN----RTEMYR--MALRHY-KCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRP 1535
            GE LLH+ L+     H  +A  LL A P +         Y G+T +H+AI N N  +VK L+  G+ +T RA G+FFL           P ++          +YGEY +SFAA  G++     L++ GAS   QD+ GNTVLH++V++        MY   ++L H  +  +  ++ N  G +PL LAA+ G   +FN ++     + W+   +   +Y LT +D+       D NS L  +  ++ ++   ++    +  LL  KW++Y  + F +    YI  +++  +   +RP
Sbjct:    1 GETLLHVALLF---RHRTLALRLLDAVPAIINIPMTCELYRGETAIHIAIANENVVMVKELLHRGADITARACGSFFL-----------PGKRC-------QCYYGEYTLSFAACTGNEMIVKLLMDHGASLITQDSLGNTVLHVLVLHPDRVLAVHMYDFLISLVHEGQRRSLEAIRNAQGFSPLKLAAAEGNLAMFNHLMQKRKNIYWNCGPVRSAIYDLTDIDTWG-----DKNSILEIITSSKNKEARNLIGMTPIKELLHHKWKVYGFKYFIIWTVLYIFYILIFTVCCIMRP 272          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001427.1 (pep scaffold:Pmarinus_7.0:GL477062:131466:156724:-1 gene:ENSPMAG00000001293.1 transcript:ENSPMAT00000001427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 3.949e-28
Identity = 100/369 (27.10%), Postives = 166/369 (44.99%), Query Frame = 3
Query:  651 RGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPL-TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYR--------MALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQP----------YAENHIHAPNNGDIVRYVAEGLSCVMSVTSALY-HVANIVKQTFKSYVK 1697
            RG LGE  LH+ L+ ++++    A +L+   P L         Y GQT LH+A++N +  +V+ L+  G+ L + RA G+ F    G                   + +YGE+ +SFA   G+ E    L++ GA+   QD+ GN+VLH++V ++  EM R        +      C  + S+ N +G TPL LA +LG   +F+ ++     V W+   ++  VY L  +D+       D  S L  +  +  ++  +M++   V  LL  KW  +    F + +  Y+  ++V  +    RP   + P            E H       D VR + E ++ VM     LY  V  I+K   K+Y K
Sbjct:   35 RGELGETALHMALLCDSQD---AAMMLIHRIPPLLNQPITSDMYQGQTALHIAVMNQDVQMVRELLSCGADLHSPRATGSCFTSADG------------------SSCYYGEFVLSFAVCTGNGEIVRLLVKNGATLKAQDSLGNSVLHVLVQHHDAEMVRSMYDLLSELVQPDEWCQIE-SLANSEGYTPLKLAVALGDDAMFSYLVERRKKVYWTMGTISYTVYDLREIDTWG-----DQRSVLDIITSSSKKKVQSMIDLRPVKDLLNHKWNSFGFNYFLIWMFSYMFYVMVFTICCLYRPLKLIPPELSDNITIMALKEMHEAYSTKEDFVRLLGEIIT-VMGAAVILYLEVPYIIKIGPKNYCK 375          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.334e-8
Identity = 47/164 (28.66%), Postives = 78/164 (47.56%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIGSPL---TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVL 1268
            G TPLH A  +G++ +V++L++ G+P+   T+  L    +   G  ++       QY     D T      +  AA  G   +   L++KGA+PNV+   G T LHI    NR  +  + L++    A    +   GLTP+ ++A +G         NLN V++
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQ-VLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY---GASIEAVTESGLTPMHVSAFMG---------NLNIVLI 156          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.849e-8
Identity = 53/158 (33.54%), Postives = 70/158 (44.30%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQD---FGIWLDIGNPSRKQYYRQKLD----TTFYGEYPVSFAASVGDQESYDCLIEKGA--SPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKV 1232
            G+TPLHMA   G   +VK L+Q G+      +G    +D     I   +G     Q   Q+       T  G  P+ FA+  G  +    L+E GA  SP  +  F  T LHI     R E+  + L  Y  SAD  V   +GLTPL +A     QKV
Sbjct:  436 GETPLHMASRAGQLEVVKTLLQSGA-----RVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGF--TPLHIASKYGRLEVATLLLEKY-ASADPKVAGQNGLTPLHVATHYDHQKV 585          

HSP 2 Score: 50.447 bits (119), Expect = 1.935e-6
Identity = 41/157 (26.11%), Postives = 70/157 (44.59%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIGSPL---TRRALGTFFLQDFG-----IWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKV 1232
            G TPLH A  +G++ ++++L++  +P+   T+  L    +   G     + L +G  +         D T     P+  AA  G       L+++G  PN +   G T LHI    NR ++  + L+H    A        GLTP+ +A+ +G   V
Sbjct:  271 GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD------DVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKH---GASIHTTTESGLTPIHVASFMGHLNV 418          

HSP 3 Score: 48.9062 bits (115), Expect = 5.149e-6
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  786 GQTPLHMAIINGNKSLVKLLVQIG---SPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGE---YPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQ 1223
            G TPL+ A   G+  +  LL++ G   SP+T++      +      L++     ++Y     D    G+    P+  A     Q+    L++KGASP+     G T LHI    N+ E+ ++ L   +  A+++++   G+ PL LAA  G 
Sbjct:  502 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASA--DPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLL---ELGAETNMLTQQGVAPLHLAAQEGH 648          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO37108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ7])

HSP 1 Score: 224.557 bits (571), Expect = 3.587e-62
Identity = 179/643 (27.84%), Postives = 308/643 (47.90%), Query Frame = 3
Query:  336 YKYLNLQGNGKLI----DGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINIL-KCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQK------------LDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRK----FNLRLGFYITQLIVAGMALYLRPS-----GDLQPYAENHIHAPNNGDIVRYVA--EGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRIS-LFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITS--FDDVISTIVTIFQMTLGEFKKIVDLLFQLSSGPETSKV 2171
            Y  LN++ +G+LI      L  K  + V+++I   L  +M+++G G  VP   ++ K  +++  D+   SR S        D++                       VG  G +GEN+LH C +  T+ H  +  LL+ AYP +  D +   +Y+G+  LHMAI+NG+ +LV  L + G  + +RA G FF        D    SR+    Q+            L  T++GEYP+SFAA +G +++   L+ + A PN QD+ GNTVLH++VI+++    +++++  K      + N  G TPL LAA L + ++F+ I+  +  V W + N+T   +PL  LD+I   G V   S +  ++   + +HL +L +G+V  +L EKW+   + +    F L L  Y+  L++  +AL +RPS     G       N  ++  N    ++ A  E L+ + +++  +     +  Q  ++   GL Y+ +           + A++C L+   +       +TR + L K+E+   ++A+ L W   L +    +LTGP V MI ++L  D + F IIY I ++ F Q  ++         +    F    S+ + +  M+LGEF    D L QL       K+
Sbjct:   29 YDLLNVKNSGRLIVAYRKALATKDFTEVNELIA-SLKEYMYDDGNGRNVPIARLVHKRGLSREADVDKNSRPSLICLPRRKDTK----------------------RVGELGAVGENILHTCFLNATRTHFDLGMLLIKAYPKIINDIYTSDEYYGENCLHMAIVNGDLALVHFLCKNGIDIHQRACGAFFCP------DDQKSSREDCETQESVVLCTETNYQSLSNTYWGEYPLSFAACLGQEDTVKYLLHRRACPNKQDSNGNTVLHMMVIHDQ----KVSVKSVKYVLTLHIRNRQGFTPLTLAAKLARNEMFHHILTKSREVFWEYGNVTAAAFPLWELDTIGDQGQVIERSAINIIIHEDSHEHLELL-DGIVLNILTEKWKHGCRFRWGAMFFLLLCIYMMYLLIFSVALGIRPSDPSCAGKFVNVTTNITNSTGNWSYSKFRAVLEVLATIWAISYLVLIAVEMCHQGVRTVFWGLVYNPIRG---------LFAVSCALIPCCL-------ATRFACLQKVEDPLTVVALVLAWPYSLMFCKGFQLTGPYVVMIYQMLKRDFIIFFIIYGIFVIGFSQAMFLAVSGYLDDSVDEHMFARWFSSGLVLIIMSLGEFG---DPLVQLVESDSPYKI 618          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpv6 (transient receptor potential cation channel subfamily V member 5 [Source:NCBI gene;Acc:101169560])

HSP 1 Score: 154.836 bits (390), Expect = 1.565e-38
Identity = 135/509 (26.52%), Postives = 226/509 (44.40%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPL-TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT--------EMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFN--LRLGFYITQLIVAGMAL-YLRPSGDLQPYAENHIHAP--NNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
             RG LGE  LH+ ++    ++L  A  L+   P L  +      + G TPLH+A++N N +LV+ L+  G  + T R  G +F +  G                     +YGE+ +SFAA VG+++    LI+ GAS  VQD+ GNTVLH++V+  N+T         M R A        D  V NY GLTP  LAA  G   VF  ++N   V+ WS   L+  +Y LT +DS       D  S L  +V +   +   +LE   V +L+  KW LY K  F     + F++  L    +   Y +   D     +  +        D +R V E +S + +V      + ++++   K Y           +I + +  L++ +        VF        R+   + E   + + + L W  ++F+A   ++ GP V MI K++ GD+ +F  +  I ++ F    ++++       +  +     T+ + F+++LG     VD
Sbjct:   75 ERGALGETALHVAVI---NDNLDAAVALMDGAPELINEPMTSELFQGVTPLHIAVVNRNINLVQHLISRGGDVCTPRVTGLYFRKRIG------------------GLIYYGEHALSFAACVGNEDIVSMLIDAGASTRVQDSRGNTVLHLLVLQPNKTIACQTMDLIMARDAELDQPVPLD-MVTNYRGLTPFKLAAKEGNTVVFQHLVNKRRVIQWSLGPLSSHLYDLTEIDS-----RADNTSVLELIVASPRREARGVLEVTPVRQLVSLKWNLYGKHYFRYLFVMLFHLILLFFCDIPENYTKSDSDYTIKIQKTLKESYVTYSDSLRLVGEVISVLGAVLILFLEIPDMIRVGAKRYFGQTALGGPFHVILISYASLVVLLC-------VF--------RLCEVQGEAEVMALCLVLGWCNVMFFARGFEMLGPYVIMIQKIIFGDLTKFMWLSLIVLIGFSTSLWMVYMTQDPSSLPMYRSFPITLFSEFELSLGMIDLPVD 541          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpv6 (transient receptor potential cation channel subfamily V member 5 [Source:NCBI gene;Acc:101169560])

HSP 1 Score: 151.754 bits (382), Expect = 1.886e-37
Identity = 140/539 (25.97%), Postives = 235/539 (43.60%), Query Frame = 3
Query:  648 RRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPL-TRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVIN-NRT--------EMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRK----------FNLRLGFYITQLIVA---------GMALYLRPSGDLQPYAENHIHAPNN----------------GDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
             RG LGE  LH+ ++    ++L  A  L+   P L  +      + G TPLH+A++N N +LV+ L+  G  + T R  G +F +  G                     +YGE+ +SFAA VG+++    LI+ GAS  VQD+ GNTVLH++V+  N+T         M R A        D  V NY GLTP  LAA  G   VF  ++N   V+ WS   L+  +Y LT +DS       D  S L  +V +   +   +LE   V +L+  KW LY K            F+L L F+  +L++           +    RP  D+    EN+  + ++                 D +R V E +S + +V      + ++++   K Y           +I + +  L++ +        VF        R+   + E   + + + L W  ++F+A   ++ GP V MI K++ GD+ +F  +  I ++ F    ++++       +  +     T+ + F+++LG     VD
Sbjct:   75 ERGALGETALHVAVI---NDNLDAAVALMDGAPELINEPMTSELFQGVTPLHIAVVNRNINLVQHLISRGGDVCTPRVTGLYFRKRIG------------------GLIYYGEHALSFAACVGNEDIVSMLIDAGASTRVQDSRGNTVLHLLVLQPNKTIACQTMDLIMARDAELDQPVPLD-MVTNYRGLTPFKLAAKEGNTVVFQHLVNKRRVIQWSLGPLSSHLYDLTEIDS-----RADNTSVLELIVASPRREARGVLEVTPVRQLVSLKWNLYGKHYFRYLFVSLMLFHLILLFFCVRLLLFLYILYIGCFTLCCVFRPLKDI---PENYTKSDSDYTIKIQKTLKESYVTYSDSLRLVGEVISVLGAVLILFLEIPDMIRVGAKRYFGQTALGGPFHVILISYASLVVLLC-------VF--------RLCEVQGEAEVMALCLVLGWCNVMFFARGFEMLGPYVIMIQKIIFGDLTKFMWLSLIVLIGFSTSLWMVYMTQDPSSLPMYRSFPITLFSEFELSLGMIDLPVD 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpv4 (transient receptor potential cation channel subfamily V member 4 [Source:NCBI gene;Acc:101169862])

HSP 1 Score: 113.62 bits (283), Expect = 3.156e-25
Identity = 113/432 (26.16%), Postives = 184/432 (42.59%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIE---KGASPNVQDTFGNTVLHIVV-------INNR--TEMYRMAL----RHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKY----SALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIY 1982
            Y GQT LH+AI    K  V+LL++ G+ +  +A G FF            P  +  Y       ++GE P+S AA        + L E   K A    QD+ GNT LH +V        N R  T+MY + L    + Y       + N DGLTPL +AA LG+  VF  II                  W++  +   +Y L+ L++   + SV      + V ++R E    ML    +  LL+ KW+ +A   F + +  Y+  +I+  +  Y  P+    P+         + D +R V E    + ++ S ++     +K  F     G+K      +   + F+  + +I+  A  L G   ++                + ++ A+ L WM  L++   +KLTG    MI K+L+ DI RF ++Y
Sbjct:  259 YRGQTALHIAIERRCKHYVELLMEKGADVHAQARGRFF-----------EPKDEGGY------FYFGELPLSLAACTNQPNIVNYLTENPHKKADLRRQDSRGNTALHALVHIADNTKDNTRFLTKMYDLLLIKCTKLYPECNLEKMANNDGLTPLMMAAKLGKIGVFQHIIRREIKDEEVRHLSRKFKDWAYGPVYSSLYDLSSLETCGEEPSV----LEILVYNSRNENCHEMLAVEPINELLRAKWQKFAAVTFYISVVSYLITMIIFTLVAYYHPTEGKPPFPYT-----TSTDYLRMVGE----IFTLASGIFFFLTNIKDLFLKKRPGVKSLVMDGSFQLLYFIYSILIIITAALYLSGIKAYV----------------SVMVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILLKDIFRFLLVY 644          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpv4 (transient receptor potential cation channel subfamily V member 4 [Source:NCBI gene;Acc:101169862])

HSP 1 Score: 92.0485 bits (227), Expect = 1.225e-18
Identity = 100/410 (24.39%), Postives = 168/410 (40.98%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIE---KGASPNVQDTFGNTVLHIVV-------INNR--TEMYRMAL----RHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLN-----------TVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKY----SALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLT 1916
            Y GQT LH+AI    K  V+LL++ G+ +  +A G FF            P  +  Y       ++GE P+S AA        + L E   K A    QD+ GNT LH +V        N R  T+MY + L    + Y       + N DGLTPL +AA LG+  VF  II                  W++  +   +Y L+ L++   + SV      + V ++R E    ML    +  LL+ KW+ +A   F + +  Y+  +I+  +  Y  P+    P+         + D +R V E    + ++ S ++     +K  F     G+K      +   + F+  + +I+  A  L G   ++                + ++ A+ L WM  L++   +  +
Sbjct:  202 YRGQTALHIAIERRCKHYVELLMEKGADVHAQARGRFF-----------EPKDEGGY------FYFGELPLSLAACTNQPNIVNYLTENPHKKADLRRQDSRGNTALHALVHIADNTKDNTRFLTKMYDLLLIKCTKLYPECNLEKMANNDGLTPLMMAAKLGKIGVFQHIIRREIKDEEVRHLSRKFKDWAYGPVYSSLYDLSSLETCGEEPSV----LEILVYNSRNENCHEMLAVEPINELLRAKWQKFAAVTFYISVVSYLITMIIFTLVAYYHPTEGKPPFPYT-----TSTDYLRMVGE----IFTLASGIFFFLTNIKDLFLKKRPGVKSLVMDGSFQLLYFIYSILIIITAALYLSGIKAYV----------------SVMVFALVLGWMNTLYFTRGLNFS 565          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027385.1 (transient receptor potential cation channel subfamily V member 1 [Source:NCBI gene;Acc:101166237])

HSP 1 Score: 81.6481 bits (200), Expect = 1.923e-15
Identity = 122/486 (25.10%), Postives = 196/486 (40.33%), Query Frame = 3
Query:  780 YFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIE---KGASPNVQDTFGNTVLHIVV-----INNRTEMY-----RMALRHYKCSADSSVM-----NYDGLTPLALAASLGQQKVFNEIINL----NTVVLWSFSNLTCRVYPL-TGLDSINTDGSVDWNSTLMRVV-DARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACR-LVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLF-------KDIKAKGIT-----------SFDDVISTIVTIFQMTLG 2108
            Y GQT LH+AI   +  LVKLLVQ G+ +  +A GTFF  D           R  +Y        +GE P+S AA     +    L+E   + A    +D+ GNTVLH+++      +  TEM      ++ ++H K    S +      N  GLTPL LAA L +  +F  ++N         L S     C   P+ + L   ++  + + NS L  +V          M++   +  LLQ+KW  +A + F L   FY+  L +     + R  G      EN        D +R   E +S V+      Y    I  +    ++K L     SEI+F     L+L        G   ++     S  ++                WM +L+Y    K  G    M+ ++++ D+  F  +Y + +  F      L         D +A+G T           S++D+  T + +F+ T+G
Sbjct:  148 YKGQTALHVAIERRSLDLVKLLVQKGADVQAKASGTFFQND----------GRLGFY--------FGELPLSLAACTNQPDIVSFLMENPYRRADLTDKDSQGNTVLHVLITVADDTSETTEMISKIYDQILVKHNKIGEKSQIQLEEIENNQGLTPLKLAAKLSKIGLFRHMLNREFMDEETRLLSRKFTECVYGPVHSSLYDTSSIDTSECNSVLEIIVYGNEIPNRPEMIKLEPLRSLLQDKWERFASKLFLLNFLFYLIYLAILTTVAFYRKDGQPPFPVENR-----PSDYLRCAGELIS-VLGAVRLFYKTITIFHKN-PPHLKSLFTDGFSEILFFLQAALLLCCTLLYFCGRREYVSLLVLSLALA----------------WMNVLYYTRGSKQLGMYNVMMQRMILSDLFHFLFVYCVLLFGFSAAVVTLMDGSPTAHNDTQARGRTSLVETVLCNKPSYNDIGFTTLELFKFTIG 592          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000005887.1 (SMESG000005887.1)

HSP 1 Score: 1305.81 bits (3378), Expect = 0.000e+0
Identity = 632/635 (99.53%), Postives = 632/635 (99.53%), Query Frame = 3
Query:  231 MAFNATGYKADFNENGDFDDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVDLL 2135
            MAFNATGYKADFNENGDFDDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK  VD L
Sbjct:    1 MAFNATGYKADFNENGDFDDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKLQVDQL 635          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 392.119 bits (1006), Expect = 9.555e-121
Identity = 233/645 (36.12%), Postives = 353/645 (54.73%), Query Frame = 3
Query:  285 DDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQS---------EF------VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQD-------FGIWLDIGN----PSRKQYYRQKL--DTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKF---NLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTR---ISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK 2117
            DD   L+     R   +Y  +N  G GKL++    +G   + + + +E+  ++ NNG+G +V    + + +I +Y   S+  R+      +   S+  K + +  +  Y  +S         EF      VCW   +RG+ GE LLH+C M  T  H IIA++LL  +PN+ +D+FIG ++FGQT LH  II  +  +VKLLV  G  + +RALG FF          F I+ ++ N     +    +   +  D  ++GEYP+SFAA  G+QE YD L+E G  PNVQD  GNTVLH+VVI+NRT +YR AL+HYK  AD +V+N  GLTP+ L+A LG++ +F EII+LNT  LW + ++ C VYPL  LD+I+  G  DW+S+LM +++  ++ HL ML+ GVV +LL EKWR++  ++F    L + FY   ++VA     LR + +     E  +   +     RY  E +  V+ +     H+  + +Q    ++KGL  S L     +    ++L +  R+    +F     TS          +EE F++ A  L    LLF+    KLTGP VTMI K++ GD++RF  IY I +  F Q F+ LFKDI    IT+F     +++T+FQMT G+FK
Sbjct:   59 DDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARY---SITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATT---LRETKEESIALEPKMSFKHK---FRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQ--IFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFK 692          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.218e-120
Identity = 233/645 (36.12%), Postives = 353/645 (54.73%), Query Frame = 3
Query:  285 DDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQS---------EF------VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQD-------FGIWLDIGN----PSRKQYYRQKL--DTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKF---NLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTR---ISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK 2117
            DD   L+     R   +Y  +N  G GKL++    +G   + + + +E+  ++ NNG+G +V    + + +I +Y   S+  R+      +   S+  K + +  +  Y  +S         EF      VCW   +RG+ GE LLH+C M  T  H IIA++LL  +PN+ +D+FIG ++FGQT LH  II  +  +VKLLV  G  + +RALG FF          F I+ ++ N     +    +   +  D  ++GEYP+SFAA  G+QE YD L+E G  PNVQD  GNTVLH+VVI+NRT +YR AL+HYK  AD +V+N  GLTP+ L+A LG++ +F EII+LNT  LW + ++ C VYPL  LD+I+  G  DW+S+LM +++  ++ HL ML+ GVV +LL EKWR++  ++F    L + FY   ++VA     LR + +     E  +   +     RY  E +  V+ +     H+  + +Q    ++KGL  S L     +    ++L +  R+    +F     TS          +EE F++ A  L    LLF+    KLTGP VTMI K++ GD++RF  IY I +  F Q F+ LFKDI    IT+F     +++T+FQMT G+FK
Sbjct:   63 DDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARY---SITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATT---LRETKEESIALEPKMSFKHK---FRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQ--IFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFK 696          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000039339.1 (SMESG000039339.1)

HSP 1 Score: 259.996 bits (663), Expect = 3.043e-74
Identity = 188/626 (30.03%), Postives = 315/626 (50.32%), Query Frame = 3
Query:  336 YKYLNLQGNGKLIDGLR----NKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYV--DLSLRSRNSGKETQLPP-----DSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTT-----FYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADS----SVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQ-PYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKY--SALSEIIFLGH-LFL--ILAMACRLVGFI-VFIVSKSTSTR-ISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKKIVD 2129
            +KYL++ G G+  + ++     K    + + I + L+ +++NNG+G LV    +++    K    D    ++NS   T  P      +    +E    I   Y      VCW++ +RG +GE LL  C +  T  H  +A+ ++  +P L  DY++  +Y+G++ LH+AI N + ++VK L+  G+ + +R  G FFL +        N    +     ++T      ++GE P+SFAA  G +E    LI KGA   +QD  GNT LH++VI+ +     +ALR +    D      + N  GLTPL LAA LG+++++  I  L   V W + N+ C   PL  LD+I+ DG+++ NS LM +V     +HL ML EG++  LL EKW    K++F +    +    ++  +A  LRP  D    +    I   NN  IV+   +   C +  T     +  +V +     +  L Y  SAL E+ + GH +F+  +++   +L+  I  FI+      R +   + E+   ++A+       LFY    +L GP V MI K++ GD++RF IIY I +L F Q  YV+F+ +     + F + +  ++ +F M+LGEF+ I +
Sbjct:   24 FKYLDVSGAGEFFEMMKICNKTKQYDQMDKKIYEYLSPYLYNNGEGKLVSVDELVRYRSGKSTEKDKKKNTKNSKHNTIYPELQIIREDENGRENPPIINPLYRE----VCWDIDQRGPVGETLLLFCFLSATSTHYDLAKRIIKIFPKLINDYYMSEEYYGESVLHIAISNEDPAMVKYLLDHGANVNQRCFGNFFLPE-DQKHTFTNIENSELLNLTVETNYEGHVYWGESPLSFAACCGQEECVRLLIAKGADLFMQDHNGNTALHMLVIHIKKMDINIALRMFDLLVDKGARLDMKNRFGLTPLTLAAKLGRKEMYQHIQILEREVHWKYGNVVCAACPLNELDTISCDGTINHNSALMHIVYGEEPEHLDML-EGIISHLLHEKWNSCVKKRFFINFFLFFIYFLIFTVAFALRPGEDPNLNWQTAVIVDGNNKIIVQNQTDKNRCYLLSTQRTEDIIRLVLELI-VVICALMYICSALREVYYQGHKIFMKTLMSAPMKLLHLISCFIIMLMIPGRAVCNPEYEDVMGVMAILSTAPHFLFYCRGFRLVGPFVVMIYKMVRGDLLRFFIIYIIFLLGFSQAMYVVFRRVNE---SLFHEPLEALMGMFIMSLGEFEDIYE 639          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 227.254 bits (578), Expect = 1.352e-63
Identity = 130/347 (37.46%), Postives = 197/347 (56.77%), Query Frame = 3
Query: 1095 IVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKF---NLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTR---ISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFK 2117
            +VVI+NRT +YR AL+HYK  AD +V+N  GLTP+ L+A LG++ +F EII+LNT  LW + ++ C VYPL  LD+I+  G  DW+S+LM +++  ++ HL ML+ GVV +LL EKWR++  ++F    L + FY   ++VA     LR + +     E  +   +     RY  E +  V+ +     H+  + +Q    ++KGL  S L     +    ++L +  R+    +F     TS          +EE F++ A  L    LLF+    KLTGP VTMI K++ GD++RF  IY I +  F Q F+ LFKDI    IT+F     +++T+FQMT G+FK
Sbjct:    1 MVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATT---LRETKEESIALEPKMSFKHK---FRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQ--IFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFK 339          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPV64.463e-4526.88transient receptor potential cation channel subfam... [more]
TRPV65.015e-4526.88transient receptor potential cation channel subfam... [more]
TRPV65.440e-4526.88transient receptor potential cation channel subfam... [more]
TRPV51.946e-4227.68transient receptor potential cation channel subfam... [more]
TRPV51.946e-4227.68transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osm-91.342e-10633.54Olfactory channel [Source:UniProtKB/TrEMBL;Acc:G5... [more]
ocr-14.923e-6627.74Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-41.102e-6326.36Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-32.700e-6326.90Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-25.972e-5127.26Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iav1.115e-10732.71gene:FBgn0086693 transcript:FBtr0070969[more]
nan6.880e-6826.33gene:FBgn0036414 transcript:FBtr0321258[more]
nan9.154e-6826.33gene:FBgn0036414 transcript:FBtr0089524[more]
Ank23.820e-730.20gene:FBgn0261788 transcript:FBtr0334062[more]
Ank26.317e-730.00gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv61.302e-3325.43transient receptor potential cation channel, subfa... [more]
trpv61.500e-3325.43transient receptor potential cation channel, subfa... [more]
trpv61.500e-3325.43transient receptor potential cation channel, subfa... [more]
trpv61.077e-3225.43transient receptor potential cation channel, subfa... [more]
trpv42.422e-2824.74transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm191.672e-3927.96RNA binding motif protein 19 [Source:Xenbase;Acc:X... [more]
rbm199.889e-3928.07RNA binding motif protein 19 [Source:Xenbase;Acc:X... [more]
tulp28.340e-3825.64TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991... [more]
rbm191.279e-3727.47RNA binding motif protein 19 [Source:Xenbase;Acc:X... [more]
tulp29.099e-3425.96TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpv62.617e-4728.30transient receptor potential cation channel, subfa... [more]
Trpv62.764e-4728.30transient receptor potential cation channel, subfa... [more]
Trpv52.289e-4428.27transient receptor potential cation channel, subfa... [more]
Trpv52.246e-3126.38transient receptor potential cation channel, subfa... [more]
Trpv12.250e-2625.09transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91WD2|TRPV6_MOUSE1.831e-4628.30Transient receptor potential cation channel subfam... [more]
sp|Q9R186|TRPV6_RAT3.971e-4627.79Transient receptor potential cation channel subfam... [more]
sp|Q9H1D0|TRPV6_HUMAN2.408e-4426.88Transient receptor potential cation channel subfam... [more]
sp|Q9JIP0|TRPV5_RAT1.502e-4328.49Transient receptor potential cation channel subfam... [more]
sp|P69744|TRPV5_MOUSE1.601e-4328.27Transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DQR13.107e-13736.39ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GDK82.069e-13636.39ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A2T7NVZ75.707e-11634.83ANK_REP_REGION domain-containing protein OS=Pomace... [more]
A0A267EZD33.038e-11438.36ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267H5B13.935e-11338.55ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv62.982e-3727.13transient receptor potential cation channel subfam... [more]
trpv63.555e-3727.13transient receptor potential cation channel subfam... [more]
trpv41.946e-2326.39transient receptor potential cation channel, subfa... [more]
trpv14.156e-2023.61transient receptor potential cation channel, subfa... [more]
trpv11.458e-1924.00transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv63.726e-3225.43transient receptor potential cation channel, subfa... [more]
ENSPMAT00000007740.11.384e-3029.19pep scaffold:Pmarinus_7.0:GL478934:8361:25408:-1 g... [more]
ENSPMAT00000001427.13.949e-2827.10pep scaffold:Pmarinus_7.0:GL477062:131466:156724:-... [more]
ENSPMAT00000007446.11.334e-828.66pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000095.13.849e-833.54pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO371083.587e-6227.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv61.565e-3826.52transient receptor potential cation channel subfam... [more]
trpv61.886e-3725.97transient receptor potential cation channel subfam... [more]
trpv43.156e-2526.16transient receptor potential cation channel subfam... [more]
trpv41.225e-1824.39transient receptor potential cation channel subfam... [more]
ENSORLT00000027385.11.923e-1525.10transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005887.10.000e+099.53SMESG000005887.1[more]
SMESG000004138.19.555e-12136.12SMESG000004138.1[more]
SMESG000004138.11.218e-12036.12SMESG000004138.1[more]
SMESG000039339.13.043e-7430.03SMESG000039339.1[more]
SMESG000004138.11.352e-6337.46SMESG000004138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030225 ID=SMED30030225|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2874bp
TAATCATCGCCAATGTTTGTCGAATATCAAATGTTTATTATCTTTATATT
CGATACACACCCATACACACAAACAAATTAGCAAATCTAATGAATGTATT
AAACAAATAATTCCTGTGGAAAATTCCATCAATTTAATCAACAGAGAATA
TTGAGTTCAATTGTTTTGATAATTGATATTTCCCCCATTTTCAATACCGA
AATTTTTAAAATTGAATTTAAATTTTAAGAATGGCTTTTAATGCCACCGG
CTACAAGGCAGATTTCAATGAGAATGGAGATTTCGACGACAGTTATCTAT
TGCAACTGGGAATGGCTCAACGGAAAAACCTCATGTATAAATATCTCAAC
CTTCAAGGAAATGGCAAACTGATTGATGGGCTTCGAAACAAAGGGGTTTC
TCATGTCCATCAGGTCATTGTGGACGAGCTGGCGTCTTTTATGCATAACA
ATGGTAAAGGAACCTTAGTACCAACGATTAATATTTTAAAATGCTCAATC
ACGAAATATGTTGATCTTTCTTTGAGGAGTCGAAATTCGGGGAAGGAAAC
ACAACTGCCTCCTGATTCTCGTGCTATTAAAGAAATGGTCCAAACAATAC
AGAGTAGATACGAGGGACAATCAGAATTCGTATGCTGGGAAGTTGGAAGG
CGAGGAATCCTTGGTGAAAATCTACTTCATATCTGCTTAATGTTAAATAC
AAAAGAACATCTCATTATTGCGCGGCTACTTTTACTTGCTTATCCGAACC
TTTGTAAAGACTATTTCATTGGAAGCCAATATTTCGGTCAGACTCCTCTC
CACATGGCTATAATTAATGGAAATAAATCCTTGGTAAAGTTACTGGTGCA
AATCGGCTCACCGTTAACTCGACGGGCTTTGGGTACATTTTTCCTTCAAG
ATTTTGGTATATGGTTGGATATTGGAAACCCATCTAGAAAACAGTATTAC
AGACAAAAACTAGATACAACATTCTACGGGGAGTATCCAGTGTCTTTTGC
TGCTTCGGTCGGGGATCAGGAATCCTATGACTGCCTTATTGAAAAAGGAG
CAAGCCCAAATGTCCAGGATACATTTGGAAATACCGTTTTACATATTGTT
GTTATTAATAATAGAACAGAAATGTACCGGATGGCATTACGCCATTACAA
GTGTTCAGCAGATTCTTCCGTCATGAATTATGACGGTCTGACTCCTCTAG
CTCTAGCAGCAAGTCTTGGACAACAAAAAGTTTTCAATGAAATTATTAAT
TTAAATACCGTGGTTCTGTGGAGTTTCAGTAATCTCACTTGTAGGGTATA
CCCCTTAACTGGATTAGACAGCATTAACACTGATGGATCCGTTGATTGGA
ATTCAACATTAATGAGGGTAGTTGATGCCAGAACTGAACAGCATTTGGCA
ATGTTAGAGGAAGGGGTAGTTTATCGGCTTCTTCAGGAAAAATGGAGGCT
ATACGCAAAAAGGAAATTCAACTTGAGATTAGGATTTTATATTACTCAAT
TGATTGTTGCTGGAATGGCTCTTTATTTGCGCCCATCCGGCGATTTGCAG
CCGTATGCAGAAAATCACATTCATGCTCCAAATAATGGTGACATTGTCCG
ATACGTCGCAGAGGGGTTGTCATGTGTCATGTCAGTCACAAGTGCCTTGT
ACCATGTTGCAAATATTGTCAAACAAACATTCAAGAGTTACGTTAAAGGC
TTAAAATACAGCGCGTTATCTGAAATTATATTCCTCGGCCATCTGTTTCT
TATTTTAGCAATGGCATGTCGGCTAGTTGGGTTTATCGTATTCATTGTAA
GTAAATCGACCAGCACAAGAATATCGCTTTTTAAACTTGAAGAAGCTTTC
ATAATAATTGCGGTGCCTTTATTGTGGATGGGACTGTTGTTTTATGCCAG
TGCAATAAAACTGACTGGTCCATGTGTAACTATGATCATCAAGCTTTTAG
TTGGAGACATCGTCAGATTCAGCATTATATACAGCATTGCAATACTTTTG
TTTGGACAAGTTTTCTATGTGTTGTTTAAAGACATCAAAGCAAAGGGAAT
AACGTCATTCGATGATGTCATATCTACGATCGTGACCATATTTCAAATGA
CACTTGGTGAATTCAAGAAAATAGTCGATCTTCTATTTCAGTTATCTAGT
GGGCCTGAGACATCCAAGGTAAGCAGAAAAAACTGTCGCTTTCCCCTTCT
AAATCGCTTAAAGCGAATTTAATTTTTTTGTCATTTAGAGCTTTTTGTTA
TTTTGTAAATTTTGCTTATACATTTCTTTATACTGTCGGATATTTTCAGC
TTTAGATATTTCATTTATCTTTCGCTAGTAATTGATAAATCATTGTTTAG
TACAATTTTTATTTTTTGTCATTTTGTATTTTATTCGTCAAGGATATAAT
AAATTATATTAGAAATCCGATTTCCACACAATGCAAGAAAGATGCAAAAA
ACATAAATTTATCTGTGAAAATCGCACAGATTCCTCATTTTTGGGATCAC
CATGGAAACAGTTCTGAGAATTTCTTAGATAAGATAATACAAATGAATTC
CTTTTATTATATGGAACAGTACTGATCAGAATATACTTTTATTCTTTATT
CACCAGTCTGGGCACCTGTTATAGTTTACTATTAATGCGAAATTGAATTT
TATAACGTAGGTTGTCTGGAACTGGCAGTCTCTAATAAAAAAACTGTACA
TGGAAAAAATACATGTCAATTATAATATAAAGAATTCAATCAGGATTTCC
ATGAAATTGGGAGCCAAAATTATTTATTAATTATATTTGAAAGTGATGAA
GTATTTGATTTTAATATTTTAAATTAATTTTGAAAATAATTAATAAATAA
TATTTTTCTTATCATAAATGGTGG
back to top

protein sequence of SMED30030225-orf-1

>SMED30030225-orf-1 ID=SMED30030225-orf-1|Name=SMED30030225-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MAFNATGYKADFNENGDFDDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDG
LRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRS
RNSGKETQLPPDSRAIKEMVQTIQSRYEGQSEFVCWEVGRRGILGENLLH
ICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKS
LVKLLVQIGSPLTRRALGTFFLQDFGIWLDIGNPSRKQYYRQKLDTTFYG
EYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYR
MALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFS
NLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRL
LQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAP
NNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEII
FLGHLFLILAMACRLVGFIVFIVSKSTSTRISLFKLEEAFIIIAVPLLWM
GLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFK
DIKAKGITSFDDVISTIVTIFQMTLGEFKKIVDLLFQLSSGPETSKVSRK
NCRFPLLNRLKRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR024862TRPV
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 249..278
e-value: 62.0
score: 12.5
coord: 185..214
e-value: 2.1E-4
score: 30.6
coord: 282..312
e-value: 170.0
score: 10.7
coord: 144..176
e-value: 1100.0
score: 4.8
coord: 318..347
e-value: 160.0
score: 11.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 185..217
score: 11.434
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 249..281
score: 9.564
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 144..212
e-value: 1.4E-6
score: 28.8
coord: 256..339
e-value: 2.3E-8
score: 34.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 185..340
score: 19.837
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 113..393
e-value: 2.8E-53
score: 183.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 139..340
NoneNo IPR availablePANTHERPTHR10582:SF28NANCHUNG, ISOFORM Bcoord: 31..632
NoneNo IPR availableTMHMMTMhelixcoord: 540..562
NoneNo IPR availableTMHMMTMhelixcoord: 413..432
NoneNo IPR availableTMHMMTMhelixcoord: 577..599
NoneNo IPR availableTMHMMTMhelixcoord: 499..521
IPR024862Transient receptor potential cation channel subfamily VPANTHERPTHR10582TRANSIENT RECEPTOR POTENTIAL ION CHANNEL PROTEINcoord: 31..632