Helicase for meiosis 1

Overview
NameHelicase for meiosis 1
Smed IDSMED30030220
Length (bp)5281
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Helicase for meiosis 1 (SMED30030220) t-SNE clustered cells

Violin plots show distribution of expression levels for Helicase for meiosis 1 (SMED30030220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Helicase for meiosis 1 (SMED30030220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Helicase for meiosis 1 (SMED30030220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030220SMESG000065404.1 SmedASXL_017196SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30030220SMESG000065400.1 SMESG000065396.1 SmedASXL_014090SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
anterior sideSMED30030220SMESG000065400.1 SMESG000065396.1 dd_Smed_v4_24408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30030220SMESG000065404.1 dd_Smed_v6_9538_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30030220SMESG000065404.1 Contig39646newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030220SMESG000065404.1 Contig39646uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30030220SMESG000065404.1 dd_Smed_v4_9538_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Match: HFM1 (helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGNC:20193])

HSP 1 Score: 183.726 bits (465), Expect = 1.799e-103
Identity = 103/294 (35.03%), Postives = 163/294 (55.44%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDS--MLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYL 1715
            ++ I+ C E  +I LR  E+  +N LNK      +RFP++GRI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D+   +++    +  L++  +L KCF  KLW+N+  VS Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +     P+YEL +EQI        +  + VT + +  +Q +     R  +DS  + LIIGD +N V Y  +I +  L+ +  W  +I V R  +   L I+LIS   VG DI+ K    YL
Sbjct:  810 VTLIAGCKEFLDIQLRINEKKTLNTLNKDPNRITIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRITRWLSDF---VAAQEKKFAVLLNSLILAKCFRCKLWENSLHVSKQLEKIGITLSNAIVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELKVEQITRYSD--TTAEILVTVILRNFEQLQTK---RTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYL 1095          

HSP 2 Score: 139.813 bits (351), Expect = 1.799e-103
Identity = 66/138 (47.83%), Postives = 91/138 (65.94%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT 414
            FC TRK   Q A  LV   +F +  +Q  +L   +  + + KLR  +  G  +HHAG+   DR++VE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++   + + Y++  +LQMIGRAGRPQFD +A A+I+T
Sbjct:  533 FCATRKGVQQAASVLVKDAKFIMTVEQKQRLQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGLFEEYSETDILQMIGRAGRPQFDTTATAVIMT 670          

HSP 3 Score: 97.8265 bits (242), Expect = 1.799e-103
Identity = 50/121 (41.32%), Postives = 77/121 (63.64%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++   +WI+S+ LYIR  +NP++YG  +G   + I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL+ LV
Sbjct:  691 SLHRHLIEHLNAEIVLHTITDVNIAVEWIRSTLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIKMDEGVN-FKPTEAGRLMAWYYITFETVKKFYTISGKETLSDLV 810          
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Match: HFM1 (helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGNC:20193])

HSP 1 Score: 142.124 bits (357), Expect = 3.220e-38
Identity = 90/294 (30.61%), Postives = 138/294 (46.94%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDS--MLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYL 1715
            ++ I+ C E  +I LR  E+  +N LNK      +RFP++GRI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI RC+                                                ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +     P+YEL +EQI        +  + VT + +  +Q +     R  +DS  + LIIGD +N V Y  +I +  L+ +  W  +I V R  +   L I+LIS   VG DI+ K    YL
Sbjct:   66 VTLIAGCKEFLDIQLRINEKKTLNTLNKDPNRITIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRITRCI-----------------------------------------------TLSNAIVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELKVEQITRYSD--TTAEILVTVILRNFEQLQTK---RTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYL 307          

HSP 2 Score: 39.2762 bits (90), Expect = 3.220e-38
Identity = 23/66 (34.85%), Postives = 38/66 (57.58%), Query Frame = 2
Query:  593 IPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL+ LV
Sbjct:    2 IEAKLQELCLKNLNDLSSLDLIKMDEGVN-FKPTEAGRLMAWYYITFETVKKFYTISGKETLSDLV 66          
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Match: SNRNP200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:HGNC Symbol;Acc:HGNC:30859])

HSP 1 Score: 89.3521 bits (220), Expect = 8.993e-30
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  773 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 875          

HSP 2 Score: 48.9062 bits (115), Expect = 8.993e-30
Identity = 28/109 (25.69%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSIC--EAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
             L + LNAEI L  + +      W+  ++LYIR+ R+P  YG+    +     + Q  + L+ +    L   +L+ +D+ T   + T  G + + Y++   T+Q   +L
Sbjct:  896 KLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQL 1004          

HSP 3 Score: 35.039 bits (79), Expect = 8.993e-30
Identity = 39/184 (21.20%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FP+ EL++
Sbjct: 1019 SLSSEFKNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK----RMWQSMCPLRQFRKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHLFPKLELSV 1188          

HSP 4 Score: 78.5666 bits (192), Expect = 1.567e-18
Identity = 41/116 (35.34%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            +K+S+  L+  ++ GVG+ H GL  ++R +VE  F  GA+ V+ ++ +L  G+N+ AHLV+I  T  +N  I     Y    +LQM+G A RP Q D     I+   S+++F  +F
Sbjct: 1602 EKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKF 1717          

HSP 5 Score: 36.5798 bits (83), Expect = 1.567e-18
Identity = 24/101 (23.76%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  449 EHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+   +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1734 DHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGISHRHLSDHLSELVEQTLSDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1830          
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Match: SNRNP200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:HGNC Symbol;Acc:HGNC:30859])

HSP 1 Score: 85.8853 bits (211), Expect = 1.395e-28
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  773 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 875          

HSP 2 Score: 49.2914 bits (116), Expect = 1.395e-28
Identity = 28/108 (25.93%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSIC--EAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  + +      W+  ++LYIR+ R+P  YG+    +     + Q  + L+ +    L   +L+ +D+ T   + T  G + + Y++   T+Q   +L
Sbjct:  897 LPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQL 1004          

HSP 3 Score: 34.2686 bits (77), Expect = 1.395e-28
Identity = 39/184 (21.20%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FP+ EL++
Sbjct: 1019 SLSSEFKNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK----RMWQSMCPLRQFRKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHLFPKLELSV 1188          
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Match: ASCC3 (activating signal cointegrator 1 complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:18697])

HSP 1 Score: 83.5741 bits (205), Expect = 5.344e-26
Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            Q+   +++R     G   HHAG+ + DR +VE+ F  G + VL  T+TL+ GVNLPAH V+IKGT        Q Y   +          ++Q+ GRAGRPQFD     II+T+ ++
Sbjct:  764 QRSRNKQVRELFPDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGT--------QIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDK 872          

HSP 2 Score: 56.6102 bits (135), Expect = 5.344e-26
Identity = 31/109 (28.44%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGS--ICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            +L ++LNAEIAL  + +++   KWI  ++LY+R+  NP  YG+   +  I   + +   +L+I    KL    +I  ++ T    +T  G   + Y++ + TI+   +L
Sbjct:  893 SLADNLNAEIALGTVTNVEEAVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRKLDKAQMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNEL 1001          

HSP 3 Score: 100.908 bits (250), Expect = 3.213e-25
Identity = 56/150 (37.33%), Postives = 87/150 (58.00%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +  +L  FL   +  +  L  D+     +I+  + +  L+  +  G+G HHAGL + DR+ VE  F+   + VL +TSTL+ GVN PAHLV+IKGT  ++    +   +    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1568 TRLTALELIAFLATEEDPKQWLNMDEREMENIIA-TVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1716          

HSP 4 Score: 36.965 bits (84), Expect = 3.213e-25
Identity = 26/102 (25.49%), Postives = 49/102 (48.04%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSIC-EAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +  G +  +++ + +  LI   + +L     I   +    IE    G + + Y+L  QT++
Sbjct: 1731 LSDHLNAEIAGGTITSKQDALDYITWTYFFRRLIMNPSYYNL--GDVSHDSVNKFLSHLIEKSLIELELSYCIEIGEDNRSIEPLTYGRIASYYYLKHQTVK 1830          
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14754622:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 99.7525 bits (247), Expect = 1.914e-32
Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 1
Query:  112 ISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAII-LTSSEEEFAHQF 444
            I +E L+  +  G+G HHAGL   +R IVE  F+   + VL +T+TL+ G+N PAHLV++KGT  F+    +   +    +LQM+GRAGRPQFD+SAVA+I +  +++ F  +F
Sbjct: 1459 IKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKF 1572          

HSP 2 Score: 60.8474 bits (146), Expect = 1.914e-32
Identity = 34/105 (32.38%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRK 757
            L  H+NAEI+   +    +I +++  ++LY R+F NP YYG+   S  EA+ + I K++   V +L     I+ D   + I+ TPCG + + Y+L  +T++ + K
Sbjct: 1587 LPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSE-EAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVK 1690          

HSP 3 Score: 92.4337 bits (228), Expect = 1.598e-27
Identity = 48/97 (49.48%), Postives = 66/97 (68.04%), Query Frame = 1
Query:  145 RGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLL---QMIGRAGRPQFDNSAVAIILTSSEE 426
            RG+G HHAGLC+ DR ++E  F  G + VL  T+TL+ GVNLPAH VVIKGT  F++  +  +T   +L   Q+ GRAGRPQF+N    II+T+ ++
Sbjct:  617 RGMGIHHAGLCRQDRILMERCFAEGHVSVLFCTATLAWGVNLPAHAVVIKGTDVFDAE-KGVFTDLGVLDVQQIFGRAGRPQFENEGHGIIITTRDK 712          

HSP 4 Score: 51.9878 bits (123), Expect = 1.598e-27
Identity = 28/108 (25.93%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  431 LHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQI---IMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
             +  L ++LNAE+AL  +  +D   +W+  +++Y R  +NP  YG+   +I E  P +      +I     +L    +I  D  T  + +T  G + + +++ ++TIQ
Sbjct:  730 FYARLHDNLNAEVALGTVSTVDEGVEWLTYTYMYTRALKNPMAYGIAYNAI-ERDPNLRDHFGNVIREAAMQLDQNKMIRFDMATEYLNSTDLGRIASNFYVKYETIQ 836          
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14768462:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 99.7525 bits (247), Expect = 2.484e-32
Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 1
Query:  112 ISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAII-LTSSEEEFAHQF 444
            I +E L+  +  G+G HHAGL   +R IVE  F+   + VL +T+TL+ G+N PAHLV++KGT  F+    +   +    +LQM+GRAGRPQFD+SAVA+I +  +++ F  +F
Sbjct:  741 IKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKF 854          

HSP 2 Score: 60.4622 bits (145), Expect = 2.484e-32
Identity = 33/101 (32.67%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L  H+NAEI+   +    +I +++  ++LY R+F NP YYG+   S  EA+ + I K++   V +L     I+ D   + I+ TPCG + + Y+L  +T++
Sbjct:  869 LPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSE-EAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVR 968          

HSP 3 Score: 52.373 bits (124), Expect = 3.514e-6
Identity = 28/108 (25.93%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  431 LHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQI---IMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
             +  L ++LNAE+AL  +  +D   +W+  +++Y R  +NP  YG+   +I E  P +      +I     +L    +I  D  T  + +T  G + + +++ ++TIQ
Sbjct:   12 FYARLHDNLNAEVALGTVSTVDEGVEWLTYTYMYTRALKNPMAYGIAYNAI-ERDPNLRDHFGNVIREAAMQLDQNKMIRFDMATEYLNSTDLGRIASNFYVKYETIQ 118          
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Match: snrp-200 (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase [Source:UniProtKB/Swiss-Prot;Acc:Q9U2G0])

HSP 1 Score: 88.9669 bits (219), Expect = 9.179e-30
Identity = 55/153 (35.95%), Postives = 85/153 (55.56%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKI----SEE----KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQ---NKLLQMIGRAGRPQFDNSAVAIILTSSEE 426
            F  +RK T + AK + D    +       + G  S +I    +E+     L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT  +N   +  +T+     ++QM+GRAGRPQ+D+    I++T+  E
Sbjct:  717 FVHSRKETAKTAKAIRDACLEKDTLSAFMREGSASTEILRTEAEQAKNLDLKDLLPYGFAIHHAGMNRVDRTLVEDLFADRHIQVLFSTATLAWGVNLPAHTVIIKGTQIYNPE-KGRWTELGALDIMQMLGRAGRPQYDDRGEGILITNHSE 868          

HSP 2 Score: 51.2174 bits (121), Expect = 9.179e-30
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMK---LIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAE+ L  +  +     W+  +FL++R+ +NP  YG+ T     A P +  +   LI +    L    LI +D+ +  I+ T  G + + ++  ++++Q   KL
Sbjct:  890 LTDMLNAEVVLGTVSSVSEATNWLGYTFLFVRMLKNPTLYGI-THEQARADPLLEQRRADLIHTACVLLDKAGLIKYDKRSGIIQATELGRIASHFYCTYESMQTYNKL 997          

HSP 3 Score: 31.9574 bits (71), Expect = 9.179e-30
Identity = 40/183 (21.86%), Postives = 74/183 (40.44%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINS--VMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELT 1394
            S  SE   +++R  E+  +  + +H  P     P+K  +  AS K + L+Q  +  L+++  +L  +   + +   R+ R + + +          + L  C    K    + W  +    HQ  +I S  V ++   N  F  L  +   Q       L K P  G+ + K    FP+ E+T
Sbjct: 1012 SMSSEFKLLSVRDEEKLELQKMAEH-AP----IPIKENLDEASAKTNVLLQAYISQLKLEGFALQADMVFVAQSAGRLFRALFEIVLWRGWAGLAQKVLTLC----KMVTQRQW-GSLNPLHQFKKIPSEVVRSIDKKNYSFDRLYDLDQHQL----GDLIKMPKMGKPLFKFIRQFPKLEMT 1180          

HSP 4 Score: 54.6842 bits (130), Expect = 3.806e-12
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  112 ISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNS--NIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL-TSSEEEFAHQF 444
            I +E LR  +  GVGF H G    D  IV+  F   A+ V      +   + + A+LVV+  T  +N   ++ + Y    +L M+G A RP  D+ A  +++  +S+  +  +F
Sbjct: 1603 IEDESLRESVSCGVGFLHEGTAPKDVHIVQQLFESNAIQVCVVPRGMCYQIEMSAYLVVVMDTQFYNGKYHVYEDYPIADMLHMVGLANRPILDSDAKCVVMCQTSKRAYYKKF 1716          

HSP 5 Score: 37.7354 bits (86), Expect = 3.806e-12
Identity = 24/103 (23.30%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  + LY R+ +NP YY +  G+    +   + +L+   +  L N   I    + ++++T     G++ + Y++ +QTI+
Sbjct: 1731 LHDHFNAEIVTKTIENKQDAIDYLTWTLLYRRMTQNPNYYNL-QGTTHRHLSDALSELVELTLKDLENSKCI---AVKDEMDTVSLNLGMIASYYYISYQTIE 1829          
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Match: helq-1 (HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q65XX0])

HSP 1 Score: 83.1889 bits (204), Expect = 6.098e-16
Identity = 44/102 (43.14%), Postives = 63/102 (61.76%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAI-ILTSSEEE 429
            L+ CI+ GV +HH+GL Q +R+ VE++F+ G + V+C+TSTL+ GVNLP   V+IK        + +     + LQM GRAGR  FD     I I+ + EEE
Sbjct:    5 LKQCILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRVIIKAPMVGRERLGKA----QYLQMAGRAGRAGFDTKGDCITIIKAGEEE 102          
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Match: helq-1 (HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q65XX0])

HSP 1 Score: 82.8037 bits (203), Expect = 1.750e-15
Identity = 44/102 (43.14%), Postives = 63/102 (61.76%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAI-ILTSSEEE 429
            L+ CI+ GV +HH+GL Q +R+ VE++F+ G + V+C+TSTL+ GVNLP   V+IK        + +     + LQM GRAGR  FD     I I+ + EEE
Sbjct:  459 LKQCILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRVIIKAPMVGRERLGKA----QYLQMAGRAGRAGFDTKGDCITIIKAGEEE 556          
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Match: l(3)72Ab (gene:FBgn0263599 transcript:FBtr0075527)

HSP 1 Score: 93.2041 bits (230), Expect = 4.385e-32
Identity = 45/110 (40.91%), Postives = 68/110 (61.82%), Query Frame = 1
Query:  103 SQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            ++++   +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT  +N    +    + L  LQM+GRAGRPQ+D     I++T+  E
Sbjct:  766 AEQVKNTELKELLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELSALDVLQMLGRAGRPQYDTKGEGILITNHSE 875          

HSP 2 Score: 51.6026 bits (122), Expect = 4.385e-32
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIP---QIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  +  +     W+  ++LYIR+ RNP  YGV   +I +A P   Q    L+ +    L    LI +D+ T   + T  G + + Y+L  +T+    +L
Sbjct:  897 LPDMLNAEIVLGTVQHLQDAVNWLGYTYLYIRMLRNPTLYGVSHDAI-KADPLLEQHRADLLHTAACCLERSGLIKYDRKTGHFQVTDLGRIASHYYLTHETMLTYNQL 1004          

HSP 3 Score: 35.8094 bits (81), Expect = 4.385e-32
Identity = 36/181 (19.89%), Postives = 82/181 (45.30%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELT 1394
            S  SE   I++R  E+  +  L +     ++  P+K  I   S K++ L+Q  +  L+++  +L  +   I +   R++R + + +          +TL  C ++ +    ++W +   +  Q  ++   +A +L    F    R+ + +   +  ++ + P  G+T+ K    FP+ EL+
Sbjct: 1019 SLSSEFRHISVREEEKLELQKLME-----RVPIPIKESIEEHSAKVNVLLQAYISQLKLEGFALMSDMVFITQSAARLMRAIFEIVLTRGWAQLADKTLTLCKMIDR----RMWQSMTPL-RQFKKMPDEIAKKLEKKHFP-WGRLYDLEPHELGELI-RVPKLGKTIHKFVHQFPKLELS 1187          

HSP 4 Score: 69.3218 bits (168), Expect = 1.597e-16
Identity = 38/116 (32.76%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFN--SNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL-TSSEEEFAHQF 444
            ++++++ L+  + +GV + H GL   D  +VE  F  GA+ V   +  L  G+++ AHLV+I  T  +N  ++  + Y    +LQMIGRA RP  D  A  +++  SS+++F  +F
Sbjct: 1601 ERMTDKTLKETLAQGVAYLHEGLSASDHRLVEQLFDSGAVQVAVISRDLCWGMSISAHLVIIMDTQFYNGKNHSYEDYPITDVLQMIGRANRPNEDADAKCVLMCQSSKKDFFKKF 1716          

HSP 5 Score: 38.1206 bits (87), Expect = 1.597e-16
Identity = 23/101 (22.77%), Postives = 51/101 (50.50%), Query Frame = 2
Query:  449 EHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            +H NAE+    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   + + ++T P   G++ A Y++++ TI+
Sbjct: 1733 DHFNAEVVTKTIENKQDAVDYLTWTFLYRRLTQNPNYYNL-QGVTHRHLSDHLSELVENTLSDLEQSKCIS---VEDDMDTLPLNLGMIAAYYYINYTTIE 1829          
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Match: obe (gene:FBgn0038344 transcript:FBtr0083147)

HSP 1 Score: 116.316 bits (290), Expect = 1.140e-28
Identity = 57/122 (46.72%), Postives = 82/122 (67.21%), Query Frame = 1
Query:   88 QLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQ--NKLLQMIGRAGRPQFDNSAVAIILTSSEEE-FAHQF 444
            ++ +I Q I E+ L+ C+  G+G HHAGL + DR+ VE  FL   + +L +T+TL+ GVNLPAHLVVIKGT  F+  +++        +LQM+GRAGRPQFDN  VA++L   E++ F  +F
Sbjct: 1606 EIELILQNIREQNLKFCLAFGIGLHHAGLQEQDRKCVEELFLNRKIQILVATATLAWGVNLPAHLVVIKGTEYFDGKVKKYVDMPITDVLQMMGRAGRPQFDNEGVAVVLVHDEKKNFYKKF 1727          

HSP 2 Score: 32.3426 bits (72), Expect = 1.140e-28
Identity = 13/40 (32.50%), Postives = 23/40 (57.50%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYY 562
            L EH+NAEI    +    +   ++  ++ + R+ RNP+YY
Sbjct: 1742 LPEHINAEIVAGTVQSKQAALDYLTWTYFFRRLLRNPSYY 1781          

HSP 3 Score: 89.7373 bits (221), Expect = 6.409e-26
Identity = 44/95 (46.32%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  148 GVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            G+  HHAG+ + DR++VE  F+ G + VL  T+TL+ GVNLPAH V+I+GT  +++          L  LQ+ GRAGRPQFD S V  I+TS ++
Sbjct:  788 GLAMHHAGMLRADRQMVEKYFVEGHISVLVCTATLAWGVNLPAHAVIIRGTDIYDAKHGSFVDLGILDVLQIFGRAGRPQFDKSGVGTIITSYDK 882          

HSP 4 Score: 49.2914 bits (116), Expect = 6.409e-26
Identity = 27/109 (24.77%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMK---LIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L ++LNAEI L  + ++D   +W+  ++L++R+  NP  YG+    + E  P +  +   LI+S    L    ++  +Q T  +  T  G   + +++ + T++   +L
Sbjct:  904 LADNLNAEIGLGTITNVDEAIEWLSYTYLFVRMRINPHVYGIEYSEL-EKDPTLEARRRALIMSAAMSLDKARMMRFNQRTMDMNITDLGRTASYFYIKYDTVETFNEL 1011          
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Match: tst (gene:FBgn0039117 transcript:FBtr0334895)

HSP 1 Score: 72.4034 bits (176), Expect = 3.609e-12
Identity = 36/95 (37.89%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            L+  + RG+G HH+G+  + +EIVE  F  G + +L +T T +MGVN+PA  VV      F+    +     + +QM GRAGR   D +  AII+
Sbjct:  574 LKDALERGIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQMAGRAGRRGHDETGTAIIM 668          
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Match: tst (gene:FBgn0039117 transcript:FBtr0084462)

HSP 1 Score: 72.4034 bits (176), Expect = 3.609e-12
Identity = 36/95 (37.89%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            L+  + RG+G HH+G+  + +EIVE  F  G + +L +T T +MGVN+PA  VV      F+    +     + +QM GRAGR   D +  AII+
Sbjct:  574 LKDALERGIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQMAGRAGRRGHDETGTAIIM 668          
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Match: DNApol-theta (gene:FBgn0002905 transcript:FBtr0082662)

HSP 1 Score: 70.4774 bits (171), Expect = 1.924e-11
Identity = 49/110 (44.55%), Postives = 63/110 (57.27%), Query Frame = 1
Query:   94 GVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIK----GTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            GV+S+ I+     AC      FHHAGL   +R+I+E+SF  GAL VL +TSTLS GVNLPA  V+I+    G    +S    TY      QMIGRAGR   D    +I++
Sbjct:  534 GVMSKAIT----YAC-----AFHHAGLTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPLFGGKQMSS---LTYR-----QMIGRAGRMGKDTLGESILI 626          
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 176.407 bits (446), Expect = 3.352e-98
Identity = 100/313 (31.95%), Postives = 172/313 (54.95%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQS--EVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNY--LNYIESQTKISKQNPEKF 1766
            I  IS+  E S++ LR  ER  +N LNK +    +RFP++G+I +  MK++CL+Q  LGC+ + +  L Q+T KIFR  +R+ R + +  FL      N+   ++  +L KCF AKLW+N+ ++S Q+  I   +A  L NAG +T ++I  +  + +E I+N+ PPFG  + +  S  PR E+++EQI     +   + VF   M    + +      D  +    + LI+GD +N V ++ +I +  L+ S  W   I V R  +   L I LIS  +VG DI+  +  +Y  ++ ++++  I+++   +F
Sbjct:  756 IEMISKAKEFSDMQLRVNERKTLNTLNKDKNRTTIRFPIEGKIKSNDMKVNCLIQAQLGCIPIQEFGLIQDTGKIFRNAVRVSRYLTE--FLCHHSKSNFAAQLNALILAKCFRAKLWENSPYISKQLERIGLSLATALVNAGLTTFSKIEQTSPRELELIVNRHPPFGNQIKEAISKLPRCEVSLEQIPRYSPSTAEI-VFTVNMNNFKELALKRTAPDHHY----VTLIVGDCDNKVVFQQKISDTLLLKSGSWSKRIEVTRSPKGEELSIHLISSEYVGLDIQQDYSAHYSGVHGLQAEFSITEKPTWRF 1061          

HSP 2 Score: 139.813 bits (351), Expect = 3.352e-98
Identity = 68/148 (45.95%), Postives = 96/148 (64.86%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEFAH 438
            FC TRK   Q A  L    RF +  D   +L   +  + + KLR   + G+G+HHAG+   DR+I E++F  G LPVL +TSTL+MGVN+PAHLVVIK T ++     + Y++  LLQMIGRAGRPQFD +A A+I+T   +++++ H
Sbjct:  495 FCSTRKGVQQSASVLAKDARFIMSIDHKQRLVKYANSLLDAKLRDLFVYGIGYHHAGMDVSDRKITENAFTVGDLPVLFTTSTLAMGVNMPAHLVVIKSTMHYVGGACEEYSEADLLQMIGRAGRPQFDTTATAVIMTRPQTKDKYMH 642          

HSP 3 Score: 86.6557 bits (213), Expect = 3.352e-98
Identity = 47/121 (38.84%), Postives = 71/121 (58.68%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH NL+EHLNAEI LH + D++    WI+S+FLYIR  +NP +Y                +L +  ++ L++ +LI  D+  N I+ T  G LMARY + F T++    ++G+ETL  L+
Sbjct:  653 SLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPKHY----------------ELCLKNLNSLASFNLITMDEDIN-IKPTETGKLMARYCVAFDTVKQFSMVTGTETLPELI 756          
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 94.3597 bits (233), Expect = 8.255e-30
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVD--QTRFELKFDQIHQLGVISQ------KISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            F   R ST + A  L++  + R EL F Q+ Q     Q      +   +++R     G G HHAG+ + DR ++ES F  G L VL  T+TL+ GVNLPAH V+IKGT+ +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  719 FVHARNSTVRTAMSLIEMAKNRGELSFFQVDQGADYGQCEKQIQRSRNKQMREMFPDGFGIHHAGMLRQDRSLMESMFSRGYLKVLVCTATLAWGVNLPAHAVIIKGTNIYDAKRGTLVDLGILDVMQIFGRAGRPQFDKYGEGTIITTHDK 870          

HSP 2 Score: 58.5362 bits (140), Expect = 8.255e-30
Identity = 30/114 (26.32%), Postives = 61/114 (53.51%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIM---KLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSE 772
            +L ++LNAEIAL  + ++D   +W+  ++LY+R+  NP  YG+      +  PQ+ +   +L++    KL    +I  D+ T    +T  G   + +++ + TI+   +L  ++
Sbjct:  891 SLADNLNAEIALGTVTNVDEAVRWLSYTYLYVRMRANPLAYGI-NHKAYQMDPQLELYRKELVVESGRKLDKARMIRFDERTGYFASTDLGRTASHFYIKYNTIESFNELFNAQ 1003          

HSP 3 Score: 104.375 bits (259), Expect = 8.085e-27
Identity = 59/150 (39.33%), Postives = 86/150 (57.33%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   D  +  L  D+     +I+  I E  L+  +  G+G HHAGL + DR+ VE  F+   + VL +TSTL+ GVN PAHLV++KGT  ++    +   Y    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1566 TRLTALDLIAFLATEDDPKQWLHQDEREMTDIIA-TIRESNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEYYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1714          

HSP 4 Score: 38.1206 bits (87), Expect = 8.085e-27
Identity = 28/101 (27.72%), Postives = 46/101 (45.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +   S  E I + +  L+   +  L     +   Q    IE    G + + Y+L  QTI+
Sbjct: 1729 LSDHLNAEIAAGTVTSKQDAMDYITWTYFFRRLVMNPSYYNLDDIS-HETINKYLSNLVERSLRDLECSYCMEIQQDEQTIEPLTYGRISSYYYLKHQTIR 1828          
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Match: snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:ZFIN;Acc:ZDB-GENE-081105-64])

HSP 1 Score: 89.3521 bits (220), Expect = 8.998e-30
Identity = 47/111 (42.34%), Postives = 65/111 (58.56%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D+    I++TS  E
Sbjct:  770 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDSKGEGILITSHGE 872          

HSP 2 Score: 50.0618 bits (118), Expect = 8.998e-30
Identity = 28/108 (25.93%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  + +      W+  ++LY+R+ RNP  YGV     SI   + +  M L+ +    L   +L+ +D+ +   + T  G + + +++  ++I    +L
Sbjct:  894 LADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSHDDRSIDPLLERRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQL 1001          

HSP 3 Score: 33.113 bits (74), Expect = 8.998e-30
Identity = 37/184 (20.11%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   +  ++  N  F  L  + +++       L + P  G+T+ K    FP+ +L +
Sbjct: 1016 SLSSEFRNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDK----RMWQSMSPLRQFRKLPE-EVIKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHQFPKLDLAV 1185          

HSP 4 Score: 73.9442 bits (180), Expect = 1.300e-17
Identity = 40/116 (34.48%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            + +S+  L+  +  GVG+ H GL   +R IVE  F  GA+ V+ ++ +L  G N+ AHLV++  T  +N  I     Y    +LQM+G+A RP Q D     I+   S+++F  +F
Sbjct: 1598 ENLSDVTLKETLSNGVGYLHEGLSPTERRIVEHLFTSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKF 1713          

HSP 5 Score: 37.3502 bits (85), Expect = 1.300e-17
Identity = 25/103 (24.27%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1728 LHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGMSHRHLSDHLSELVENTLQDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1826          
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Match: snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:ZFIN;Acc:ZDB-GENE-081105-64])

HSP 1 Score: 89.3521 bits (220), Expect = 8.998e-30
Identity = 47/111 (42.34%), Postives = 65/111 (58.56%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D+    I++TS  E
Sbjct:  770 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDSKGEGILITSHGE 872          

HSP 2 Score: 50.0618 bits (118), Expect = 8.998e-30
Identity = 28/108 (25.93%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  + +      W+  ++LY+R+ RNP  YGV     SI   + +  M L+ +    L   +L+ +D+ +   + T  G + + +++  ++I    +L
Sbjct:  894 LADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSHDDRSIDPLLERRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQL 1001          

HSP 3 Score: 33.113 bits (74), Expect = 8.998e-30
Identity = 37/184 (20.11%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   +  ++  N  F  L  + +++       L + P  G+T+ K    FP+ +L +
Sbjct: 1016 SLSSEFRNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDK----RMWQSMSPLRQFRKLPE-EVIKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHQFPKLDLAV 1185          

HSP 4 Score: 73.9442 bits (180), Expect = 1.300e-17
Identity = 40/116 (34.48%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            + +S+  L+  +  GVG+ H GL   +R IVE  F  GA+ V+ ++ +L  G N+ AHLV++  T  +N  I     Y    +LQM+G+A RP Q D     I+   S+++F  +F
Sbjct: 1598 ENLSDVTLKETLSNGVGYLHEGLSPTERRIVEHLFTSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKF 1713          

HSP 5 Score: 37.3502 bits (85), Expect = 1.300e-17
Identity = 25/103 (24.27%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1728 LHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGMSHRHLSDHLSELVENTLQDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1826          
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Match: sclt1 (sodium channel and clathrin linker 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3278])

HSP 1 Score: 100.908 bits (250), Expect = 5.930e-21
Identity = 154/677 (22.75%), Postives = 331/677 (48.89%), Query Frame = 1
Query: 3022 SEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIK-------LIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRN-QIDNMPKNFETCFSEQLKV---------NMQAQIDLMIKEKNSLQEMLRISELEVDRLQNE------------VTENNMKPQTV----------IFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKI-------------QADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNXXXXXXXXXXXXXLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQ--MSCDKAQSNADRFTKLLLASEESATKN-----RKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFXXXXXXXXXXWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLERKVNISEDMAP 4875
            +E +FL+DQV+RLN VL  YQ+++   S      D+        L       PL+ EYD+ I +M  +++ ++  +   + S++ + KENERL   Q  ++ K  ++  +              N++ Q+   ++EK  + +M + +  E+DRLQ +            V   +M+ Q            + N++++S  Q ++ ++ E   E     D++R L      Q+    ++E+ N++              A + +  +EA++  L QL+++L +++       Q  E+V   +T+ +         C++L D      EK    ++A  ++  + ++AE+A+++++  ++RE Q   E E+++  +  ++++A +RT++EV+ V  +   ++ R+ +EL+  +    +   ++++  R +  +E+E+E +++  R    +    E + H R + AE+ ++E +L L S  N   +   E++        E S  Q+++  LQ  ++  + +S A    +L L  E           RK+   + R  + +   ++Q   +K+Q LE+RL   E++ +++++ + + L  QQ+  S++++EA NL++ ++QKL  +  E +RQK+R  E+   +    Q+ILE    + EQ+     L+R+++ +E  A 
Sbjct:    3 TEVEFLRDQVNRLNSVLGRYQDEFPPPSSVSQVEDVVIEAAAPWLADRGLMAPLIEEYDRHIQQMEMQLKFYQRQMTDVKASLEQVVKENERLHAEQRLSVEKQLQSLSAGAEGDAAADAMAISNLEEQVKCAVEEKERVLQMWQTASQELDRLQTQFQSSMSDGQIHAVERQHMQSQLAQLQQHAQKLQLTNQKLDSTNQQFVKTVAEQSAEL---EDLRRQLRQAKLDQRSAATKVEEMNRLVQNVQDQMQRREEDAAEAQGREEASDRRLQQLQAALSQLEARLKSATQDCESVRRKQTDCERQVGELQGRCSSLED------EK----FEALSRLRSSIQLAEEASLQREQAQLREKQRAEELEKMKDAMKQLIQNAAMRTRKEVESVRKQCNVQIHRMAEELSALQLECADKETQIERAHRERKAVEEELEKVYKEGRVGEPEMRKMEAL-HQRCLNAERLKDETQLALNSMNNKMKKMEMEYS-------EELSRCQEEVRRLQSALTTARQESTAVSEERLTLQQENQQMHRDMEALRKECALAQRRAKQQVSSMQQELCVKEQGLESRLREMEESSKNSSAGLTRLLLAQQKTISRYKDEAKNLTQAFQQKLNSLRSELNRQKQRVQELEIQMEADHQKILEFERQVSEQQEKNTRLQRRLSQAEQRAA 658          
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Match: hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:NCBI gene;Acc:779837])

HSP 1 Score: 199.134 bits (505), Expect = 5.881e-111
Identity = 100/295 (33.90%), Postives = 169/295 (57.29%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCS--LHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLN 1718
            +S IS CSE S++ LR  ER  +N LNK +    +R+P++G+I    MK++CL+Q  LGC+ V D SL Q+  KIFR G R+ +C+ ++L L     + +   ++  +L KCF +KLW+N+  +S Q+ +I   +A  + NAG +T  +I ++ A+ +E I+N+ PPFG  + +  +  P+YE+  +Q+ +  +      L V +T  +Q   +     D  F    ++L+IGD +N   +K +IM+  L  +  W  +I + R S+   +C++LIS  +VG DI+  F   YL 
Sbjct:  745 VSLISSCSEFSDVQLRANERRVLNTLNKDKNRVTIRYPMEGKIKTKEMKVNCLIQAHLGCILVQDFSLTQDISKIFRHGTRLAKCLSEFLALQE---NKFSAFLNALILTKCFKSKLWENSSHISKQLEKIGVTLANAMVNAGLTTFKKIEDTNARELELIVNRHPPFGNQIKESVAHLPKYEIKFQQLAKYRATTAEVVLTVLLTNFKQLQKKRTAP-DSHF----VMLVIGDDDNQAIFKQKIMDSSLFKTGSWTRKIEIKRASKSTNVCLNLISSEYVGLDIQQSFNICYLG 1031          

HSP 2 Score: 150.984 bits (380), Expect = 5.881e-111
Identity = 72/151 (47.68%), Postives = 103/151 (68.21%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEFAHQFD 447
            FC TRK   Q A  L    +F +  +   +L   +  I + KLR  +  GVG+HHAG+   DR+++E+SFL G LPVL +TSTL+MGVNLPAHLV++K T ++ S + Q Y++  +LQMIGRAGRPQFD++A A+I+T  S++E++ H  D
Sbjct:  468 FCSTRKGVQQAASILTKDAKFVMSIEHKQRLQKCANSIKDSKLRDVLQYGVGYHHAGVDISDRKVIENSFLIGDLPVLFTTSTLAMGVNLPAHLVIVKSTMHYVSGMFQEYSETDILQMIGRAGRPQFDSTATAVIMTRLSTKEKYVHMLD 618          

HSP 3 Score: 96.2857 bits (238), Expect = 5.881e-111
Identity = 52/121 (42.98%), Postives = 73/121 (60.33%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +L+EHLNAEIALH + D+    +WI+S+FLYIR  +NPAYYG   G     I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F T +    + G+ETL  LV
Sbjct:  626 SLHKHLVEHLNAEIALHTITDVKVALEWIRSTFLYIRALKNPAYYGFSEGLDKIGIEAKLQELCLKNLNDLSSLGLIKMDEEIN-FKPTETGKLMALYYIAFNTAKLFHTIRGTETLAELV 745          
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Match: SNRNP200 (small nuclear ribonucleoprotein, U5 200kDa subunit [Source:NCBI gene;Acc:100145098])

HSP 1 Score: 89.3521 bits (220), Expect = 2.159e-28
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  712 ELKDLLPYGFAIHHAGMSRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 814          

HSP 2 Score: 45.8246 bits (107), Expect = 2.159e-28
Identity = 28/109 (25.69%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
             L + LNAE+ L  + +      W+  ++LYIR+ R+P  YG+      I   + Q  + LI +    L   +L+ +D+ T   + T  G + + +++   +IQ   +L
Sbjct:  835 KLPDMLNAEVVLGHVQNAKDAVNWLGYTYLYIRMLRSPNLYGISHDDLKIDPLLEQRRLDLIHTAALLLDKNNLMKYDKKTGNFQVTELGRIASHFYITNDSIQTYNQL 943          

HSP 3 Score: 33.4982 bits (75), Expect = 2.159e-28
Identity = 38/184 (20.65%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FP+ +L++
Sbjct:  958 SLSSEFKNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK----RMWQSMCPLRQFRKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHLFPKLDLSV 1127          

HSP 4 Score: 82.4185 bits (202), Expect = 8.179e-20
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            +K+S+E L+  ++ GVG+ H GL  L+R IVE  F  GA+ V+ ++ +L  G+N+ AHLV+I  T  +N  I     Y    +LQM+G A RP Q D     I+   S+++F  +F
Sbjct: 1541 EKLSDETLKETLLNGVGYLHEGLSSLERRIVEQLFNTGAVQVIVASRSLCWGLNIAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGYANRPLQDDEGRCVIMCQGSKKDFFKKF 1656          

HSP 5 Score: 37.3502 bits (85), Expect = 8.179e-20
Identity = 25/103 (24.27%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+   +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1671 LHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGVSHRHLSDHLSELVEHTLSDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1769          
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 83.5741 bits (205), Expect = 2.859e-25
Identity = 44/109 (40.37%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            Q+   ++LR     G   HHAG+ + DR +VE+ F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  771 QRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDK 879          

HSP 2 Score: 54.6842 bits (130), Expect = 2.859e-25
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            +L ++LNAE+AL  + +++   KW+  ++LY+R+  NP  YG+      +  A+ +   +L+I    KL    +I  ++ T    +T  G   + +++ + TI+   +L
Sbjct:  900 SLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNEL 1008          

HSP 3 Score: 100.138 bits (248), Expect = 5.085e-25
Identity = 56/150 (37.33%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   +  +  L  D+  ++  I   + +  L+  +  G+G HHAGL + DR  VE  F+   + VL +TSTL+ GVN PAHLV++KGT  ++    +   Y    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1575 TRLTALDLIAFLATENDPKQWLNMDE-REMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1723          

HSP 4 Score: 36.965 bits (84), Expect = 5.085e-25
Identity = 25/101 (24.75%), Postives = 46/101 (45.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +      E++ + +  L+   +  L     I   +    IE    G + + Y+L  QT++
Sbjct: 1738 LSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVG-HESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVR 1837          
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 83.5741 bits (205), Expect = 2.907e-25
Identity = 44/109 (40.37%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            Q+   ++LR     G   HHAG+ + DR +VE+ F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  762 QRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDK 870          

HSP 2 Score: 54.6842 bits (130), Expect = 2.907e-25
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            +L ++LNAE+AL  + +++   KW+  ++LY+R+  NP  YG+      +  A+ +   +L+I    KL    +I  ++ T    +T  G   + +++ + TI+   +L
Sbjct:  891 SLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNEL 999          

HSP 3 Score: 100.138 bits (248), Expect = 5.003e-25
Identity = 56/150 (37.33%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   +  +  L  D+  ++  I   + +  L+  +  G+G HHAGL + DR  VE  F+   + VL +TSTL+ GVN PAHLV++KGT  ++    +   Y    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1566 TRLTALDLIAFLATENDPKQWLNMDE-REMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1714          

HSP 4 Score: 36.965 bits (84), Expect = 5.003e-25
Identity = 25/101 (24.75%), Postives = 46/101 (45.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +      E++ + +  L+   +  L     I   +    IE    G + + Y+L  QT++
Sbjct: 1729 LSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVG-HESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVR 1828          
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 83.5741 bits (205), Expect = 2.980e-25
Identity = 44/109 (40.37%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            Q+   ++LR     G   HHAG+ + DR +VE+ F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  747 QRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDK 855          

HSP 2 Score: 54.6842 bits (130), Expect = 2.980e-25
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            +L ++LNAE+AL  + +++   KW+  ++LY+R+  NP  YG+      +  A+ +   +L+I    KL    +I  ++ T    +T  G   + +++ + TI+   +L
Sbjct:  876 SLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNEL 984          

HSP 3 Score: 100.138 bits (248), Expect = 5.432e-25
Identity = 56/150 (37.33%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   +  +  L  D+  ++  I   + +  L+  +  G+G HHAGL + DR  VE  F+   + VL +TSTL+ GVN PAHLV++KGT  ++    +   Y    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1551 TRLTALDLIAFLATENDPKQWLNMDE-REMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1699          

HSP 4 Score: 36.965 bits (84), Expect = 5.432e-25
Identity = 25/101 (24.75%), Postives = 46/101 (45.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +      E++ + +  L+   +  L     I   +    IE    G + + Y+L  QT++
Sbjct: 1714 LSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVG-HESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVR 1813          
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 184.111 bits (466), Expect = 9.023e-103
Identity = 111/314 (35.35%), Postives = 167/314 (53.18%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHV-FVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNR--ISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTN 1772
            IS IS C+E  ++ LR +E+  +N LNK      +RFP+  RI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D+   +++    +  L++  +L KCF  KLW+N+  VS Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +  +  P+YEL +EQI         + V  + R  ++        D  +      LIIGD +N V +K +IM+  L+ S  W  +I V R  ISED  L I+LIS  +VG DI  KF   Y              P KF N
Sbjct:  808 ISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARWLSDF---VAAQEKKFAVLLNSVILTKCFKCKLWENSKHVSKQLDKIGISLSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVEQIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYAT----LIIGDADNQVVFKHKIMDSVLLKSGNWVKKIDVKRALISED--LSINLISSDYVGLDIHQKFTVFYF------------GPRKFVN 1100          

HSP 2 Score: 140.198 bits (352), Expect = 9.023e-103
Identity = 68/146 (46.58%), Postives = 99/146 (67.81%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  LV   +F +  +Q  +L   +  I + KL+  ++ GVG+HHAG+   DR++VE  F  G LPVL +TSTL+MG+N+PAHLVVIK T +++  + + Y++  +LQMIGRAGRPQFD +A A+I+T  S+ E++
Sbjct:  531 FCSTRKGVQQAASVLVKDAKFIISVEQKLRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKY 676          

HSP 3 Score: 93.9745 bits (232), Expect = 9.023e-103
Identity = 49/121 (40.50%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++    WI+S+ LYIR  +NP++YG  +G   + I   + +L +  +  LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  L+
Sbjct:  689 SLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKDGIEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFETVKKFCAISGKETLLDLI 808          
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 184.111 bits (466), Expect = 9.023e-103
Identity = 111/314 (35.35%), Postives = 167/314 (53.18%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHV-FVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNR--ISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTN 1772
            IS IS C+E  ++ LR +E+  +N LNK      +RFP+  RI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D+   +++    +  L++  +L KCF  KLW+N+  VS Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +  +  P+YEL +EQI         + V  + R  ++        D  +      LIIGD +N V +K +IM+  L+ S  W  +I V R  ISED  L I+LIS  +VG DI  KF   Y              P KF N
Sbjct:  808 ISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARWLSDF---VAAQEKKFAVLLNSVILTKCFKCKLWENSKHVSKQLDKIGISLSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVEQIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYAT----LIIGDADNQVVFKHKIMDSVLLKSGNWVKKIDVKRALISED--LSINLISSDYVGLDIHQKFTVFYF------------GPRKFVN 1100          

HSP 2 Score: 140.198 bits (352), Expect = 9.023e-103
Identity = 68/146 (46.58%), Postives = 99/146 (67.81%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  LV   +F +  +Q  +L   +  I + KL+  ++ GVG+HHAG+   DR++VE  F  G LPVL +TSTL+MG+N+PAHLVVIK T +++  + + Y++  +LQMIGRAGRPQFD +A A+I+T  S+ E++
Sbjct:  531 FCSTRKGVQQAASVLVKDAKFIISVEQKLRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKY 676          

HSP 3 Score: 93.9745 bits (232), Expect = 9.023e-103
Identity = 49/121 (40.50%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++    WI+S+ LYIR  +NP++YG  +G   + I   + +L +  +  LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  L+
Sbjct:  689 SLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKDGIEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFETVKKFCAISGKETLLDLI 808          
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 142.124 bits (357), Expect = 1.531e-37
Identity = 100/316 (31.65%), Postives = 145/316 (45.89%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKL--RFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHV-FVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNR--ISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTN 1772
            IS IS C+E  ++ LR +E+  +N LNK   PN++  RFP+  RI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI RC+                                                ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +  +  P+YEL +EQI         + V  + R  ++        D  +      LIIGD +N V +K +IM+  L+ S  W  +I V R  ISED  L I+LIS  +VG DI  KF   Y              P KF N
Sbjct:   66 ISMISSCNEFLDVQLRISEKRILNTLNKD--PNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARCIS-----------------------------------------------LSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVEQIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYAT----LIIGDADNQVVFKHKIMDSVLLKSGNWVKKIDVKRALISED--LSINLISSDYVGLDIHQKFTVFYF------------GPRKFVN 314          

HSP 2 Score: 36.5798 bits (83), Expect = 1.531e-37
Identity = 22/66 (33.33%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  593 IPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            I   + +L +  +  LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  L+
Sbjct:    2 IEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFETVKKFCAISGKETLLDLI 66          
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Match: Snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:MGI Symbol;Acc:MGI:2444401])

HSP 1 Score: 89.3521 bits (220), Expect = 8.438e-30
Identity = 45/104 (43.27%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQ---NKLLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT  ++   +  +T+     +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  773 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPE-KGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 875          

HSP 2 Score: 48.9062 bits (115), Expect = 8.438e-30
Identity = 28/108 (25.93%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSIC--EAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  + +      W+  ++LYIR+ R+P  YG+    +     + Q  + L+ +    L   +L+ +D+ T   + T  G + + Y++   T+Q   +L
Sbjct:  897 LPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQL 1004          

HSP 3 Score: 34.6538 bits (78), Expect = 8.438e-30
Identity = 39/184 (21.20%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +TL  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FP+ EL++
Sbjct: 1019 SLSSEFKNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK----RMWQSMCPLRQFRKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHLFPKLELSV 1188          

HSP 4 Score: 78.5666 bits (192), Expect = 1.018e-18
Identity = 41/116 (35.34%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            +K+S+  L+  ++ GVG+ H GL  ++R +VE  F  GA+ V+ ++ +L  G+N+ AHLV+I  T  +N  I     Y    +LQM+G A RP Q D     I+   S+++F  +F
Sbjct: 1602 EKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKF 1717          

HSP 5 Score: 36.965 bits (84), Expect = 1.018e-18
Identity = 24/101 (23.76%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  449 EHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+   +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1734 DHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGISHRHLSDHLSELVEQTLSDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1830          
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Match: Ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:MGI Symbol;Acc:MGI:1925237])

HSP 1 Score: 100.523 bits (249), Expect = 1.682e-26
Identity = 56/150 (37.33%), Postives = 87/150 (58.00%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +  +L  FL   +  +  L  D+  ++  I   + +  L+  +  G+G HHAGL + DR+ VE  F+   + VL +TSTL+ GVN PAHLV+IKGT  ++    +   +    +LQM+GRAGRPQFD+   A+IL    +++F  +F
Sbjct: 1569 TRLTALELIAFLATEEDPKQWLNMDE-QEMDNIIGTVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKF 1717          

HSP 2 Score: 41.2022 bits (95), Expect = 1.682e-26
Identity = 27/102 (26.47%), Postives = 50/102 (49.02%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICE-AIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +  G + + +I + +  LI   + +L     I   +    IE   CG + + Y+L  +T++
Sbjct: 1732 LSDHLNAEIAGGTITSKQDAMDYITWTYFFRRLIMNPSYYSL--GDVSQDSINKFLSHLIGQSLVELELSHCIEVGEDNRTIEPLTCGRIASYYYLKHKTVK 1831          

HSP 3 Score: 85.1149 bits (209), Expect = 1.741e-25
Identity = 47/117 (40.17%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            QK   +++R     G   HHAG+ + DR +VE+ F  G + VL  T+TL+ GVNLPAH VVIKGT        Q Y   +          ++Q+ GRAGRPQFD     II+T+ ++
Sbjct:  765 QKSRNKQVRELFSDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIKGT--------QIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDK 873          

HSP 4 Score: 53.1434 bits (126), Expect = 1.741e-25
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGS--ICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            +L ++LNAEIAL  + +++   +W+  ++LY+R+  NP  YG+   +  I   + +   +L+I    KL    +I  ++ T    +T  G   + +++ + TI+   +L
Sbjct:  894 SLADNLNAEIALGTVTNVEEAVRWMSYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLLIEVGQKLDKAKMIRFEERTGYFSSTDLGRTASHFYIKYNTIETFNEL 1002          
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Match: sp|A2RUV5|HFM1_XENTR (Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis OX=8364 GN=hfm1 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 3.024e-110
Identity = 100/295 (33.90%), Postives = 169/295 (57.29%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCS--LHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLN 1718
            +S IS CSE S++ LR  ER  +N LNK +    +R+P++G+I    MK++CL+Q  LGC+ V D SL Q+  KIFR G R+ +C+ ++L L     + +   ++  +L KCF +KLW+N+  +S Q+ +I   +A  + NAG +T  +I ++ A+ +E I+N+ PPFG  + +  +  P+YE+  +Q+ +  +      L V +T  +Q   +     D  F    ++L+IGD +N   +K +IM+  L  +  W  +I + R S+   +C++LIS  +VG DI+  F   YL 
Sbjct:  679 VSLISSCSEFSDVQLRANERRVLNTLNKDKNRVTIRYPMEGKIKTKEMKVNCLIQAHLGCILVQDFSLTQDISKIFRHGTRLAKCLSEFLALQE---NKFSAFLNALILTKCFKSKLWENSSHISKQLEKIGVTLANAMVNAGLTTFKKIEDTNARELELIVNRHPPFGNQIKESVAHLPKYEIKFQQLAKYRATTAEVVLTVLLTNFKQLQKKRTAP-DSHF----VMLVIGDDDNQAIFKQKIMDSSLFKTGSWTRKIEIKRASKSTNVCLNLISSEYVGLDIQQSFNICYLG 965          

HSP 2 Score: 150.984 bits (380), Expect = 3.024e-110
Identity = 72/151 (47.68%), Postives = 103/151 (68.21%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEFAHQFD 447
            FC TRK   Q A  L    +F +  +   +L   +  I + KLR  +  GVG+HHAG+   DR+++E+SFL G LPVL +TSTL+MGVNLPAHLV++K T ++ S + Q Y++  +LQMIGRAGRPQFD++A A+I+T  S++E++ H  D
Sbjct:  402 FCSTRKGVQQAASILTKDAKFVMSIEHKQRLQKCANSIKDSKLRDVLQYGVGYHHAGVDISDRKVIENSFLIGDLPVLFTTSTLAMGVNLPAHLVIVKSTMHYVSGMFQEYSETDILQMIGRAGRPQFDSTATAVIMTRLSTKEKYVHMLD 552          

HSP 3 Score: 95.9005 bits (237), Expect = 3.024e-110
Identity = 52/121 (42.98%), Postives = 73/121 (60.33%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +L+EHLNAEIALH + D+    +WI+S+FLYIR  +NPAYYG   G     I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F T +    + G+ETL  LV
Sbjct:  560 SLHKHLVEHLNAEIALHTITDVKVALEWIRSTFLYIRALKNPAYYGFSEGLDKIGIEAKLQELCLKNLNDLSSLGLIKMDEEIN-FKPTETGKLMALYYIAFNTAKLFHTIRGTETLAELV 679          
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Match: sp|A2PYH4|HFM1_HUMAN (Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens OX=9606 GN=HFM1 PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.014e-103
Identity = 103/294 (35.03%), Postives = 163/294 (55.44%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDS--MLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYL 1715
            ++ I+ C E  +I LR  E+  +N LNK      +RFP++GRI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D+   +++    +  L++  +L KCF  KLW+N+  VS Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +     P+YEL +EQI        +  + VT + +  +Q +     R  +DS  + LIIGD +N V Y  +I +  L+ +  W  +I V R  +   L I+LIS   VG DI+ K    YL
Sbjct:  810 VTLIAGCKEFLDIQLRINEKKTLNTLNKDPNRITIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRITRWLSDF---VAAQEKKFAVLLNSLILAKCFRCKLWENSLHVSKQLEKIGITLSNAIVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELKVEQITRYSD--TTAEILVTVILRNFEQLQTK---RTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYL 1095          

HSP 2 Score: 139.813 bits (351), Expect = 8.014e-103
Identity = 66/138 (47.83%), Postives = 91/138 (65.94%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT 414
            FC TRK   Q A  LV   +F +  +Q  +L   +  + + KLR  +  G  +HHAG+   DR++VE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++   + + Y++  +LQMIGRAGRPQFD +A A+I+T
Sbjct:  533 FCATRKGVQQAASVLVKDAKFIMTVEQKQRLQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGLFEEYSETDILQMIGRAGRPQFDTTATAVIMT 670          

HSP 3 Score: 97.8265 bits (242), Expect = 8.014e-103
Identity = 50/121 (41.32%), Postives = 77/121 (63.64%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++   +WI+S+ LYIR  +NP++YG  +G   + I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL+ LV
Sbjct:  691 SLHRHLIEHLNAEIVLHTITDVNIAVEWIRSTLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIKMDEGVN-FKPTEAGRLMAWYYITFETVKKFYTISGKETLSDLV 810          
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Match: sp|D3Z4R1|HFM1_MOUSE (Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 5.516e-102
Identity = 111/314 (35.35%), Postives = 167/314 (53.18%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHV-FVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNR--ISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTN 1772
            IS IS C+E  ++ LR +E+  +N LNK      +RFP+  RI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D+   +++    +  L++  +L KCF  KLW+N+  VS Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +  +  P+YEL +EQI         + V  + R  ++        D  +      LIIGD +N V +K +IM+  L+ S  W  +I V R  ISED  L I+LIS  +VG DI  KF   Y              P KF N
Sbjct:  808 ISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARWLSDF---VAAQEKKFAVLLNSVILTKCFKCKLWENSKHVSKQLDKIGISLSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVEQIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYAT----LIIGDADNQVVFKHKIMDSVLLKSGNWVKKIDVKRALISED--LSINLISSDYVGLDIHQKFTVFYF------------GPRKFVN 1100          

HSP 2 Score: 140.198 bits (352), Expect = 5.516e-102
Identity = 68/146 (46.58%), Postives = 99/146 (67.81%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  LV   +F +  +Q  +L   +  I + KL+  ++ GVG+HHAG+   DR++VE  F  G LPVL +TSTL+MG+N+PAHLVVIK T +++  + + Y++  +LQMIGRAGRPQFD +A A+I+T  S+ E++
Sbjct:  531 FCSTRKGVQQAASVLVKDAKFIISVEQKLRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKY 676          

HSP 3 Score: 93.9745 bits (232), Expect = 5.516e-102
Identity = 49/121 (40.50%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++    WI+S+ LYIR  +NP++YG  +G   + I   + +L +  +  LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  L+
Sbjct:  689 SLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKDGIEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFETVKKFCAISGKETLLDLI 808          
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Match: sp|Q5D892|MER3_ARATH (DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana OX=3702 GN=MER3 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 3.542e-61
Identity = 64/151 (42.38%), Postives = 94/151 (62.25%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKF--------DQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSSE 423
            FC TRK   + A+ L  QT     +        +Q+ +L   S   S++++++ I++GVG+H+ GLCQ DR +VE  FL G + V+C+T+TL+ G+NLPAH VVIK T +FN        Y ++ LLQM GRAGRP FD++ + II+T  E
Sbjct:  280 FCSTRKGAQEAAQKLA-QTAMTYGYSNPFIKSREQLERLREASPMCSDKQMQSYILQGVGYHNGGLCQKDRSLVEGLFLNGDIQVICTTNTLAHGINLPAHTVVIKSTQHFNKEKGHYMEYDRSTLLQMSGRAGRPPFDDTGMVIIMTRRE 429          

HSP 2 Score: 100.138 bits (248), Expect = 3.542e-61
Identity = 79/295 (26.78%), Postives = 140/295 (47.46%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPL-------KGRIMNASMKIDCLVQVIL-GCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGF-PRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIG-DLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCI--DLISEMHVGFDI 1688
            +  +    E+S I LR  E+  +N++N  +   +LRF +       K RI     K+  L    L G   V D S+ Q+ + I   G RI RC+ +Y         NY+  +S TLL K    KLWD++ ++  Q+P I  V A  L + G  +   +A +  + IE +  +  PFG T+ +  S   P+ E+ +E++  ++  +  L V ++R+ Q    ++     R Y D   LI+G +  N +H+  +I       S+ +   +++ R  +   + +  DLI E ++G D+
Sbjct:  567 LHIVCHAEEISWIQLRRNEKKTLNDVNADK-EGRLRFHINDNKGKRKKRIQTREEKLFVLANDWLTGDPSVHDLSMTQDANSICSNGSRIARCMKEYFIYKK----NYKGTLSSTLLAKSLYQKLWDDSPYLLKQLPGIGMVTAKALHSMGVRSFEALAEADPRRIEIVTGRKYPFGNTIKESLSSLPPKVEIKVEEVDCQKQGISKLAVTLSRVSQPLQSTK-----RHYAD---LIVGSEEENLIHFHEKIRMEDF--SSPYSVTVLLERPHQQTKVTVKADLIFEEYIGIDL 846          

HSP 3 Score: 62.003 bits (149), Expect = 3.542e-61
Identity = 31/101 (30.69%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            LIEHL AEI    + DI    +W++ S+LY+R+ +NP  Y +  G   + + + + +L + ++++LS   +I  D     ++    G LM +Y+L F+T++
Sbjct:  452 LIEHLTAEIVQLTISDITRAIEWMKCSYLYVRMKKNPENYAIKKGIPKDRVEKHLQELCLQKINELSQYQMIWTDTDGFVLKPEEPGRLMTKYYLKFETMK 552          
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Match: sp|B6DMK2|MER3_ORYSJ (ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=MER3 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 4.591e-60
Identity = 64/151 (42.38%), Postives = 90/151 (59.60%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFD--------QIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSN--IEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSE 423
            FC TRK   + A+ L  QT   L +         Q   L   +   S+++L+AC++ GVG+H+ GLC  DR +VE  FL G + +LC+T+TL+ G+NLPAH VVIK T  FN    +   Y ++ +LQM GRAGRP FD++   II+T  E
Sbjct:  287 FCSTRKGAQEAAQCL-SQTASSLGYSNPFMKSMQQYEHLKEAALTCSDKQLQACLVHGVGYHNGGLCLKDRSVVEGLFLKGDIQILCTTNTLAHGINLPAHTVVIKSTQFFNKEKGLYVEYERSMVLQMCGRAGRPPFDDTGTIIIMTRRE 436          

HSP 2 Score: 98.5969 bits (244), Expect = 4.591e-60
Identity = 83/302 (27.48%), Postives = 141/302 (46.69%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHR---------GPNKLRFPLKGRIMNASMKI-----DCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGF-PRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVN-RISEDPTLCIDLISEMHVGFDIRTK 1697
            +  I   +E++ I LR  E+  +N +N  +         G N  R   K RI     KI     DCL    L    V D SL+QE + I   G R+ +C+ +Y         NY++ +S  LL KC   KLW+++ F+  Q+P I  V A  L  AG  +   +A + A+ IES+  +  PFG ++        P+ ++ IE  G ++    ++ V +TR+ Q    S+ +     Y D  +++  + +N + +  +I   +   S+ +  ++ V    +   TL +D+I E +VG DI  K
Sbjct:  574 LHIICHSAEITWIQLRRNEKKLLNEINADKEGRLWFHVVGANGKR---KKRIQTREEKIFILANDCLTGDPL----VHDLSLNQEMNSICSNGCRVAKCMREYFIYKK----NYKSAISSMLLAKCLHQKLWESSPFLLKQLPGIGIVTAKALKTAGIDSFESLATADARKIESVTGRNYPFGDSIKSYLPSLGPKIDINIEDAGNRQGK-STIIVTLTRLSQAVGSSKQN-----YAD--MVVGSEEDNAILFHEKIKTQEF--SSPYSVKLYVPCPPNARATLKVDVIFEEYVGLDIHKK 854          

HSP 3 Score: 63.1586 bits (152), Expect = 4.591e-60
Identity = 37/115 (32.17%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  446 IEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            +EHLNAEI    + DI    +W++ S+LYIRI +NP +YG+      E + + +  + + ++ +L    LI  D+    ++    G LM +++L F T++ I K S   TL  L+
Sbjct:  460 VEHLNAEIVQLTVSDITLAIEWLKCSYLYIRIKKNPQHYGIKKEIPRELLEKQMKDICVEKIHELGEYGLIWTDEDGFLLKPLEPGRLMTKFYLKFDTMKLIVKASACCTLEDLL 574          
BLAST of Helicase for meiosis 1 vs. TrEMBL
Match: A0A5G3L853 (Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis OX=8364 GN=hfm1 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.359e-108
Identity = 100/295 (33.90%), Postives = 169/295 (57.29%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCS--LHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLN 1718
            +S IS CSE S++ LR  ER  +N LNK +    +R+P++G+I    MK++CL+Q  LGC+ V D SL Q+  KIFR G R+ +C+ ++L L     + +   ++  +L KCF +KLW+N+  +S Q+ +I   +A  + NAG +T  +I ++ A+ +E I+N+ PPFG  + +  +  P+YE+  +Q+ +  +      L V +T  +Q   +     D  F    ++L+IGD +N   +K +IM+  L  +  W  +I + R S+   +C++LIS  +VG DI+  F   YL 
Sbjct:  745 VSLISSCSEFSDVQLRANERRVLNTLNKDKNRVTIRYPMEGKIKTKEMKVNCLIQAHLGCILVQDFSLTQDISKIFRHGTRLAKCLSEFLALQE---NKFSAFLNALILTKCFKSKLWENSSHISKQLEKIGVTLANAMVNAGLTTFKKIEDTNARELELIVNRHPPFGNQIKESVAHLPKYEIKFQQLAKYRATTAEVVLTVLLTNFKQLQKKRTAP-DSHF----VMLVIGDDDNQAIFKQKIMDSSLFKTGSWTRKIEIKRASKSTNVCLNLISSEYVGLDIQQSFNICYLG 1031          

HSP 2 Score: 150.984 bits (380), Expect = 5.359e-108
Identity = 72/151 (47.68%), Postives = 103/151 (68.21%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEFAHQFD 447
            FC TRK   Q A  L    +F +  +   +L   +  I + KLR  +  GVG+HHAG+   DR+++E+SFL G LPVL +TSTL+MGVNLPAHLV++K T ++ S + Q Y++  +LQMIGRAGRPQFD++A A+I+T  S++E++ H  D
Sbjct:  468 FCSTRKGVQQAASILTKDAKFVMSIEHKQRLQKCANSIKDSKLRDVLQYGVGYHHAGVDISDRKVIENSFLIGDLPVLFTTSTLAMGVNLPAHLVIVKSTMHYVSGMFQEYSETDILQMIGRAGRPQFDSTATAVIMTRLSTKEKYVHMLD 618          

HSP 3 Score: 96.2857 bits (238), Expect = 5.359e-108
Identity = 52/121 (42.98%), Postives = 73/121 (60.33%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +L+EHLNAEIALH + D+    +WI+S+FLYIR  +NPAYYG   G     I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F T +    + G+ETL  LV
Sbjct:  626 SLHKHLVEHLNAEIALHTITDVKVALEWIRSTFLYIRALKNPAYYGFSEGLDKIGIEAKLQELCLKNLNDLSSLGLIKMDEEIN-FKPTETGKLMALYYIAFNTAKLFHTIRGTETLAELV 745          
BLAST of Helicase for meiosis 1 vs. TrEMBL
Match: A0A1L8GMZ3 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18023344mg PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.617e-107
Identity = 109/336 (32.44%), Postives = 185/336 (55.06%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCS--LHVFVTRMRQKSDQSEVDCDIRFYNDS--MLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKI-SKQNPEKFTNSKLDNKLPSCPLDKNLTCDT 1832
            +S IS C+E S++ LR  E+  +N LNK +    +R+P++G+I    MK++CL+Q  LGC+ V D SL Q+  KIFR G R+ +C+ ++L L     + +   ++   L KCF +KLW+N+  VS Q+ +I   +A  + NAG +T  +I ++ A+ IE I+N+ PPFG  + +  +  P+Y++T +Q+ +   +     L V +T   Q   +       R   DS  ++L+IGD +N V +K +IM+  L+ +  W  +I + R S    +C++L+S  +VG DI+  F   YL    S   + ++Q  E F+     +K+   P  +    DT
Sbjct:  780 VSLISSCAEFSDVQLRANEKRVLNTLNKDKNRVTIRYPMEGKIKTKEMKVNCLIQAHLGCILVQDFSLSQDISKIFRHGTRLAKCLSEFLALQE---NKFSAFLNALFLTKCFKSKLWENSLHVSKQLEKIGVTLANAMVNAGLTTFKKIEDTNAREIELIVNRHPPFGNQIKESVANLPKYDITFQQLSKYRISTAEVVLTVLLTNFEQLQKK-------RTAPDSHYVMLVIGDDDNQVIFKQKIMDSSLLKTGSWTRKIEIKRASTSTDVCLNLVSSEYVGLDIQRNFNIYYLGSDSSNAGVKTQQKSETFS-----SKISKSPTKRKYNADT 1100          

HSP 2 Score: 147.517 bits (371), Expect = 4.617e-107
Identity = 71/151 (47.02%), Postives = 102/151 (67.55%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEFAHQFD 447
            FC TRK   Q A  L    +F +  +   +L   +  I + KLR  +  GVG+HHAG+   DR+++E++FL G LPVL +TSTL+MGVNLPAHLV+IK T ++ S + Q Y++  +LQMIGRAGRPQFD++A A+I+T  S++E++    D
Sbjct:  503 FCATRKGVQQAASILTKDAKFVMSIEHKQRLQKCANPIKDSKLRDVVQYGVGYHHAGVDIHDRKVIENTFLMGDLPVLFTTSTLAMGVNLPAHLVIIKSTMHYVSGMFQEYSETDILQMIGRAGRPQFDSTATAVIMTRLSTKEKYLQMLD 653          

HSP 3 Score: 94.3597 bits (233), Expect = 4.617e-107
Identity = 51/121 (42.15%), Postives = 73/121 (60.33%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +L+EHLNAEIALH + D++   +WI+S+FLYIR  +N AYYG   G     I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F T +    + G+ETL  LV
Sbjct:  661 SLHKHLVEHLNAEIALHTITDVNVALEWIRSTFLYIRALKNSAYYGFSEGLDKMGIEAKLQELCLKNLNDLSSVGLIKMDEEIN-FKPTETGKLMALYYIAFNTAKLFHTIRGTETLAELV 780          
BLAST of Helicase for meiosis 1 vs. TrEMBL
Match: F7ARR8 (Helicase for meiosis 1 OS=Monodelphis domestica OX=13616 GN=HFM1 PE=4 SV=3)

HSP 1 Score: 200.29 bits (508), Expect = 3.157e-106
Identity = 121/352 (34.38%), Postives = 189/352 (53.69%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYL--NYIESQTKISKQNPEKFTNSKLDNKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRN 1889
            ++ I+ C E  +I LR  E+  +N LNK +    +RFP++GRI    MK++CL+Q  LGCL + D SL Q+T KIFR G RI + + +YL +       +  L++  +L KCF AKLW+N+  VS Q+ +I   ++  + NAG ++  +I +  A+ +E ILN+ PPFG  + +  +  P+YEL +EQI    +    L V V     +  Q++       Y   + LIIGD NN V +K ++M+  L+ +  W  +I V R  +   L I+LIS  +VG DI+ KF   Y+  N  E+Q  + ++N E  T+S+  +  P   +    T +             TCKIS N
Sbjct:  631 VTMIAGCKEFLDIQLRINEKKTLNTLNKDQNRITIRFPMEGRIKTREMKVNCLIQAQLGCLPIQDFSLTQDTAKIFRSGTRITKWLSEYLAMQEK---KFAVLLNSLILAKCFRAKLWENSLHVSKQLEKIGVTLSNAMANAGLTSFKKIEDINARELELILNRHPPFGNQIKETVTHLPKYELEVEQISRYSNTGAELLVTVFLRNFEQLQTKRTAPDSHY---VTLIIGDANNQVVFKHKLMDSVLLKTGNWTKKIDVKRALQSEDLSINLISSEYVGLDIQQKFTAFYIGPNRFENQITM-QRNVETETHSRHSDGSPRKDVSAGSTSNRK----------NTCKISGN 965          

HSP 2 Score: 141.739 bits (356), Expect = 3.157e-106
Identity = 70/146 (47.95%), Postives = 96/146 (65.75%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  L    RF +   Q  +L   +  + + KLR  +  G+G+HHAG+   DR+IVE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++   + + Y++  +LQMIGRAGRPQFD +A A+I+T  S+ E++
Sbjct:  354 FCATRKGVQQAASVLSKNARFAMTMGQKQRLQKCTHSLRDSKLRDLLTCGIGYHHAGMELSDRKIVEEAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYVGGMFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKY 499          

HSP 3 Score: 98.5969 bits (244), Expect = 3.157e-106
Identity = 50/121 (41.32%), Postives = 78/121 (64.46%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++   +WI+S+ LYIR  +NPA+YG  +G     I   + +L +  ++ LS+  LI  D+  N  ++T  G LMA Y++ F+T++    ++G+ETL+ LV
Sbjct:  512 SLHRHLIEHLNAEIVLHTITDVNVALEWIRSTLLYIRALKNPAHYGFASGLDKNGIESKLQELCLKNLNDLSSVDLIKMDEDVN-FKSTEAGRLMAWYYITFETVKKFCIINGTETLSELV 631          
BLAST of Helicase for meiosis 1 vs. TrEMBL
Match: G1L0V4 (Helicase for meiosis 1 OS=Ailuropoda melanoleuca OX=9646 GN=HFM1 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 4.249e-105
Identity = 111/335 (33.13%), Postives = 183/335 (54.63%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLN--YIESQTKISKQNPEKFTNSKLDNKLPSCPLDKNLT-CDTP 1835
            ++ I+ C E  ++ LR  E+  +N LNK      +RFP++GRI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D++ +       +  L++  +L KCF  KLW+N+  +S Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +     P+YEL +EQI      M  + V +     +  Q++       Y   + LIIGD +N + +K RIM+  L+ +  W  +I V R  +   LCI+LIS  +VG DI+ KF   YL    + +Q  + K++  + ++SK  N+      +K +T C  P
Sbjct:  813 VTMIASCKEFVDVQLRINEKKTLNTLNKDPNRVTIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRNGSRITRWLSDFVAVQEK---KFAVLLNSLILAKCFRCKLWENSLHISKQLEKIGITLSNAMVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELEVEQIARYSDVMAEILVTIILRNFEQLQTKRTAPDSHY---VTLIIGDADNQLVFKHRIMDSVLLKAGNWTKKIDVKRALKSEDLCINLISSEYVGLDIQRKFTVFYLGPKRLGNQIIMQKKSETEISHSKHSNRSTIAGPNKGMTACKKP 1141          

HSP 2 Score: 144.821 bits (364), Expect = 4.249e-105
Identity = 71/146 (48.63%), Postives = 98/146 (67.12%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  LV   +F +  +Q  +L   +  I + KLR  +I GV +HHAG+   DR++VE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++   + + Y++  +LQMIGRAGRPQFD +A A+I+T  S++E +
Sbjct:  536 FCATRKGVQQAASVLVKDAKFIMAVEQKQRLQKCAYSIRDSKLRDILIHGVAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGMFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTKERY 681          

HSP 3 Score: 95.5153 bits (236), Expect = 4.249e-105
Identity = 50/121 (41.32%), Postives = 76/121 (62.81%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++   +WI+S+ LYIR  +NP++YG  +G   + I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  LV
Sbjct:  694 SLHRHLIEHLNAEIVLHTITDVNIALEWIRSTLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIRMDEDIN-FKPTEAGRLMAWYYITFETVKKFCTISGKETLLDLV 813          
BLAST of Helicase for meiosis 1 vs. TrEMBL
Match: A0A3Q7VWX0 (probable ATP-dependent DNA helicase HFM1 OS=Ursus arctos horribilis OX=116960 GN=HFM1 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 4.284e-105
Identity = 107/319 (33.54%), Postives = 177/319 (55.49%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLN--YIESQTKISKQNPEKFTNSKLDNK 1790
            ++ I+ C E  ++ LR  E+  +N LNK      +RFP++GRI    MK++CL+Q  LGC+ + D +L Q+T KIFR G RI R + D++ +       +  L++  +L KCF  KLW+N+  +S Q+ +I   ++  + NAG ++  +I  + A+ +E ILN+ PPFG  + +     P+YEL +EQI      M  + V +     +  Q++       Y   + LIIGD +N + +K RIM+  L+ +  W  +I V R  +   LCI+LIS  +VG DI+ KF   YL    + +Q  + K++  + ++SK  N+
Sbjct:  813 VTMIASCKEFVDVQLRINEKKTLNTLNKDPNRVTIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRNGSRITRWLSDFVAVQEK---KFAVLLNSLILAKCFRCKLWENSLHISKQLEKIGITLSNAMVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELEVEQIARYSDTMAEILVTIILRNFEQLQTKRTAPDSHY---VTLIIGDADNQLVFKHRIMDSVLLKAGNWTKKIDVKRAFKSEDLCINLISSEYVGLDIQQKFTVFYLGPKRLGNQIIMQKKSETEISHSKHSNR 1125          

HSP 2 Score: 145.206 bits (365), Expect = 4.284e-105
Identity = 71/146 (48.63%), Postives = 99/146 (67.81%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT--SSEEEF 432
            FC TRK   Q A  LV   +F +  +Q  +L   +  I + KLR  +I GV +HHAG+   DR++VE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++   + + Y++  +LQMIGRAGRPQFD +A A+I+T  S++E++
Sbjct:  536 FCATRKGVQQAASVLVKDAKFIMAVEQKQRLQKCAYSIRDSKLRDILIHGVAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGMFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTKEKY 681          

HSP 3 Score: 95.1301 bits (235), Expect = 4.284e-105
Identity = 50/121 (41.32%), Postives = 76/121 (62.81%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D++   +WI+S+ LYIR  +NP++YG  +G   + I   + +L +  ++ LS+  LI  D+  N  + T  G LMA Y++ F+T++    +SG ETL  LV
Sbjct:  694 SLHRHLIEHLNAEIVLHTITDVNIALEWIRSTLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIRMDEDIN-FKPTEAGRLMAWYYITFETVKKFCTISGKETLLDLV 813          
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 176.022 bits (445), Expect = 3.844e-102
Identity = 95/296 (32.09%), Postives = 168/296 (56.76%), Query Frame = 3
Query:  825 NICY*ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNY 1712
            N+   I  +S+  E S++ LR  E+  +N LN  +    +R+P++G+I +  MK++CL+Q  LG L + +  L Q+T KIFR G+RI +C+ ++L   S    N+   ++  +L KCF AKLW+++ +VS Q+ +I   +A  + NAG ++ ++I  +  + +E I+N+ PPFG  + +  S  P+YE+ +EQ+ +   +   + V V     +   ++       Y   + LIIGD +N+V ++ +I +  L+ S  W  +I V R S++  + I+LIS  +VG DI+  F   Y
Sbjct:  765 NLAELIEMMSKGKEFSDVQLRVNEKRTLNTLNIDKNRVTIRYPMEGKIKSKDMKVNCLIQAQLGNLPIQEFGLTQDTGKIFRSGVRISKCLAEFLSHHSK--QNFSAQLNSLILAKCFRAKLWEDSPYVSKQLDKIGLSLATAMVNAGLTSFSKIEATNPRELELIVNRHPPFGNQIKEAVSKLPKYEIRLEQLPKYSVSTAEILVTVNLKNFEELLTKRTAPDHHY---VTLIIGDCDNNVVFQQKIQDTVLLKSGSWSRKIEVTRTSQEDKISINLISSEYVGLDIQQTFTAFY 1055          

HSP 2 Score: 142.51 bits (358), Expect = 3.844e-102
Identity = 71/138 (51.45%), Postives = 91/138 (65.94%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT 414
            FC TRK   Q A  L    RF +  D   +L   +  I + KLR  I+ GVG+HHAG+   DR++VE +F  G LPVL +TSTL+MGVNLPAHLVVIK T ++     + Y++  +LQMIGRAGRPQFD SA A+I+T
Sbjct:  493 FCSTRKGVQQSATVLAKDARFIMSIDHRQRLMKYASSILDAKLRDLIMCGVGYHHAGVSLSDRKVVEDAFTAGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGSCEEYSEADMLQMIGRAGRPQFDTSATAVIMT 630          

HSP 3 Score: 97.8265 bits (242), Expect = 3.844e-102
Identity = 50/121 (41.32%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH NL+EHLNAEI LH + D++    WI+S+FLYIR  +NP +YG  +      I   + +L +  ++ L++  LI  D+  N I+ T  G LMARY + F T++   KL+G+E L  L+
Sbjct:  651 SLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPTHYGFSSELDKCGIETKLQELCLKNLNSLASYQLITMDEDIN-IKPTESGKLMARYCVAFDTMKQFSKLTGTENLAELI 770          
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:103030392])

HSP 1 Score: 88.9669 bits (219), Expect = 1.106e-28
Identity = 45/104 (43.27%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQ---NKLLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT  ++   +  +T+     +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  770 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPE-KGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 872          

HSP 2 Score: 49.2914 bits (116), Expect = 1.106e-28
Identity = 27/108 (25.00%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAE+ L  + ++     WI  ++LY+R+ RNP  Y V     S    + Q  M L+ +    L   +L+ +D+ +   + T  G + + +++  ++I    +L
Sbjct:  894 LPDMLNAEVVLGNVQNVKDAVNWIGYTYLYVRMLRNPTLYAVSHDERSTDPYLEQRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQL 1001          

HSP 3 Score: 30.4166 bits (67), Expect = 1.106e-28
Identity = 35/184 (19.02%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   I +R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +T+  C ++ K    ++W +   +    ++PE   +  ++  +  F  L  + +++       L + P  G+T+ K    FP+ +L +
Sbjct: 1016 SLSSEFRNITVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLGRGWAQLTDKTMNLCKMIDK----RMWQSMSPLRQFRKLPE-EVIKKIEKKSFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHQFPKLDLAV 1185          

HSP 4 Score: 73.9442 bits (180), Expect = 1.803e-17
Identity = 41/116 (35.34%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEEFAHQF 444
            +K+S+  LR  +  GVG+ H GL   + +IVE  F  GA+ V+ ++ +L  G N+ AHLV++  T  +N  I     Y    +LQM+G+A RP Q D     I+   S+++F  +F
Sbjct: 1599 EKLSDATLRETLSNGVGYLHEGLSSTECKIVEQLFNSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKF 1714          

HSP 5 Score: 36.965 bits (84), Expect = 1.803e-17
Identity = 24/103 (23.30%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   + ++++  P   G++ A Y++++ TI+
Sbjct: 1729 LHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGMSHRHLSDHLSELVENTLQDLEQSKCIS---VEDEMDVAPLNLGMIAAYYYINYTTIE 1827          
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 90.1225 bits (222), Expect = 2.336e-17
Identity = 56/152 (36.84%), Postives = 81/152 (53.29%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVD--QTRFELKFDQIHQLGVIS------QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            F   R ST + A  L++  + R E  F Q+ Q           Q+   ++LR     G G HHAG+ + DR ++E+ F  G L VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  721 FVHARNSTVRTAMSLIEMAKNRGESSFFQVDQGPDYGHCEKQVQRSRNKQLREMFPDGFGIHHAGMLRQDRTLMENMFSRGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAMVDLGILDVMQIFGRAGRPQFDKYGEGTIITTHDK 872          

HSP 2 Score: 72.4034 bits (176), Expect = 5.907e-17
Identity = 39/103 (37.86%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFN 312
            TR +   L  FL   D  +  L  D+     +I+  + +  L+  +  G+G HHAGL + DR+ VE  F+   + VL +TSTL+ GVN PAHLV++KGT  ++
Sbjct: 1528 TRLTALDLIAFLATEDDPKQWLHQDEREMTDIIA-TVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEYYD 1629          

HSP 3 Score: 36.965 bits (84), Expect = 5.907e-17
Identity = 34/148 (22.97%), Postives = 63/148 (42.57%), Query Frame = 2
Query:  302 QILTLILSKHILKINYYK*SVGRVGRNLTTVPWP*F*LVARRSLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            ++L  ++  H +K ++YK             P+P        SL   L +HLNAEIA   +        +I  ++ + R+  NP+YY +   +  E I + +  L+   +  L     +   +    IE    G + + Y+L  QT++
Sbjct: 1644 EVLAGLMLLHDIKKDFYK--------KFLYEPFP-----VESSLLGVLSDHLNAEIAAGTVTSKQDAMDYITWTYFFRRLVMNPSYYNLDDIN-HETINKFLSNLVEKSLRDLECSYCMEIQEDERTIEPLTYGRIASYYYLKHQTVR 1777          
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Match: polq (DNA polymerase theta [Source:NCBI gene;Acc:103039702])

HSP 1 Score: 72.0182 bits (175), Expect = 7.217e-12
Identity = 42/100 (42.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEE 426
            L+  +  GV FHHAGL   +R+I+E +F  G + VL +TSTLS GVNLPA  V+I+ T  FN ++    T     QM+GRAGR   D    ++++    E
Sbjct:  578 LQRTVPWGVAFHHAGLTFDERDILEGAFRQGFIRVLAATSTLSSGVNLPARRVIIR-TPVFNGHLLDILTYK---QMVGRAGRKGVDTIGESVLVCKEAE 673          
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Match: skiv2l (Ski2 like RNA helicase [Source:NCBI gene;Acc:103028968])

HSP 1 Score: 69.3218 bits (168), Expect = 3.862e-11
Identity = 35/98 (35.71%), Postives = 53/98 (54.08%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSS 420
            +R  + RG+G HH+G+  + +E++E  F  G + VL +T T +MGVN+PA  VV       +    +     + +QM GRAGR   D +   IIL  S
Sbjct:  633 MRDLLKRGIGVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKS 730          
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003190.1 (pep scaffold:Pmarinus_7.0:GL480029:355:29241:-1 gene:ENSPMAG00000002910.1 transcript:ENSPMAT00000003190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 3.703e-73
Identity = 62/190 (32.63%), Postives = 107/190 (56.32%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSD-CDNYQTLVSCTLLKKCFVAKLWDNT-WFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQ 1403
            ++ ++ C E   I LR  E+  +N  N  +  + +RFP+ G+I    MK++CL+Q  LGC+ + D +L Q+  KIFR G+R+ +C+ +  FL   D  +N+Q +++   L KCF AKLW N+  F    +  ++  ++  L NAG ++  +I    A     I+N+ PPFG  + +     P+Y++ +EQ
Sbjct:  396 VNLVAHCREYKYIALRVNEKKTLNTFNMAKN-HTIRFPMPGKIKTIEMKVNCLIQPQLGCV-LQDFALIQDIAKIFRTGIRLTKCLAE--FLQQKDKQNNFQAVLNAVHLAKCFRAKLWKNSPVFKQQNVSAVSFSLSSALVNAGLTSFEKIYTVNAIGPVVIVNRHPPFGNQIKEAVQHLPKYQVRVEQ 581          

HSP 2 Score: 114.005 bits (284), Expect = 3.703e-73
Identity = 68/147 (46.26%), Postives = 89/147 (60.54%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFD--QIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFN-SNIEQTYTQNKLLQMIGRAGRP-QFDNSAVAIILTSSEEE 429
            FC TR+S  Q A  L    +F + F   Q H     S  + + KLR  +++G+ +HHAG+   DR  +E  FL G L VL STSTL++GVNLPAHLV++K T  +    + Q Y +   LQMIGRAGRP QFD SA A+ILT  + E
Sbjct:  122 FCATRRSVQQAAATLAKYAKFMIDFQHRQSHCRKHASH-LKDIKLRDLLMKGIAYHHAGMAASDRRNIEDVFLQGELRVLFSTSTLAIGVNLPAHLVIVKSTMRYTRGGMLQEYGET--LQMIGRAGRPQQFDVSATAVILTRKKYE 265          

HSP 3 Score: 84.7297 bits (208), Expect = 3.703e-73
Identity = 50/130 (38.46%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIM---------KLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLHINL EHLNAEI LH + D++    WI+S+FLYIR  +NP +Y  P G   E I + ++          L   +++ + NG           I+ T  G LMA Y++ F TI+    L GSE +  LV
Sbjct:  277 SLHINLTEHLNAEIVLHTITDVNVALDWIRSTFLYIRALKNPKHYKFPAGLSKEDIEKKLLSELCLESLNSLATFKLNCMQNGD----------IKPTDVGRLMASYYIAFDTIKLFGTLQGSEAMQDLV 396          
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 104.375 bits (259), Expect = 1.654e-22
Identity = 59/150 (39.33%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   D  +  L  D+     +IS  + +  L+ C+  G+G HHAGL + DR  VE  F+   + VL +TSTL+ GVN PAHLV+IKGT  F+    +   +    +LQM+GRAGRPQFD+   A+I     +++F  +F
Sbjct:  939 TRLTALDLIAFLAGEDNPKQWLHTDETEMEHIIS-TVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKF 1087          

HSP 2 Score: 81.6481 bits (200), Expect = 5.944e-22
Identity = 43/109 (39.45%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            ++   + +R     G   HHAG+ + DR +VE  F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQ+D   + II+TS ++
Sbjct:  130 ERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDK 238          

HSP 3 Score: 41.9726 bits (97), Expect = 5.944e-22
Identity = 28/129 (21.71%), Postives = 55/129 (42.64%), Query Frame = 2
Query:  431 LHINLIEHLNAE--IALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEA--IPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSG----SETLTSLVC 793
               +L ++LNAE    L     I    +W+  ++LY+R+  NP  YG+    +  +  +     ++++    KL    +I  D+ T     T  G   + +++ + TI+      G       + S+VC
Sbjct:  256 FQASLQDNLNAEDEAGLATAAYIFEAVRWLSYTYLYVRMRANPLAYGINYNELWRSPNVEWFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVC 384          
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 104.375 bits (259), Expect = 1.655e-22
Identity = 59/150 (39.33%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  FL   D  +  L  D+     +IS  + +  L+ C+  G+G HHAGL + DR  VE  F+   + VL +TSTL+ GVN PAHLV+IKGT  F+    +   +    +LQM+GRAGRPQFD+   A+I     +++F  +F
Sbjct:  940 TRLTALDLIAFLAGEDNPKQWLHTDETEMEHIIS-TVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKF 1088          

HSP 2 Score: 81.6481 bits (200), Expect = 7.179e-22
Identity = 43/109 (39.45%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            ++   + +R     G   HHAG+ + DR +VE  F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQ+D   + II+TS ++
Sbjct:  131 ERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDK 239          

HSP 3 Score: 41.9726 bits (97), Expect = 7.179e-22
Identity = 29/125 (23.20%), Postives = 55/125 (44.00%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIP---QIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSG----SETLTSLVC 793
            +L ++LNAE             +W+  ++LY+R+  NP  YG+   S  +A P   +   ++++    KL    +I  D+ T     T  G   + +++ + TI+      G       + S+VC
Sbjct:  260 SLQDNLNAEDEAGLATAAFEAVRWLSYTYLYVRMRANPLAYGI-NHSHYQADPSLHKFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVC 383          
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 73.1738 bits (178), Expect = 3.734e-13
Identity = 44/150 (29.33%), Postives = 86/150 (57.33%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFL---VDQTRFELKFDQIHQLGVISQKISEEKL----RACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 429
            FC T+K+   +A+ +   + +TR  L   +  +  ++++  ++ +L    R  +  G+ +HH+GL   +R ++E ++  G L +L  TSTL+ GVNLPA  V+++     NS +    ++++  QM+GRAGR   D+S  +I + +S ++
Sbjct:  265 FCPTKKNCENVAEMICKYLAKTRHTLHHREEEKRALLAELQADGELCPVLRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSPYIGNSFL----SRSQYKQMVGRAGRAGIDSSGESITIVNSRDK 410          
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 71.633 bits (174), Expect = 1.430e-12
Identity = 36/101 (35.64%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  127 LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 429
            LR  +  G+ +HH+GL   +R ++E ++  G L +L  TSTL+ GVNLPA  V+++     NS +    ++++  QM+GRAGR   D+S  +I + +S ++
Sbjct:  385 LRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSPYIGNSFL----SRSQYKQMVGRAGRAGIDSSGESITIVNSRDK 481          
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Match: HFM1 (Meiosis specific DNA helicase; involved in the conversion of double-stranded breaks to later recombination intermediates and in crossover control; catalyzes the unwinding of Holliday junctions; has ssDNA and dsDNA stimulated ATPase activity [Source:SGD;Acc:S000003220])

HSP 1 Score: 130.183 bits (326), Expect = 3.078e-41
Identity = 66/141 (46.81%), Postives = 92/141 (65.25%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSE 423
            FC TR ST   AKFL++   F     + +         S++ L  C+ +G+ FHHAG+   DR  VE  FL G++ +LCSTSTL++GVNLPA+LV+IKGT ++NS+  Q Y+   +LQMIGRAGRPQF+    A+I+T S+
Sbjct:  377 FCPTRASTISTAKFLLNNHIFSKSKKRCNH------NPSDKILNECMQQGIAFHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQEYSDLDVLQMIGRAGRPQFETHGCAVIMTDSK 511          

HSP 2 Score: 57.7658 bits (138), Expect = 3.078e-41
Identity = 33/120 (27.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  416 VARRSLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYY----------GVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQ 745
            V   SLH+NLIEHL AE +L  +  I++   W++++F Y+R  +NPA Y           V    I +    ++  L+  ++  +SNG          + ++T  G  M R+++ F++++
Sbjct:  525 VLESSLHLNLIEHLAAETSLETVYSIETAVNWLRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLDTLVKVKIIDISNG----------EYKSTAYGNAMTRHYISFESMK 634          
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Match: SLH1 (Putative RNA helicase related to Ski2p; involved in translation inhibition of non-poly(A) mRNAs; required for repressing propagation of dsRNA viruses [Source:SGD;Acc:S000003503])

HSP 1 Score: 103.99 bits (258), Expect = 1.441e-28
Identity = 55/135 (40.74%), Postives = 79/135 (58.52%), Query Frame = 1
Query:   49 DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIE--QTYTQNKLLQMIGRAGRPQFDNSAVAIILTS-SEEEFAHQF 444
            D  R  L  D   +L     +++++ L+  +  G+G HHAGL Q DR I    F    + +L +TSTL+ GVNLPAHLV+IKGT  F++ IE  +      +LQM+GRAGRP +D +  AI+ T  S++ F   F
Sbjct: 1397 DNPRRFLNIDDEEELQYYLSQVTDDTLKLSLQFGIGLHHAGLVQKDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTTGTAIVYTKESKKMFYKHF 1531          

HSP 2 Score: 41.2022 bits (95), Expect = 1.441e-28
Identity = 31/112 (27.68%), Postives = 53/112 (47.32%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKL--SNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRK 757
            SLH  L +HL AEI    + +      ++  +FL+ R   NP YYG+   +    + + +  LI S ++ L  S   L++ D I      TP   + + Y++   TI+ + K
Sbjct: 1541 SLHKVLDDHLGAEITSGSITNKQEALDFLSWTFLFRRAHHNPTYYGIEDDTSTAGVSEHLSSLIDSTLENLRESQCVLLHGDDIV----ATPFLSISSYYYISHLTIRQLLK 1648          

HSP 3 Score: 68.5514 bits (166), Expect = 1.078e-11
Identity = 30/56 (53.57%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  148 GVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNS 315
            G G HHAG+ + DR + E  F  GA+ VLC T+TL+ GVNLPA  V+IKGT  ++S
Sbjct:  594 GFGIHHAGMARSDRNLTEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQVYDS 649          
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Match: BRR2 (RNA-dependent ATPase RNA helicase (DEIH box); required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis; homologous to human U5-200kD [Source:SGD;Acc:S000000974])

HSP 1 Score: 90.8929 bits (224), Expect = 1.692e-24
Identity = 59/151 (39.07%), Postives = 84/151 (55.63%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQ----------TRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFN---SNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT 414
            F  +RK T + A +L ++          T+ +    QI  L   +  + +  LR  I  G+G HHAGL + DR + E  F  G L VL  T+TL+ GVNLPAH V+IKGT  ++    + EQ   Q+ +LQM+GRAGRP++D     II+T
Sbjct:  743 FVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQI--LKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQD-VLQMLGRAGRPRYDTFGEGIIIT 890          

HSP 2 Score: 40.817 bits (94), Expect = 1.692e-24
Identity = 23/100 (23.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTI 742
            L+++LNAE+    +   +    W+  ++LY+R+  +P  Y VP  S    + +    L+ S +  L    L+ +D   + IE T  G + + ++++  ++
Sbjct:  916 LVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDISSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASM 1015          

HSP 3 Score: 41.5874 bits (96), Expect = 1.883e-9
Identity = 37/128 (28.91%), Postives = 54/128 (42.19%), Query Frame = 2
Query:  455 LNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLI---------------NHDQITNKIETTPCGLLMARYFLDFQTIQD-IRKLSGSETLTSLV 790
            LN EIA   +        W   S+ Y RI  NP+YYGV   S    I   +  L+ + ++ L   S I                 D+ T  I T   GL+ + Y + F TIQ  +  LS + TL +++
Sbjct: 1754 LNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTS-PHGISVFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNML 1880          

HSP 4 Score: 38.891 bits (89), Expect = 1.883e-9
Identity = 40/148 (27.03%), Postives = 74/148 (50.00%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIH----QLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVA---IILTS 417
            F  +RK   ++A   +  ++  +++D ++    Q+    +K+++  LRA +  GVG  + G+   D  IV+  +  GA+ VL  +   S         V+I GT+ ++    +   YT N+LL+M+G A      N ++A   +ILTS
Sbjct: 1584 FLPSRKDCMEVASAFMKFSK-AIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKDCS-AFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLAS----GNDSMAGKVLILTS 1725          
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Match: SKI2 (Ski complex component and putative RNA helicase; mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay; mutations in the human ortholog, SKIV2L, causes Syndromic diarrhea/Trichohepatoenteric (SD/THE) syndrome [Source:SGD;Acc:S000004390])

HSP 1 Score: 68.5514 bits (166), Expect = 7.752e-12
Identity = 33/96 (34.38%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            K R+ + RG+  HH GL  + +E++E  F  G + VL +T T +MG+NLP   V+       + N  +  T  +  QM GRAGR   D++   I++
Sbjct:  683 KTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVM 778          
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Match: MTR4 (ATP-dependent 3'-5' RNA helicase of the DExD/H family; involved in nuclear RNA processing and degradation both as a component of TRAMP complex and in TRAMP-independent processes; TRAMP unwinds RNA duplexes, with Mtr4p unwinding activity stimulated by Pap2p/Air2p but not dependent on ongoing polyadenylation; contains an arch domain, with two coiled-coil arms/stalks and a globular fist/KOW domain, which has RNA binding activity and is required for 5.8S rRNA processing [Source:SGD;Acc:S000003586])

HSP 1 Score: 68.1662 bits (165), Expect = 1.126e-11
Identity = 33/95 (34.74%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  145 RGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 429
            RG+G HH+GL  + +E++E  F  G L VL +T T S+G+N+PA  VV      ++    +  +  + +QM GRAGR   D+  + I++   + E
Sbjct:  470 RGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKME 564          
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Match: EDO34884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN39])

HSP 1 Score: 156.377 bits (394), Expect = 1.216e-55
Identity = 68/189 (35.98%), Postives = 116/189 (61.38%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQI 1406
            +  +S+C E +++ LR +E+  +N LNK +    +RFP+ G+I     KI+CL+Q  LGCL + + SL+Q+  KIFR G R+ RC+ + L L      +Y+ L +  L+ KC  ++LW+N+ +VS Q+ ++   ++  L NAG +T  +I  +  + IE I+N+ PPFG  +      FP+YE+++EQ+
Sbjct:  277 VILLSKCKEFADVKLRVSEKRILNTLNKDKHKATVRFPVNGKIKTTDQKINCLIQATLGCLPITEFSLNQDVTKIFRSGQRVTRCLMELLMLRG----DYRALQNAILVTKCMKSRLWENSLYVSRQLEKVGMTLSTMLVNAGLTTFKKIEETNPREIELIVNRHPPFGSQIRDAVLAFPKYEVSVEQV 461          

HSP 2 Score: 80.4925 bits (197), Expect = 1.216e-55
Identity = 43/121 (35.54%), Postives = 69/121 (57.02%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +LIEHLNAEI LH + D+    +W++S+FL+IRI +NP YY                 + I  ++ L   +L+  +   +   + P G LMARY++ F +I++   + G+ETL+ +V
Sbjct:  174 SLHRHLIEHLNAEIVLHTITDVSVALEWLKSTFLFIRIQKNPTYYD----------------MCIQNLNTLERSNLVKMEDGFDLKPSEP-GCLMARYYIAFDSIKEFLAIQGTETLSDMV 277          

HSP 3 Score: 21.557 bits (44), Expect = 1.216e-55
Identity = 8/16 (50.00%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  382 FDNSAVAIILTSSEEE 429
            FD SA A+ILT++ ++
Sbjct:  143 FDTSATAVILTTTTKK 158          
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Match: EDO49146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH22])

HSP 1 Score: 90.1225 bits (222), Expect = 4.591e-28
Identity = 47/118 (39.83%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  103 SQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            ++++   +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  766 AEQVKNGELKDLLPYGFAIHHAGMSRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWVELGALDILQMLGRAGRPQYDTKGEGILITSHGE 875          

HSP 2 Score: 54.6842 bits (130), Expect = 4.591e-28
Identity = 32/109 (29.36%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMK---LIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L ++LNAE+ L  +        W+  ++LYIR+ RNPA YG+    I E  P +  +   LI S    L   +L+ +D+ +   + T  G + + Y+L  +T+     L
Sbjct:  897 LADNLNAEVVLGSVQTAKDAVHWLGYTYLYIRMLRNPALYGISHDEI-EKDPLLEQRRADLIHSAASLLDKNNLLKYDKKSGNFQVTELGRIASHYYLTHETVSTFNNL 1004          

HSP 3 Score: 70.8626 bits (172), Expect = 3.014e-17
Identity = 39/115 (33.91%), Postives = 63/115 (54.78%), Query Frame = 1
Query:  109 KISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIIL-TSSEEEFAHQF 444
            +++++ L+  +  G+ F H GL   + +IV   F  GA+ V+  + TL + VNL AHLVV+  T  +         Y    +L MIG A RP  D++  A+IL  +S++EF  +F
Sbjct: 1603 RLTDKTLKETVTYGIAFLHEGLSDAEVKIVNQLFTSGAIQVVVVSRTLCLSVNLSAHLVVVMDTQFYEGKTHSYADYPVTDVLHMIGHASRPLLDDAGKAVILCQASKKEFFKKF 1717          

HSP 4 Score: 37.7354 bits (86), Expect = 3.014e-17
Identity = 23/103 (22.33%), Postives = 53/103 (51.46%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAE+    + +      ++  +FLY R+  NP YY +  G     +   + +L+ + ++ L     ++   + ++++ TP   G++ A Y++++ TI+
Sbjct: 1732 LHDHFNAEVVTKTIENKQDAVDYLTWTFLYRRMTLNPNYYNL-QGVTHRHLSDHMSELVENTLNDLEQSKCVS---VEDEMDVTPLNLGMIAAYYYINYTTIE 1830          
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Match: EDO46714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC5])

HSP 1 Score: 85.1149 bits (209), Expect = 5.338e-27
Identity = 45/103 (43.69%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  121 EKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSE 423
            ++LR     G G HHAG+ + DR +VE  F  G + VL  T+TL+ GVNLPAH V+IKGT  +++          L  LQ+ GRAGRPQFD      I+T+ +
Sbjct:  774 KQLRDLFPDGFGTHHAGMLRTDRTMVEQYFAKGLIKVLVCTATLAWGVNLPAHAVIIKGTEVYDAKKGSFVDLGILDVLQIFGRAGRPQFDKFGEGTIITAHD 876          

HSP 2 Score: 56.225 bits (134), Expect = 5.338e-27
Identity = 29/112 (25.89%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICE--AIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRK 757
            +L  +L + LNAEI L  + +++   +W+  S+LYIR+ +NP  YG+P     +   +     +LI+S   KL    +I   +    +  T  G   + +++ + TI++  +
Sbjct:  894 TLTASLTDSLNAEICLGTVTNVNEAVEWLSYSYLYIRMIKNPLVYGIPHKDKEDDPTLENYRRQLIVSTARKLDKARMIRFAEEQGYLSATDLGRTASHFYIKYDTIEEFNE 1005          

HSP 3 Score: 96.6709 bits (239), Expect = 1.207e-23
Identity = 54/138 (39.13%), Postives = 78/138 (56.52%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNI--EQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            TR +   L  FL   D  +  L   +  ++  +   + +  L+  +  G+G HHAGL + DR +VE  F+   + VL +TSTL+ GVN PAHLVVIKGT  F+        +    +LQM+GRAGRPQ+D+   A+IL
Sbjct: 1573 TRLTALDLIAFLAAQDDPKQWLHMPE-EEMEQVLHAVRDSNLKLVLSFGIGLHHAGLHERDRSVVEELFVNQKIQVLIATSTLAWGVNFPAHLVVIKGTEYFDGKKCRYVDFPITDVLQMMGRAGRPQYDDQGKAVIL 1709          

HSP 4 Score: 33.4982 bits (75), Expect = 1.207e-23
Identity = 19/105 (18.10%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRK 757
            L +HLNAE+    +        ++  ++ + R+  NP YY +   +  +++ + + +L+ S   +L     +N  + +  +  T    + + Y+L+  T++ +++
Sbjct: 1736 LADHLNAEVVAGTITSKQDAMDYMTWTYFFRRLVMNPTYYDL-QDTDHDSVNKYLSRLVESAAAELELSGCLNTGEDSVSLSPTTAAHIASYYYLNHLTLRMLKE 1839          
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Match: EDO44748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT3])

HSP 1 Score: 75.8702 bits (185), Expect = 1.262e-13
Identity = 51/173 (29.48%), Postives = 91/173 (52.60%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEK------LRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNS--AVAIILTSSEEEFAHQFD*TFECGNRSSSFARYR 495
            FC T+K+   +AK +V+    E+   +I +   + Q +  +       L+  +  G+ +HH+GL   +R+++E ++  G L  L  TSTL+ GVNLPA  V+++       NI +   +++  QMIGRAGR   D++  ++ II T+ + + A  F   F+    S  +  Y+
Sbjct:  273 FCATKKNCENVAKLMVEFLPREMTQVKIGERMELLQALHHQANGLCPVLKKSVPYGIAYHHSGLTMDERKLIEDAYSQGVLCALTCTSTLAAGVNLPAKRVILRA-PYIGRNIIR---KSQYKQMIGRAGRAGIDSTGESILIIKTTDKHKVAPLFSGEFDSCQSSLPYQEYK 441          
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Match: EDO38196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDN7])

HSP 1 Score: 67.0106 bits (162), Expect = 6.068e-11
Identity = 33/96 (34.38%), Postives = 55/96 (57.29%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIIL 411
            +++  + RG+G HH+G+  + +E++E  F  G + +L +T T +MGVN+PA  VV   T   + +  +     + +QM GRAGR   D +   IIL
Sbjct:  344 RMQELLQRGIGVHHSGILPILKEMIEILFQEGLVKLLYATETFAMGVNMPARTVVFDSTRKNDGSSFRDLLPGEYVQMAGRAGRRGKDTTGTVIIL 439          
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 140.584 bits (353), Expect = 7.924e-81
Identity = 90/278 (32.37%), Postives = 148/278 (53.24%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMH 1673
            +  +S+  E SEI LR  E+  +N+ NK +    + FPLKG++ ++ MK++ L+Q  LGC+ + D  L Q+T KIFRIGLRI +      FL       +  L++  +L KCF +KLW+N+ +VS Q+ +I ++ A  + NAG +T  +I     + +E ILN+ PPFG  +       P+Y++ +EQ+         + V V    Q    S+     R Y   + L+IG+ +N V    + ++  L+    W  +I V R S+   L ++LIS  +
Sbjct:  518 VELVSKSKEFSEIQLRVNEKRPLNSFNKDKNRTTI-FPLKGKMKSSDMKVN-LIQAQLGCISIQDFGLTQDTAKIFRIGLRISKLSE---FLGQRSRAGFTALLNSIILAKCFQSKLWENSPYVSKQLEKIQTLSAA-MVNAGLTTFTKIEQINPRELELILNRHPPFGNQIRDSVMHLPKYDVCVEQLPRYNIASAEISVKVILKNQTQLLSKRTSPDRHY---VSLLIGNADNSVVCLHK-LDSILLKCGTWSKKIEVTRASKGDELNVNLISSQY 785          

HSP 2 Score: 124.405 bits (311), Expect = 7.924e-81
Identity = 69/138 (50.00%), Postives = 87/138 (63.04%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILT 414
            FC TRK   Q A  L    RF L  +   QL   +  + + KLR   + G+GFHHAGL   DR++VE +F  G L VL +T TL+MGVNLPAHLVVIK T  +     + Y++  +LQMIGRAGRPQFD SA A+I+T
Sbjct:  263 FCSTRKGAQQSAAILAKDVRFNLSIEH-KQLTKYANSVLDSKLRLVPL-GIGFHHAGLDLSDRKLVEEAFTQGDLSVL-TTRTLAMGVNLPAHLVVIKSTMQYVVGSCEEYSEADILQMIGRAGRPQFDTSATAVIMT 397          

HSP 3 Score: 80.1073 bits (196), Expect = 7.924e-81
Identity = 48/121 (39.67%), Postives = 70/121 (57.85%), Query Frame = 2
Query:  428 SLHINLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            SLH +L+EHLNAEI L  + D++    WI+S+FLYIR  +NP +Y                 L +  ++ LS+  LI+ D+  N I+ T  G LMARY + F T++   K+ GSE+L+ LV
Sbjct:  417 SLHGHLVEHLNAEIVLQTISDVNMALDWIRSTFLYIRALKNPTHY-----------------LCLKNLNSLSSIDLISMDEDIN-IKPT-AGRLMARYCVAFDTMKQFSKVDGSESLSDLV 518          
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 88.5817 bits (218), Expect = 1.389e-31
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  688 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 790          

HSP 2 Score: 53.1434 bits (126), Expect = 1.389e-31
Identity = 29/109 (26.61%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
             L + LNAEI L  +  +     W+  ++LY+R+ RNP  YG+     S    + +  M LI +  + L   SL+ +D+ T   + T  G + + +++   ++Q   +L
Sbjct:  811 KLPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYGISQDDRSADPLLERRRMDLIHTAANVLDKNSLVKYDKRTGAFQVTDLGRIASHFYITHDSVQTYNQL 919          

HSP 3 Score: 36.965 bits (84), Expect = 1.389e-31
Identity = 39/184 (21.20%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   IN+R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +T+  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FPR +L +
Sbjct:  934 SLSSEFKNINVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTMNLCKMIDK----RMWQSMSPLRQFKKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHQFPRLDLAV 1103          

HSP 4 Score: 78.9518 bits (193), Expect = 3.327e-19
Identity = 40/116 (34.48%), Postives = 68/116 (58.62%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIIL-TSSEEEFAHQF 444
            +KI++  L+  +  GVG+ H GL   +R+IVE  F  GA+ V+ S+ +L  G+++ AHLV++  T  +N  I     Y    +LQM+G+A RP  D+    +I+   S+++F  +F
Sbjct: 1517 EKINDPTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKF 1632          

HSP 5 Score: 37.7354 bits (86), Expect = 3.327e-19
Identity = 25/103 (24.27%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1647 LHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGMSHRHLSDHLSELVENTLHDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1745          
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 88.5817 bits (218), Expect = 1.758e-31
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  124 KLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNK----------LLQMIGRAGRPQFDNSAVAIILTSSEE 426
            +L+  +  G   HHAG+ ++DR +VE  F    + VL ST+TL+ GVNLPAH V+IKGT        Q Y+  K          +LQM+GRAGRPQ+D     I++TS  E
Sbjct:  771 ELKDLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGT--------QVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGE 873          

HSP 2 Score: 52.7582 bits (125), Expect = 1.758e-31
Identity = 29/108 (26.85%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTG--SICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKL 760
            L + LNAEI L  +  +     W+  ++LY+R+ RNP  YG+     S    + +  M LI +  + L   SL+ +D+ T   + T  G + + +++   ++Q   +L
Sbjct:  895 LPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYGISQDDRSADPLLERRRMDLIHTAANVLDKNSLVKYDKRTGAFQVTDLGRIASHFYITHDSVQTYNQL 1002          

HSP 3 Score: 36.965 bits (84), Expect = 1.758e-31
Identity = 39/184 (21.20%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  852 SRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSH--QIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTI 1397
            S  SE   IN+R  E+     L   +   ++  P+K  I   S KI+ L+Q  +  L+++  +L  +   + +   R++R + + +          +T+  C ++ K    ++W +   +    ++PE   V  ++  N  F  L  + +++       L + P  G+T+ K    FPR +L +
Sbjct: 1017 SLSSEFKNINVREEEK-----LELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTMNLCKMIDK----RMWQSMSPLRQFKKLPE-EVVKKIEKKNFPFERLYDLNHNEIGE----LIRMPKMGKTIHKYVHQFPRLDLAV 1186          

HSP 4 Score: 78.9518 bits (193), Expect = 3.982e-19
Identity = 40/116 (34.48%), Postives = 68/116 (58.62%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIIL-TSSEEEFAHQF 444
            +KI++  L+  +  GVG+ H GL   +R+IVE  F  GA+ V+ S+ +L  G+++ AHLV++  T  +N  I     Y    +LQM+G+A RP  D+    +I+   S+++F  +F
Sbjct: 1600 EKINDPTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKF 1715          

HSP 5 Score: 37.3502 bits (85), Expect = 3.982e-19
Identity = 25/103 (24.27%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTP--CGLLMARYFLDFQTIQ 745
            L +H NAEI    + +      ++  +FLY R+ +NP YY +  G     +   + +L+ + +  L     I+   I ++++  P   G++ A Y++++ TI+
Sbjct: 1730 LHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNL-QGMSHRHLSDHLSELVENTLHDLEQSKCIS---IEDEMDVAPLNLGMIAAYYYINYTTIE 1828          
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:101173332])

HSP 1 Score: 85.1149 bits (209), Expect = 6.057e-26
Identity = 44/109 (40.37%), Postives = 65/109 (59.63%), Query Frame = 1
Query:  106 QKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEE 426
            Q+   ++++     G G HHAG+ + DR ++ES F  G L VL  T+TL+ GVNLPAH V+IKGT  +++          L  +Q+ GRAGRPQFD      I+T+ ++
Sbjct:  623 QRSRNKQMKEMFPEGFGIHHAGMLRSDRSLMESLFSKGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDK 731          

HSP 2 Score: 54.299 bits (129), Expect = 6.057e-26
Identity = 29/114 (25.44%), Postives = 62/114 (54.39%), Query Frame = 2
Query:  440 NLIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIM---KLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSE 772
            +L ++LNAEIAL  + +++   KW+  ++LY+R+  NP  YG+   +I +  P + +   +L++    +L    +I  ++ T    +T  G   + +++ + TI+   +L  S+
Sbjct:  752 SLADNLNAEIALGTVTNVEEAVKWLSYTYLYVRMRANPLAYGINHKAI-QMDPTLELFRTELVVESGRRLDKAHMIRFEERTGYFASTDLGRTASHFYIRYNTIETFNELFSSQ 864          

HSP 3 Score: 99.3673 bits (246), Expect = 2.260e-25
Identity = 57/150 (38.00%), Postives = 85/150 (56.67%), Query Frame = 1
Query:   10 TRKSTFQLAKFLV--DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQ--TYTQNKLLQMIGRAGRPQFDNSAVAIILTSS-EEEFAHQF 444
            TR +   L  +L   D  +  L  D+  ++  I   + +  L+  +  G+G HHAGL + DR+ VE  F+   + VL +TSTL+ GVN PAHLVV+KGT  ++    +   Y    +LQM+GRAGRPQFD    A+IL    +++F  +F
Sbjct: 1427 TRLTALDLIAYLATEDNPKQWLHQDE-REIEDIIATVRDSNLKLTLAFGIGLHHAGLHERDRKTVEELFVNCKIQVLVATSTLAWGVNFPAHLVVVKGTEYYDGKSRRYVDYPITDVLQMMGRAGRPQFDEQGKAVILVHDIKKDFYKKF 1575          

HSP 4 Score: 38.1206 bits (87), Expect = 2.260e-25
Identity = 25/100 (25.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  443 LIEHLNAEIALHPLLDIDSIYKWIQSSFLYIRIFRNPAYYGVPTGSICEAIPQIIMKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTI 742
            L +HLNAEIA   +        +I  ++ + R+  NP+YY +   S  E+I + +  L+   +  L     I   +    +E    G + + Y+L  Q++
Sbjct: 1590 LSDHLNAEIAAGTISSKQDAMDYITWTYFFRRLVMNPSYYSLADTS-HESINKYLSNLVEQSLRDLEISHCIEIKEDERTVEPLTYGRIASYYYLKHQSV 1688          
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Match: sclt1 (sodium channel and clathrin linker 1 [Source:NCBI gene;Acc:101167852])

HSP 1 Score: 75.8702 bits (185), Expect = 2.764e-13
Identity = 158/708 (22.32%), Postives = 323/708 (45.62%), Query Frame = 1
Query: 3022 SEFDFLKDQVSRLNGVLSNYQEKY--------FEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLR--------NQIDNMPKNFETCFS----EQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQN------------EVTENNMKPQTVIF----------NEQMESMRQMYMNSIQELENE-----------------AVAN-RDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNXXXXXXXXXXXXXLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFT--KLLLASE------------ESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFXXXXXXXXXXWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLERKVNISEDMA------------PFNIE 4887
            +E D+L+DQV RLN  L  YQ+           E++ +  ++   L   +   PL+ EYD+ I +MT+ +++ +  +   ++ ++ + KENERL          Q+ ++P    T       + +  N+Q Q++L  +E+    E+ + ++ E+DRLQ             +     +K Q V F          N+++ES  Q  + ++ E  +E                 A A   ++ + L N  E+ QR+  EL     ++A   +  + AA+  L QL+ +L +++       Q  EAV             ++ W   + +++ +    E++ + A  KV E  ++AE+A + K    +RE Q   E E+ +      +++A VRT++EV+    +    + R+ +EL+  +    +   ++++  R +  +E+E+E +++  R +   E  + +  H R + AE+ +++  L LQ+ +    +   E N        E S  Q+++  L+ S   A ++    +  +L L  E            ++    +KK ++ +    HEY +       K+Q LE R+   E++ R +++++ + L+ QQ+ + + +EEA NL + +E K+  +  E +RQK+R+ E+ + L      I+E  + + E +     L+R++  +E  A            PF+++
Sbjct:    4 AELDYLRDQVRRLNLSLRQYQDGLHPPSTSSQVEEAWRAESSAPWLTDRSLMAPLIAEYDRHIADMTERLRKNQEQMTNLKVQLERVVKENERLHAELKECVEKQLHSLPVASGTSGGTMEEDAIIRNLQEQLELSEQERIKAMELWQTADQELDRLQRIHQQTVSDHEGQDAERRQLKDQLVQFQQHSYKFQVANQKLESTSQQLLKTVAEQSSEMEELHSQLRRAKAELRTATAKVEEMTKLLQNLQEQIQRREEEL-----LEA---QGRESAADRRLQQLQGTLSQLETRLTAASQEAEAVH----------REQAVWEKKVGELQARCTTLEEEKHQALSKVRENIQLAEEATLHKDQALLREKQKTEELEKTKEAFKLFIQEAAVRTRKEVENERKQCNIRIHRMSEELSVLQLECADKQSQIERSLRERKAVEEELERVYKEGRAEP--ELQKIDALHQRCLDAERLKDDALLTLQTTQKKLKKMEMEHN-------EELSRCQEEMRRLRSSLAAAHNDGVSVSEERLQLQHENLQLRREMEELRKATMLVQKKAKQEVSQMEHEYSV-------KEQGLEARVRELEESSRSSSADLTRLLAAQQKSAQRRKEEAKNLVQAFEAKITGLKMELNRQKQRSRELQAQLERDHDTIMEYEKQLGEHQEKAGRLQRRLTQAEQKAASAVQQVGPCRLPFHVQ 677          
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Match: SMESG000065400.1 (SMESG000065400.1)

HSP 1 Score: 1449.11 bits (3750), Expect = 0.000e+0
Identity = 707/723 (97.79%), Postives = 708/723 (97.93%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLDNKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSKSFKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA 3008
            ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQ               ETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLDNKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSK+FKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA
Sbjct:   61 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQ---------------ETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLDNKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSKNFKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA 768          

HSP 2 Score: 123.635 bits (309), Expect = 4.364e-28
Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 2
Query:  608 MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSL+
Sbjct:    1 MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLI 61          
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Match: SMESG000065400.1 (SMESG000065400.1)

HSP 1 Score: 1440.63 bits (3728), Expect = 0.000e+0
Identity = 707/732 (96.58%), Postives = 708/732 (96.72%), Query Frame = 3
Query:  840 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLD---------NKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSKSFKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA 3008
            ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQ               ETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLD         NKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSK+FKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA
Sbjct:   61 ISFISRCSELSEINLRYTERGFMNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQ---------------ETDKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTWFVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTVIKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFYNDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCIDLISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLDYDRNLLSKDNKLPSCPLDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRKNTSPVIVSKNFKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVMSKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQMLNMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQKFVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKIPNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSFSNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISELSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASKA 777          

HSP 2 Score: 123.25 bits (308), Expect = 4.679e-28
Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 2
Query:  608 MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLV 790
            MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSL+
Sbjct:    1 MKLIISEVDKLSNGSLINHDQITNKIETTPCGLLMARYFLDFQTIQDIRKLSGSETLTSLI 61          
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Match: SMESG000065404.1 (SMESG000065404.1)

HSP 1 Score: 1279.23 bits (3309), Expect = 0.000e+0
Identity = 673/674 (99.85%), Postives = 673/674 (99.85%), Query Frame = 1
Query: 3010 MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNXXXXXXXXXXXXXLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFXXXXXXXXXXWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLERKVNISEDMAPFNIEVDSSDLDNSGWXXXXXXXXXXRIVKESVARKFDFSPKFSCKPETSSFR 5031
            MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNRAIRAEKEREEIRLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFLSKQQQLSSKWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLE KVNISEDMAPFNIEVDSSDLDNSGWQLQQFKKQQQRIVKESVARKFDFSPKFSCKPETSSFR
Sbjct:    1 MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNRAIRAEKEREEIRLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFLSKQQQLSSKWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLESKVNISEDMAPFNIEVDSSDLDNSGWQLQQFKKQQQRIVKESVARKFDFSPKFSCKPETSSFR 674          
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Match: SMESG000065404.1 (SMESG000065404.1)

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 655/656 (99.85%), Postives = 655/656 (99.85%), Query Frame = 1
Query: 3010 MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNXXXXXXXXXXXXXLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFXXXXXXXXXXWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLERKVNISEDMAPFNIEVDSSDLDNSGWXXXXXXXXXXRIVKESVAR 4977
            MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNRAIRAEKEREEIRLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFLSKQQQLSSKWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLE KVNISEDMAPFNIEVDSSDLDNSGWQLQQFKKQQQRIVKESVAR
Sbjct:    1 MNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFNNHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQIDNMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEVTENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEKQQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQLLEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAYKIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVANKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDREKSFQENSQEEINHNRAIRAEKEREEIRLQLQSAENGFTRERAEWNRQREAFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQESLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFLSKQQQLSSKWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILESHEVIDEQKRTIELLESKVNISEDMAPFNIEVDSSDLDNSGWQLQQFKKQQQRIVKESVAR 656          
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Match: SMESG000065396.1 (SMESG000065396.1)

HSP 1 Score: 295.819 bits (756), Expect = 8.384e-88
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 1
Query:    1 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 429
            FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE
Sbjct:  322 FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 464          
The following BLAST results are available for this feature:
BLAST of Helicase for meiosis 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HFM11.799e-10335.03helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGN... [more]
HFM13.220e-3830.61helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGN... [more]
SNRNP2008.993e-3042.34small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
SNRNP2001.395e-2842.34small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ASCC35.344e-2638.46activating signal cointegrator 1 complex subunit 3... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y54E2A.41.914e-3243.86pep chromosome:WBcel235:II:14754622:14778149:1 gen... [more]
Y54E2A.42.484e-3243.86pep chromosome:WBcel235:II:14768462:14778149:1 gen... [more]
snrp-2009.179e-3035.95Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
helq-16.098e-1643.14HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
helq-11.750e-1543.14HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(3)72Ab4.385e-3240.91gene:FBgn0263599 transcript:FBtr0075527[more]
obe1.140e-2846.72gene:FBgn0038344 transcript:FBtr0083147[more]
tst3.609e-1237.89gene:FBgn0039117 transcript:FBtr0334895[more]
tst3.609e-1237.89gene:FBgn0039117 transcript:FBtr0084462[more]
DNApol-theta1.924e-1144.55gene:FBgn0002905 transcript:FBtr0082662[more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hfm13.352e-9831.95helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ascc38.255e-3037.50activating signal cointegrator 1 complex subunit 3... [more]
snrnp2008.998e-3042.34small nuclear ribonucleoprotein 200 (U5) [Source:Z... [more]
snrnp2008.998e-3042.34small nuclear ribonucleoprotein 200 (U5) [Source:Z... [more]
sclt15.930e-2122.75sodium channel and clathrin linker 1 [Source:ZFIN;... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hfm15.881e-11133.90HFM1, ATP-dependent DNA helicase homolog [Source:N... [more]
SNRNP2002.159e-2842.34small nuclear ribonucleoprotein, U5 200kDa subunit... [more]
gipc12.859e-2540.37GIPC PDZ domain containing family member 1 [Source... [more]
gipc12.907e-2540.37GIPC PDZ domain containing family member 1 [Source... [more]
gipc12.980e-2540.37GIPC PDZ domain containing family member 1 [Source... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hfm19.023e-10335.35HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Hfm19.023e-10335.35HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Hfm11.531e-3731.65HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Snrnp2008.438e-3043.27small nuclear ribonucleoprotein 200 (U5) [Source:M... [more]
Ascc31.682e-2637.33activating signal cointegrator 1 complex subunit 3... [more]
back to top
BLAST of Helicase for meiosis 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RUV5|HFM1_XENTR3.024e-11033.90Probable ATP-dependent DNA helicase HFM1 OS=Xenopu... [more]
sp|A2PYH4|HFM1_HUMAN8.014e-10335.03Probable ATP-dependent DNA helicase HFM1 OS=Homo s... [more]
sp|D3Z4R1|HFM1_MOUSE5.516e-10235.35Probable ATP-dependent DNA helicase HFM1 OS=Mus mu... [more]
sp|Q5D892|MER3_ARATH3.542e-6142.38DExH-box ATP-dependent RNA helicase DExH17 OS=Arab... [more]
sp|B6DMK2|MER3_ORYSJ4.591e-6042.38ATP-dependent DNA helicase MER3 homolog OS=Oryza s... [more]
back to top
BLAST of Helicase for meiosis 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3L8535.359e-10833.90Probable ATP-dependent DNA helicase HFM1 OS=Xenopu... [more]
A0A1L8GMZ34.617e-10732.44Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
F7ARR83.157e-10634.38Helicase for meiosis 1 OS=Monodelphis domestica OX... [more]
G1L0V44.249e-10533.13Helicase for meiosis 1 OS=Ailuropoda melanoleuca O... [more]
A0A3Q7VWX04.284e-10533.54probable ATP-dependent DNA helicase HFM1 OS=Ursus ... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hfm13.844e-10232.09helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
snrnp2001.106e-2843.27small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ascc32.336e-1736.84activating signal cointegrator 1 complex subunit 3... [more]
polq7.217e-1242.00DNA polymerase theta [Source:NCBI gene;Acc:1030397... [more]
skiv2l3.862e-1135.71Ski2 like RNA helicase [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003190.13.703e-7332.63pep scaffold:Pmarinus_7.0:GL480029:355:29241:-1 ge... [more]
ascc31.654e-2239.33activating signal cointegrator 1 complex subunit 3... [more]
ascc31.655e-2239.33activating signal cointegrator 1 complex subunit 3... [more]
helq3.734e-1329.33helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
helq1.430e-1235.64helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HFM13.078e-4146.81Meiosis specific DNA helicase; involved in the con... [more]
SLH11.441e-2840.74Putative RNA helicase related to Ski2p; involved i... [more]
BRR21.692e-2439.07RNA-dependent ATPase RNA helicase (DEIH box); requ... [more]
SKI27.752e-1234.38Ski complex component and putative RNA helicase; m... [more]
MTR41.126e-1134.74ATP-dependent 3'-5' RNA helicase of the DExD/H fam... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348841.216e-5535.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491464.591e-2839.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467145.338e-2743.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447481.262e-1329.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381966.068e-1134.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hfm17.924e-8132.37helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
snrnp2001.389e-3142.34small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
snrnp2001.758e-3142.34small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ascc36.057e-2640.37activating signal cointegrator 1 complex subunit 3... [more]
sclt12.764e-1322.32sodium channel and clathrin linker 1 [Source:NCBI ... [more]
back to top
BLAST of Helicase for meiosis 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065400.14.364e-2897.79SMESG000065400.1[more]
SMESG000065400.14.679e-2896.58SMESG000065400.1[more]
SMESG000065404.10.000e+099.85SMESG000065404.1[more]
SMESG000065404.10.000e+099.85SMESG000065404.1[more]
SMESG000065396.18.384e-88100.00SMESG000065396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030220 ID=SMED30030220|Name=Helicase for meiosis 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5281bp
TTTTGCATGACTCGTAAGAGCACCTTTCAACTTGCCAAATTTCTGGTCGA
TCAAACGCGATTTGAATTAAAGTTTGATCAGATCCATCAATTGGGCGTTA
TAAGTCAAAAGATTTCCGAAGAAAAGTTACGAGCTTGTATTATTCGTGGC
GTTGGTTTTCATCATGCGGGATTATGTCAACTGGATCGAGAAATTGTTGA
GAGCTCATTTTTGTGTGGAGCCTTACCCGTGTTATGTTCCACATCTACTT
TGTCCATGGGAGTCAATTTGCCGGCACATTTAGTAGTTATTAAAGGAACC
TCAAATTTTAACTCTAATATTGAGCAAACATATACTCAAAATAAATTATT
ACAAATGATCGGTAGGGCGGGTCGGCCGCAATTTGACAACAGTGCCGTGG
CCATAATTTTGACTAGTAGCGAGGAGGAGTTTGCACATCAATTTGATTGA
ACATTTGAATGCGGAAATCGCTCTTCATCCTTTGCTAGATATCGATTCAA
TTTATAAGTGGATCCAATCGTCATTCTTATATATTAGAATATTTAGAAAT
CCTGCTTATTATGGAGTACCTACTGGTTCAATTTGTGAAGCAATTCCTCA
AATAATCATGAAATTGATAATTAGTGAAGTGGACAAATTATCTAACGGAT
CACTAATAAATCATGATCAAATCACTAATAAAATAGAAACAACTCCTTGT
GGGCTATTAATGGCTCGCTATTTTTTAGATTTTCAAACCATTCAAGATAT
TCGAAAGTTAAGTGGTTCAGAAACGTTAACTAGTTTGGTATGCCCTAGAA
CAATCTTTCGATTGACATTGAAATAATATTTGCTATTAGATTAGTTTCAT
TTCTCGTTGTTCGGAACTAAGTGAGATCAACTTAAGATATACAGAAAGGG
GATTCATGAATAATTTGAATAAACATAGAGGACCCAATAAGCTAAGATTC
CCCTTAAAAGGGCGTATAATGAACGCCTCGATGAAAATCGATTGTTTAGT
GCAAGTGATTCTAGGATGTCTGGAAGTAGACGATTCCTCTCTCCACCAGG
AGACAGATAAAATATTTAGAATCGGACTAAGAATCCTTCGATGTGTCCAT
GATTACTTGTTTCTATTATCTTCCGATTGTGACAACTATCAGACTCTTGT
TAGTTGTACTTTACTGAAGAAATGTTTTGTCGCAAAACTCTGGGACAATA
CCTGGTTTGTGTCTCACCAGATTCCTGAAATTAATTCAGTTATGGCTGTT
CAACTTACAAATGCGGGATTCAGTACTCTAAATAGAATTGCCAATTCCCA
GGCTCAAGCTATTGAATCTATTTTGAATAAGACTCCTCCATTCGGTCAAA
CTGTGATTAAGCGTGCAAGTGGTTTCCCCAGATATGAATTGACAATTGAA
CAAATCGGTGAAAAAGAGTCAAATATGTGTTCACTTCATGTTTTTGTAAC
TAGGATGAGACAAAAATCTGATCAATCGGAAGTTGATTGTGATATTCGAT
TTTACAATGACTCTATGCTCCTAATAATTGGCGATCTCAATAATCATGTG
CATTACAAATCCAGAATTATGAATCATCAGTTGGTTAATAGTACAGTTTG
GCGAGCAGAAATCATTGTCAATCGAATTTCGGAAGATCCTACTTTGTGTA
TTGATTTAATAAGTGAAATGCACGTGGGATTTGATATTCGAACGAAATTC
AAGCCAAATTATTTAAATTACATTGAAAGTCAAACAAAAATTTCCAAACA
AAATCCGGAGAAATTTACAAACTCTAAACTTGATAATAAACTCCCGAGTT
GTCCTCTTGATAAAAACTTAACATGTGATACTCCTATTGCTACCAAAGTG
AAAGTTTTCCCCTGGAAAACTTGTAAAATATCCAGAAACATGTCGCTAAT
TTCTAGCTATAGACAGTCGTGTTCAACAACTTCTTTCGATCATTCCAAAA
GAAAAAATACTTCCCCAGTAATTGTATCGAAGAGTTTTAAGAGTGCATGT
CTACAATATCCTACTCAATTATCGTGTGGTAGAGATATGTCAGTTGATCT
CGATAAATCGGCAAGTTTCAATGAGTTCTCTGATGATAGTTTCGACGAAG
TAATGAGCAAAATTGATGAAGAATCCTTTAATAACTCATTTATCCAAATT
GACAATTTCCCGGTTTCCAGCACTCCTATTGTAAAAAATCTATCATCACA
CAATCCTATGAAAAATATTAATGCAAATGATTTTAAATCTTTCAATCAAA
TGTTGAATATGAATGCTGAGTCGCCAATCCTGCCAGTTTGTGCAATAGAA
CGTGACATCAATGTTCCACTTGTCCAAACAATAAAAATTGGCAGTCACAA
TAATACTCAAAAATCCTTTGAAATTTCACCAACTACCCAAAATTCTTCTC
AAAAGTTTGTAAATAGCGGGTTTATTAGAACGAAAAGCTATAATTCATGC
TGGGAAATGTTTTCTTTGCCTATGACCAAATCTGTGCGTGAAAGTGATTT
GCTACCGACAGTAAATAACGGTCTGCTATACACAAGTCAACCCATTGATA
AGATTCCAAATACGCTCACAGAGTGGACTGATCCAATTGCAGATAGAAGT
CTAGTGGATTCAATAAATGATCTCAATACTGATATGATGCATAATCCAAG
TACTGTGGAATTTCCCCATCTTAAAATCAAATCGACGGGCACATCAAATT
CATTTTCAAACCCTTTCTTATCATCAATTAATTCTGAAGATCTGAGGCAT
ATAAATGTTGGAGAAAAGTTATTAAATGTTGACAGCATCTCTCATTTGGA
CAGTTACCAGAACACGGAATTAATGGATAAATCCAACGCGGCAAACATTT
CAGAGTTATCTGTTCATCATTCAAGACAACTAGGAATAGTCAACGGTAAT
CCTGGCACTAATATTCCGTCACCATCGATGGTATCGTTTTATAATCAAGG
ATGGGACGCACTTTTTGATTTTATTAAAATGCGCTCGCTTTTGAATGCAT
CAAAAGCATATGAATACACAATCAGAATTTGATTTTCTCAAAGATCAAGT
AAGCCGATTAAATGGTGTACTGTCGAATTATCAAGAAAAGTATTTCGAAC
AATCAGAAAAAAAGGGCAATAATGATATTAAGTTAATATTTAACAATCAT
ACAACGCCATTGCTGATGGAATATGACAAAGTAATTTTCGAAATGACTAA
GGAAATTCAAGAATTTAAAACCTACGTTGAGCAGGAACAAATGTCAGTCA
AAGCGATCACTAAAGAAAACGAACGTTTGCGGAATCAGATAGACAATATG
CCGAAGAATTTTGAAACATGTTTCAGCGAGCAATTGAAAGTGAATATGCA
GGCCCAAATAGATTTGATGATAAAGGAGAAAAATAGTCTACAAGAAATGT
TGAGGATTTCTGAACTGGAAGTCGATCGATTGCAGAACGAAGTGACTGAG
AACAATATGAAACCTCAGACAGTAATATTTAACGAGCAAATGGAATCAAT
GCGACAAATGTATATGAACTCAATCCAAGAACTTGAAAACGAAGCAGTTG
CCAATAGAGACATCAAAAGAGATCTCAGTAACGAGCTGGAGAAACAACAG
AGACAGAATTTGGAACTGGAGAAGGAAAACAAAATCCAGGCTGATAAATT
AAAATTTGAGAAAGAAGCTGCTGAAGAAAATCTCAACCAGCTCAAATCCA
GTTTGAAAAGAATTGATCTTCTAAACAACGAAAAAAAACAATTGCTGGAG
GCTGTCGACGCATTAAGGACGGAAATAAAGAATCATGATTCGGTAAAGAG
TGAATGGTGTACGACATTGTCAGATATAGAGGTGAAGTACAATGAAAAAG
AACAGCAAGTATATGATGCGTCCCAAAAGGTGTCTGAAGCCTATAAAATT
GCTGAGGATGCTGCTGTCGAGAAGAAAGCTATTGAAATCAGAGAAATGCA
AGCTCTTGGCGAATGTGAACGATTGAGAGGAGTAATATCGGGCATTTTGG
AGGATGCTGGAGTCAGAACTAAAGAAGAAGTCGATTTAGTGGCCAATAAG
TACGAGAAGGAAATGGAAAGAGTTATGGATGAATTAAATTTCTGTGAACA
GAATAGGCAGGAATTGATAGTGGAATTAGATCAGATGAAAAGGAGCAAAT
CTCAATTAGAACAAGAGATGGAATTGCTGCATAGATCTGATCGAGAAAAA
TCATTCCAGGAAAATTCACAGGAAGAAATAAACCACAATCGTGCAATTAG
AGCAGAAAAGGAGCGTGAAGAAATTCGTTTACAACTTCAGTCAGCAGAAA
ATGGATTTACAAGAGAAAGAGCAGAATGGAACCGACAAAGAGAGGCTTTT
GAAAATGAGAATAGTTTCATGCAAAAGAAATTGTCAAACCTCCAAATGTC
TTGTGATAAAGCTCAGTCCAATGCCGATAGATTCACTAAATTGCTGTTGG
CGTCTGAAGAAAGTGCAACAAAAAATCGGAAGAAATATCAAGAATCTCTA
AGAAATTGCCGACATGAATATGAACTGCTCAAACAAGCATCACAAATGAA
GCAGCAAGAATTAGAGACGAGATTAGCATCGGCAGAGGACACTCAGAGAC
ACACAACTTCAGAAATGCGACAATTCTTAAGCAAACAGCAACAACTCAGT
TCCAAATGGCGAGAAGAAGCACATAACCTGTCAGAGCAATATGAACAAAA
ATTGAAACAAATTACCAAAGAGTTTGATAGACAGAAGAAAAGAAACGATG
AAATGATTTCATTACTTCATGAATCCAAACAAGAAATTTTAGAGAGTCAT
GAAGTCATTGATGAACAGAAGCGGACGATTGAATTGCTGGAAAGAAAAGT
AAACATATCGGAGGACATGGCACCGTTCAATATTGAGGTGGATTCCTCGG
ATCTAGATAATTCCGGTTGGCAGCTGCAGCAGTTCAAGAAGCAGCAACAG
CGAATTGTCAAGGAGTCCGTTGCGAGGAAATTTGATTTTTCTCCGAAATT
CTCCTGTAAACCAGAAACTAGCAGCTTTCGATAACATTGAGGAATGTGAA
GCGTGAGAATTGAGGCATTTGATAAAATCGCTCACTGAAAGTCCGGTGTG
GCATATTGGATATTTATTAGTGATCTTCTATGTCAACTCGTGAATCTCTG
TTCTGCTCGTTTTATCTTGTTACCTTTCGTCATTTGTGGATGATGTGATA
TTTATTTCGAGTTTTTCCGGGTTTCCAGTGTCACTAAATATAATCCCCCT
TAAATCAATAAGGATATAATATATTTTGGCT
back to top

protein sequence of SMED30030220-orf-1

>SMED30030220-orf-1 ID=SMED30030220-orf-1|Name=SMED30030220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
FCMTRKSTFQLAKFLVDQTRFELKFDQIHQLGVISQKISEEKLRACIIRG
VGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGT
SNFNSNIEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEEFAHQFD*
back to top

protein sequence of SMED30030220-orf-2

>SMED30030220-orf-2 ID=SMED30030220-orf-2|Name=SMED30030220-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=709bp
MNNLNKHRGPNKLRFPLKGRIMNASMKIDCLVQVILGCLEVDDSSLHQET
DKIFRIGLRILRCVHDYLFLLSSDCDNYQTLVSCTLLKKCFVAKLWDNTW
FVSHQIPEINSVMAVQLTNAGFSTLNRIANSQAQAIESILNKTPPFGQTV
IKRASGFPRYELTIEQIGEKESNMCSLHVFVTRMRQKSDQSEVDCDIRFY
NDSMLLIIGDLNNHVHYKSRIMNHQLVNSTVWRAEIIVNRISEDPTLCID
LISEMHVGFDIRTKFKPNYLNYIESQTKISKQNPEKFTNSKLDNKLPSCP
LDKNLTCDTPIATKVKVFPWKTCKISRNMSLISSYRQSCSTTSFDHSKRK
NTSPVIVSKSFKSACLQYPTQLSCGRDMSVDLDKSASFNEFSDDSFDEVM
SKIDEESFNNSFIQIDNFPVSSTPIVKNLSSHNPMKNINANDFKSFNQML
NMNAESPILPVCAIERDINVPLVQTIKIGSHNNTQKSFEISPTTQNSSQK
FVNSGFIRTKSYNSCWEMFSLPMTKSVRESDLLPTVNNGLLYTSQPIDKI
PNTLTEWTDPIADRSLVDSINDLNTDMMHNPSTVEFPHLKIKSTGTSNSF
SNPFLSSINSEDLRHINVGEKLLNVDSISHLDSYQNTELMDKSNAANISE
LSVHHSRQLGIVNGNPGTNIPSPSMVSFYNQGWDALFDFIKMRSLLNASK
AYEYTIRI*
back to top

protein sequence of SMED30030220-orf-3

>SMED30030220-orf-3 ID=SMED30030220-orf-3|Name=SMED30030220-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MHQKHMNTQSEFDFLKDQVSRLNGVLSNYQEKYFEQSEKKGNNDIKLIFN
NHTTPLLMEYDKVIFEMTKEIQEFKTYVEQEQMSVKAITKENERLRNQID
NMPKNFETCFSEQLKVNMQAQIDLMIKEKNSLQEMLRISELEVDRLQNEV
TENNMKPQTVIFNEQMESMRQMYMNSIQELENEAVANRDIKRDLSNELEK
QQRQNLELEKENKIQADKLKFEKEAAEENLNQLKSSLKRIDLLNNEKKQL
LEAVDALRTEIKNHDSVKSEWCTTLSDIEVKYNEKEQQVYDASQKVSEAY
KIAEDAAVEKKAIEIREMQALGECERLRGVISGILEDAGVRTKEEVDLVA
NKYEKEMERVMDELNFCEQNRQELIVELDQMKRSKSQLEQEMELLHRSDR
EKSFQENSQEEINHNRAIRAEKEREEIRLQLQSAENGFTRERAEWNRQRE
AFENENSFMQKKLSNLQMSCDKAQSNADRFTKLLLASEESATKNRKKYQE
SLRNCRHEYELLKQASQMKQQELETRLASAEDTQRHTTSEMRQFLSKQQQ
LSSKWREEAHNLSEQYEQKLKQITKEFDRQKKRNDEMISLLHESKQEILE
SHEVIDEQKRTIELLERKVNISEDMAPFNIEVDSSDLDNSGWQLQQFKKQ
QQRIVKESVARKFDFSPKFSCKPETSSFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000712resolution of meiotic recombination intermediates
GO:0045162clustering of voltage-gated sodium channels
GO:0006281DNA repair
GO:0006307DNA dealkylation involved in DNA repair
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0008283cell proliferation
GO:0032508DNA duplex unwinding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038911SCLT1
IPR004179Sec63-dom
IPR001650Helicase_C
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0043140ATP-dependent 3'-5' DNA helicase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
GO:0005829cytosol
GO:0016020membrane
GO:0099053activating signal cointegrator 1 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 552..583
NoneNo IPR availableCOILSCoilCoilcoord: 495..533
NoneNo IPR availableCOILSCoilCoilcoord: 417..437
NoneNo IPR availableCOILSCoilCoilcoord: 442..469
NoneNo IPR availableCOILSCoilCoilcoord: 78..105
NoneNo IPR availableCOILSCoilCoilcoord: 115..149
NoneNo IPR availableCOILSCoilCoilcoord: 163..267
NoneNo IPR availableCOILSCoilCoilcoord: 605..625
NoneNo IPR availableCOILSCoilCoilcoord: 343..398
IPR038911Sodium channel and clathrin linker 1PANTHERPTHR35970FAMILY NOT NAMEDcoord: 10..624