BAR domain-containing protein

Overview
NameBAR domain-containing protein
Smed IDSMED30030202
Length (bp)3133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BAR domain-containing protein (SMED30030202) t-SNE clustered cells

Violin plots show distribution of expression levels for BAR domain-containing protein (SMED30030202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BAR domain-containing protein (SMED30030202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BAR domain-containing protein (SMED30030202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030202SMESG000043769.1 SmedASXL_053279SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermal cellSMED30030202SMESG000043769.1 dd_Smed_v4_5879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30030202SMESG000043769.1 dd_Smed_v6_5879_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030202SMESG000043769.1 dd_Smed_v4_5879_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30030202SMESG000043769.1 dd_Smed_v4_5879_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030202SMESG000043769.1 dd_Smed_v4_5879_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 83.1889 bits (204), Expect = 3.798e-16
Identity = 66/243 (27.16%), Postives = 107/243 (44.03%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     R + E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 71.2478 bits (173), Expect = 2.994e-12
Identity = 68/264 (25.76%), Postives = 109/264 (41.29%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNA------YTTLGRAAL---------------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A       + L  A L               E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 262          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 69.3218 bits (168), Expect = 4.165e-12
Identity = 39/131 (29.77%), Postives = 62/131 (47.33%), Query Frame = 3
Query:  363 SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
             + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     R + E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:   11 GTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 141          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 68.5514 bits (166), Expect = 2.537e-11
Identity = 68/272 (25.00%), Postives = 109/272 (40.07%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNA------YTTLGRAAL-----------------------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A       + L  A L                       E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSQLNSARLEGDNIMVNFSYMLNFLHVKWLKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 270          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 67.3958 bits (163), Expect = 5.649e-11
Identity = 68/262 (25.95%), Postives = 115/262 (43.89%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------------GTVLQSPLEETK---FYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAAL--------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            ++ ++ K+ + AG    R  Q  EE F    +TE    +++ + + D     T+K++   EV LQ N        ++EEF               G +L   + +       ++ + K L+KV + + +LG A   +I   S +++  LR  LE D K   +E  +L+N RLD D  K R+  A     +A L        E+E    + EF+   E T    + + S    H   L EFV+ Q  YY  C +++  L ++L
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPS-----ARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQL 257          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800045:3802767:-1 gene:WBGene00001335.1 transcript:F35A5.8c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 74.7146 bits (182), Expect = 7.554e-14
Identity = 62/249 (24.90%), Postives = 117/249 (46.99%), Query Frame = 3
Query:   99 KMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQI-------EEFGTVLQSPLEETKFY----------SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            K+ + AG    R  Q  EE FL   RTE    +++ +++ D     T++L+S  E +LQ N  P  +M ++       ++ G + Q+ LE+              ++ +   L+KV + +N+LG A      + +   +  +R+ LE D+K  ++E ++L + RLD D  K+R+  A T   +   E +    + EF+   E T    + + +        L++FVE Q ++Y    + ++ L R+L  
Sbjct:    7 KIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPN--PTVRMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELSG 253          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800737:3802771:-1 gene:WBGene00001335.1 transcript:F35A5.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 70.0922 bits (170), Expect = 9.290e-13
Identity = 66/262 (25.19%), Postives = 120/262 (45.80%), Query Frame = 3
Query:   99 KMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQI-------EEFGTVLQSPLEETKFY----------SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYT----------TLGRAALEKEFEKVR---HEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            K+ + AG    R  Q  EE FL   RTE    +++ +++ D     T++L+S  E +LQ N  P  +M ++       ++ G + Q+ LE+              ++ +   L+KV + +N+LG A      + +   +  +R+ LE D+K  ++E ++L + RLD D  K+R+  A T          T G   +E+    VR    EF+   E T    + + +        L++FVE Q ++Y    + ++ L R+L  
Sbjct:    7 KIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPN--PTVRMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVTNSKTSGGFTIEQAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELSG 266          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800045:3802771:-1 gene:WBGene00001335.1 transcript:F35A5.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 70.0922 bits (170), Expect = 2.570e-12
Identity = 66/262 (25.19%), Postives = 120/262 (45.80%), Query Frame = 3
Query:   99 KMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQI-------EEFGTVLQSPLEETKFY----------SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYT----------TLGRAALEKEFEKVR---HEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            K+ + AG    R  Q  EE FL   RTE    +++ +++ D     T++L+S  E +LQ N  P  +M ++       ++ G + Q+ LE+              ++ +   L+KV + +N+LG A      + +   +  +R+ LE D+K  ++E ++L + RLD D  K+R+  A T          T G   +E+    VR    EF+   E T    + + +        L++FVE Q ++Y    + ++ L R+L  
Sbjct:    7 KIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPN--PTVRMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVTNSKTSGGFTIEQAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELSG 266          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086559)

HSP 1 Score: 93.9745 bits (232), Expect = 5.383e-20
Identity = 70/250 (28.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKDL------VKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            +V  ++  AG+T+ R+ Q  EE      RTEY + +++  ++ D     T+K++ D E  L  N  P +++      +IE+      S LE            F +DL      +KVG+ + KLG   + +I      + + LRK L+ ++K   +E  ILE  RLD D  KNR+  A + LG+ + E++    + EF+   E T      + +    H   L  F++ Q  YY+ C   +  L R+L N
Sbjct:    9 NVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPN--PQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELAN 256          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0113098)

HSP 1 Score: 91.6633 bits (226), Expect = 2.609e-19
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKDL------VKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            +V  ++  AG+T+ R+ Q  EE      RTEY + +++  ++ D     T+K++ D E  L  N  P +++      +IE+      S LE            F +DL      +KVG+ + KLG   + +I      + + LRK L+ ++K   +E  ILE  RLD D  KNR+  A + LG+ + E++    + EF+   E T      + +    H   L  F++ Q  YY+ C   +  L R+L
Sbjct:    9 NVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPN--PQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 254          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086558)

HSP 1 Score: 85.1149 bits (209), Expect = 5.302e-17
Identity = 70/262 (26.72%), Postives = 117/262 (44.66%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKDL------VKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAA------------LEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            +V  ++  AG+T+ R+ Q  EE      RTEY + +++  ++ D     T+K++ D E  L  N  P +++      +IE+      S LE            F +DL      +KVG+ + KLG   + +I      + + LRK L+ ++K   +E  ILE  RLD D  KNR+  A + LG+ +             E++    + EF+   E T      + +    H   L  F++ Q  YY+ C   +  L R+L N
Sbjct:    9 NVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPN--PQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELAN 268          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0113097)

HSP 1 Score: 82.8037 bits (203), Expect = 2.311e-16
Identity = 69/260 (26.54%), Postives = 116/260 (44.62%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKDL------VKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAA------------LEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            +V  ++  AG+T+ R+ Q  EE      RTEY + +++  ++ D     T+K++ D E  L  N  P +++      +IE+      S LE            F +DL      +KVG+ + KLG   + +I      + + LRK L+ ++K   +E  ILE  RLD D  KNR+  A + LG+ +             E++    + EF+   E T      + +    H   L  F++ Q  YY+ C   +  L R+L
Sbjct:    9 NVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPN--PQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 266          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 82.0333 bits (201), Expect = 4.820e-16
Identity = 71/266 (26.69%), Postives = 115/266 (43.23%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK--MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNEN--FWKIFQNEISP 833
            +E +V ++   AGT L R  Q  EE F    +TE     +  + + +     T+K++   EV LQ N          E +DK   T+      + Q  ++    +   + +   L+K G+ +  LG A   +I   +  ++   R  +E D K   +E ++L+N RLD D  KNRM  A     R+A E E    + EF+   E T    + + S    H   L +FV+ Q  YY  C +    L ++L ++   F   F N   P
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNVRVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQLGSQTAIFPSTFSNNNQP 266          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 81.6481 bits (200), Expect = 6.718e-16
Identity = 71/264 (26.89%), Postives = 114/264 (43.18%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK--MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISP 833
            +E +V ++   AGT L R  Q  EE F    +TE     +  + + +     T+K++   EV LQ N          E +DK   T+      + Q  ++    +   + +   L+K G+ +  LG A   +I   +  ++   R  +E D K   +E ++L+N RLD D  KNRM  A     R+A E E    + EF+   E T    + + S    H   L +FV+ Q  YY  C +    L ++L   +F   F N   P
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNVRVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQLG--SFPSTFSNNNQP 262          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 71.633 bits (174), Expect = 1.210e-12
Identity = 66/254 (25.98%), Postives = 112/254 (44.09%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            ++ +V +    AGT   R  Q  EE F    +TE     +  + + +     T+K++   EV LQ N          E +DK     M   E  G   QS ++    +   + +   L+K G+ + ++G A   +I+  +  ++   R  LE D K   +E ++L+N RLD D  K ++  A     RA  E++ +  + EF+   E T    + + S    H   L +FVE Q  YY  C + +  L ++L N
Sbjct:    1 MDFNVKRFAADAGTLFSRAVQFTEEKFGQAEKTELDAHLETLLTRAECTKHWTEKILKQTEVLLQPNPNARIEELLYEKLDKKAPPRMNNHELMG---QSMIDSGNEFGPGTAYGNALIKCGETEKQIGGAEREFIQTSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMADARAVAEQDLKMTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMVDLQKQLGN 251          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 71.633 bits (174), Expect = 1.210e-12
Identity = 66/254 (25.98%), Postives = 112/254 (44.09%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            ++ +V +    AGT   R  Q  EE F    +TE     +  + + +     T+K++   EV LQ N          E +DK     M   E  G   QS ++    +   + +   L+K G+ + ++G A   +I+  +  ++   R  LE D K   +E ++L+N RLD D  K ++  A     RA  E++ +  + EF+   E T    + + S    H   L +FVE Q  YY  C + +  L ++L N
Sbjct:    1 MDFNVKRFAADAGTLFSRAVQFTEEKFGQAEKTELDAHLETLLTRAECTKHWTEKILKQTEVLLQPNPNARIEELLYEKLDKKAPPRMNNHELMG---QSMIDSGNEFGPGTAYGNALIKCGETEKQIGGAEREFIQTSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMADARAVAEQDLKMTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMVDLQKQLGN 251          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 66.6254 bits (161), Expect = 5.581e-11
Identity = 71/293 (24.23%), Postives = 114/293 (38.91%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK--MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAA-----------------------------LEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISP 833
            +E +V ++   AGT L R  Q  EE F    +TE     +  + + +     T+K++   EV LQ N          E +DK   T+      + Q  ++    +   + +   L+K G+ +  LG A   +I   +  ++   R  +E D K   +E ++L+N RLD D  KNRM  A     R+A                              E E    + EF+   E T    + + S    H   L +FV+ Q  YY  C +    L ++L   +F   F N   P
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNVRVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAELNCSPPLGEEYVAHFSYMLSFLHVRWLKAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQL--GSFPSTFSNNNQP 291          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 88.1965 bits (217), Expect = 5.796e-18
Identity = 66/240 (27.50%), Postives = 111/240 (46.25%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPLEETKFYS---------SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYY 746
            ++ +V K+   AGT L R  Q  EE F    +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + L +  +  ++ +         + +   L+K G+ Q ++GVA    ++  +  ++  LR  +E D K   +E+++L+N RLD D  K R+  A  T  RAA E+E    + EF+   E T    + + S    H   L +FVE Q  Y+
Sbjct:    1 MDFNVKKLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYF 235          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 77.7962 bits (190), Expect = 1.415e-14
Identity = 59/217 (27.19%), Postives = 99/217 (45.62%), Query Frame = 3
Query:  150 EEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPLEETKFYSSLFNK---------DLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYY 746
            EE F    +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + L +  +  ++ +   N+          L+K G+ Q ++GVA    ++  +  ++  LR  +E D K   +E+++L+N RLD D  K R+  A  T  RAA E+E    + EF+   E T    + + S    H   L +FVE Q  Y+
Sbjct:    6 EEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYF 217          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 77.7962 bits (190), Expect = 1.463e-14
Identity = 58/217 (26.73%), Postives = 99/217 (45.62%), Query Frame = 3
Query:  150 EEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPLEETKFYS---------SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYY 746
            EE F    +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + L +  +  ++ +         + +   L+K G+ Q ++GVA    ++  +  ++  LR  +E D K   +E+++L+N RLD D  K R+  A  T  RAA E+E    + EF+   E T    + + S    H   L +FVE Q  Y+
Sbjct:   11 EEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYF 222          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 77.7962 bits (190), Expect = 1.815e-14
Identity = 58/217 (26.73%), Postives = 99/217 (45.62%), Query Frame = 3
Query:  150 EEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPLEETKFYS---------SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYY 746
            EE F    +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + L +  +  ++ +         + +   L+K G+ Q ++GVA    ++  +  ++  LR  +E D K   +E+++L+N RLD D  K R+  A  T  RAA E+E    + EF+   E T    + + S    H   L +FVE Q  Y+
Sbjct:   19 EEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYF 230          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 77.411 bits (189), Expect = 2.482e-14
Identity = 66/259 (25.48%), Postives = 112/259 (43.24%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPLEETKFYS---------SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAAL-------------------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYY 746
            ++ +V K+   AGT L R  Q  EE F    +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + L +  +  ++ +         + +   L+K G+ Q ++GVA    ++  +  ++  LR  +E D K   +E+++L+N RLD D  K R+  A  T  RAA+                   E+E    + EF+   E T    + + S    H   L +FVE Q  Y+
Sbjct:    1 MDFNVKKLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAVTYVFSFNANQMWTEEVTKAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYF 254          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 82.8037 bits (203), Expect = 3.052e-16
Identity = 65/243 (26.75%), Postives = 108/243 (44.44%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     +++ E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 82.8037 bits (203), Expect = 3.274e-16
Identity = 65/243 (26.75%), Postives = 108/243 (44.44%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     +++ E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 70.4774 bits (171), Expect = 3.573e-12
Identity = 65/264 (24.62%), Postives = 108/264 (40.91%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAA---------------------LEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     +++                      E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSQLNSARPEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 262          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb2 (SH3-domain GRB2-like endophilin B2 [Source:MGI Symbol;Acc:MGI:2385131])

HSP 1 Score: 69.3218 bits (168), Expect = 8.002e-12
Identity = 69/262 (26.34%), Postives = 115/262 (43.89%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------------GTVLQSPLEETK---FYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAAL--------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            ++ ++ K+ + AG    R  Q  EE F    +TE    +++ + + D     T++++   EV LQ N        ++EEF               G +L   + E       S+ + K L+KV + + +LG A   +I   S +++  LR  LE D K   +E  +L+N RLD D  K R+  A     +A L        E+E    + EF+   E T    + + S    H   L EFV+ Q  YY  C +++  L ++L
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPS-----ARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQL 257          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb2 (SH3-domain GRB2-like endophilin B2 [Source:MGI Symbol;Acc:MGI:2385131])

HSP 1 Score: 69.3218 bits (168), Expect = 9.530e-12
Identity = 69/262 (26.34%), Postives = 115/262 (43.89%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------------GTVLQSPLEETK---FYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAAL--------EKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            ++ ++ K+ + AG    R  Q  EE F    +TE    +++ + + D     T++++   EV LQ N        ++EEF               G +L   + E       S+ + K L+KV + + +LG A   +I   S +++  LR  LE D K   +E  +L+N RLD D  K R+  A     +A L        E+E    + EF+   E T    + + S    H   L EFV+ Q  YY  C +++  L ++L
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPS-----ARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQL 257          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32LM0|SHLB1_BOVIN (Endophilin-B1 OS=Bos taurus OX=9913 GN=SH3GLB1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.544e-16
Identity = 67/243 (27.57%), Postives = 108/243 (44.44%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     RA+ E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZIR1|SHLB1_CHICK (Endophilin-B1 OS=Gallus gallus OX=9031 GN=SH3GLB1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.001e-15
Identity = 67/239 (28.03%), Postives = 105/239 (43.93%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ ++ K+   AGT L R  Q  EE      +TE     ++ + K +     T+K++   EV LQ N          E +D+     M   E  G  +     E    ++  N  L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     RAA E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNMKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKQWTEKIMKQTEVLLQPNPNARIEEFFYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNA-LIKCGETQKQIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRLKKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R8P5|SHLB1_PONAB (Endophilin-B1 OS=Pongo abelii OX=9601 GN=SH3GLB1 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.824e-15
Identity = 66/243 (27.16%), Postives = 107/243 (44.03%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     R + E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y371|SHLB1_HUMAN (Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.824e-15
Identity = 66/243 (27.16%), Postives = 107/243 (44.03%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     R + E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JK48|SHLB1_MOUSE (Endophilin-B1 OS=Mus musculus OX=10090 GN=Sh3glb1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.290e-15
Identity = 65/243 (26.75%), Postives = 108/243 (44.44%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------GTVLQSPL--------EETKFY-SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V K+   AGT L R  Q  EE      +TE     ++ + K +   + T+K++   EV LQ N        +IEEF          + + +P           T+F   + +   L+K G+ Q ++G A    I+  +  ++  LR  +E D K   +E ++L+N RLD D  K R+  A     +++ E+E    + EF+   E T    + + S    H   L +FVE Q  YY  C
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN-----ARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQC 241          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A182QAX5 (Uncharacterized protein OS=Anopheles farauti OX=69004 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.299e-19
Identity = 77/252 (30.56%), Postives = 121/252 (48.02%), Query Frame = 3
Query:   84 EMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKD------LVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            E DV K +  AG+TL R+ Q  EE      +TE    ++   ++ D   L T+K++ D E  L  N  P ++M      +IE+      S LE            F +D      L+KVG+ + KLG     +I      +I+ L+K LE ++K   +E+ +LE+ RLD D  KNR+  A + +G+ A E++    + EF+   E T    + + +    H   L  FVE Q  YY  C+K +S L R+L +
Sbjct:    7 EFDVKKFVKGAGSTLSRVVQLTEEKLGTSEKTEMDARFEHLSERSDSAKLWTEKIMRDTEAALIPN--PANRMEDFIFEKIEKQKPKRLSNLEYLGLDMIEGGGEFGQDGPYGSALIKVGQAEQKLGSCERDFIGSTGVCFIQPLKKFLEGEMKTITKEKGVLESKRLDLDACKNRVRKARSMIGQQAAERDLRVAQSEFDRQAEITKLLLEGISTTQATHLRYLHSFVEAQVRYYGQCNKIMSDLQRELVS 256          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A182ND82 (Uncharacterized protein OS=Anopheles dirus OX=7168 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.719e-19
Identity = 77/252 (30.56%), Postives = 120/252 (47.62%), Query Frame = 3
Query:   84 EMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKD------LVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            E DV K +  AG+TL R+ Q  EE      +TE    ++   ++ D   L T+K++ D E  L  N  P ++M      +IE+      S LE            F +D      L+KVG+ + KLG     +I      +I+ L+K LE ++K   +E  +LE+ RLD D  KNR+  A + +G+ A E++    + EF+   E T    + + +    H   L  FVE Q  YY  C+K +S L R+L +
Sbjct:    7 EFDVKKFVKGAGSTLSRVVQLTEEKLGTSEKTEMDARFEHLSERSDSAKLWTEKIMRDTEAALIPN--PANRMEDFIFEKIEKQKPKRLSNLEYLGLDMIEGGGEFGQDGPYGSALIKVGQAEQKLGSCERDFIGSTGMCFIQPLKKFLEGEMKTITKERGVLESKRLDLDACKNRVRKARSMIGQQAAERDLRVAQSEFDRQAEITKLLLEGISTTQATHLRYLHSFVEAQVRYYGQCNKIMSDLQRELVS 256          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A182YE51 (BAR domain-containing protein OS=Anopheles stephensi OX=30069 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.582e-18
Identity = 76/250 (30.40%), Postives = 121/250 (48.40%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMT-----QIEEFGTVLQSPLEETKF----YSSLFNKD------LVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            D+ K +  AG+TL R+ Q  EE      +TE    ++   ++ D   L T+K++ D E  L  N  P ++M      +IE+      S LE            F +D      L+KVG+ + KLG     +I   +  YI+ L+K LE ++K   +E+ +LE+ RLD D  KNR+  A + +G+ A E++    + EF+   E T    + + +    H   L  FVE Q  YY  C+K +S L R+L +
Sbjct:    5 DMKKFVKGAGSTLSRVVQLTEEKLGTSEKTEMDARFEHLSERSDSAKLWTEKIMRDTEAALIPN--PANRMEDFIFEKIEKQKPKRLSNLEYLGLDMIEGGGEFGQDGPYGSALIKVGQAEQKLGSCERDFIGSAAMCYIQPLKKFLEGEMKTITKEKGVLESKRLDLDACKNRVRKARSMIGQQAAERDLRVAQSEFDRQAEITKLLLEGISTTQATHLRYLHSFVEAQVRYYGQCNKIMSDLQRELVS 252          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A1B6EXW9 (Uncharacterized protein OS=Cuerna arida OX=1464854 GN=g.9169 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.692e-18
Identity = 76/269 (28.25%), Postives = 122/269 (45.35%), Query Frame = 3
Query:   78 NLEMD--VIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISPH 836
            N+E D  V K +  AGT L R+ Q  EE      +TE    +++  ++ D     T+K++ D E  L  N          E IDK     ++ +E  G  +     E     + +   L+KVG+ + +LG     +I      ++  LRK L+ ++K   +E  ILE+ RLD D  KNR+  A + LG+   E++    + EF+   E T    + V S  T H   L EFVE Q  +Y  C + +  L + + + +  K   +   PH
Sbjct:    2 NMEFDFNVKKFVREAGTALSRVVQLTEEKLGTSEKTELDAHFENLAERSDVTKQWTEKILRDTEAVLTPNPGYRVEDFLFEKIDKKRPNRLSNLEYLGLDMIEAGNEFG-PGTAYGSALIKVGQNEQRLGHIERDFIASSHHCFLVPLRKFLDGEMKTILKERSILESKRLDLDACKNRVRKARSMLGQPTAERDLRVAQSEFDRQAEITKLLLEGVSSSHTRHLRCLHEFVEAQVTFYAQCHQAMQELQKDIASMSMGKANSSPAMPH 269          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A034VWM5 (Endophilin-B1 OS=Bactrocera dorsalis OX=27457 GN=SHLB1 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.966e-18
Identity = 76/256 (29.69%), Postives = 119/256 (46.48%), Query Frame = 3
Query:   90 DVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETK--------------------FYSSL-FNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN 794
            +V  ++  AG+TL R+ Q  EE      RTEY  E+++  ++ D     T+K++ D E  L  N +      +IE+F   +   +E+TK                    F   L + + L+KVG+ + KLG     +I      + + LRK LE ++K   +E  ILE  RLD D  KNR+  A + LG+ A E++    + EF+   E T    + + +    H   L  FVE Q  YY+ C   ++ L R L N
Sbjct:    9 NVKNLVKEAGSTLSRVVQLTEEKLGTTERTEYDNEFQNLAERADITKTWTEKIVRDTETVLIPNPQ-----NRIEDF---IFEKIEKTKPQRLSNLEHLALGMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCERDFIASSGICFTQPLRKFLEGEMKTITKERGILETKRLDLDACKNRVKKARSMLGQQAAERDLRVAQAEFDRQSEITKVLLEGISTSQASHLRHLHAFVETQVRYYKHCMDAMNNLQRDLAN 256          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb2a (SH3-domain GRB2-like endophilin B2a [Source:ZFIN;Acc:ZDB-GENE-061201-8])

HSP 1 Score: 75.8702 bits (185), Expect = 3.808e-14
Identity = 71/243 (29.22%), Postives = 105/243 (43.21%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF---------------GTVL-QSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++  V K+   AG    R  Q  EE      +TE    ++  + + D     T+K+    EV LQ N        +IEEF               G +L Q  LE  K +   + +   L++VG  Q +LG A   +++  S +++  LR  LE D +   +E  +LEN RLD D  K R+  A     +AA E+E    + EF+   E T    + + S    H   L EFVE Q  YY  C
Sbjct:    1 MDFSVKKLACDAGVFFSRAVQYTEEKLGQAEKTELDAHFESLLARADCTKNWTEKIYRQTEVLLQPNPS-----ARIEEFLYEKLDRKLPYRATNGEILGQYMLEAAKEFGPGTPYGSTLIQVGDCQRRLGGAEREFLQTSSISFLTPLRNFLEGDWRTITKERRLLENRRLDLDACKARLKKAKAAEAKAAAEQELRLAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVEAQATYYNQC 238          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb2b (SH3-domain GRB2-like endophilin B2b [Source:ZFIN;Acc:ZDB-GENE-040426-833])

HSP 1 Score: 67.781 bits (164), Expect = 2.453e-11
Identity = 70/268 (26.12%), Postives = 113/268 (42.16%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHE--FESYYEKTLQYFKTVDS---------------YFTI-HRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            ++ +V K+ + AG    R  Q  EE      +TE     ++ I + D     T+K+    EV LQ N          E +DK      T  E  G  +Q   ++     + +   L+ VG+YQ KLG +   +++  +  ++  LR  LE D +   +E  +LEN RLD D  K R+  A     +AA   +F++ R      S     ++  +   S               + T+ H   L EFVE Q  YY  C K++  L ++L
Sbjct:    1 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDAHLENLIARGDCTKNWTEKIFRQTEVLLQPNPSARIEEFFYEKLDKKAPTRTTNGELLGQYMQDAAKDFG-PGTPYGSTLITVGEYQKKLGGSEREFLQSSAVGFLTPLRNFLEGDWRTISKERRLLENRRLDLDVCKARLKKAKLAEAKAAAAPDFQETRPRNYILSASASAVRKLQRTSSLSLSLPFPHSFCLSLFLTVNHLRCLHEFVEAQAVYYAQCHKHMQELQKEL 267          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 65.4698 bits (158), Expect = 9.144e-11
Identity = 60/240 (25.00%), Postives = 99/240 (41.25%), Query Frame = 3
Query:   78 NLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
             +E  V ++   AGT   R  Q  EE      RTE     ++ + + +     T++++   EV LQ N          E +D+         E  G  +     E     + +   L+K G+ + +LG +   +I   +  ++   R  +E D K   +E ++L+  RLD D  K R+  A     R+A E E    + EF+   E T    + V S    H   L +FV+ Q +YY  C
Sbjct:    3 GMEFSVRRLAADAGTLFSRAVQFTEEKLGQAERTELDAHLENLLGRAEATKHWTERVMKQTEVLLQPNPNVRMEEFLYEKLDRKLPTRANNHELLGECMIDAGHEFG-PGTAYGSALIKCGEVEKQLGSSEKEFIHSSAINFLTPFRNFIEGDYKTISKERKLLQIKRLDLDAAKTRVKKARAADARSAAETELRIAQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDFVDAQASYYAQC 241          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 63.5438 bits (153), Expect = 4.502e-10
Identity = 62/254 (24.41%), Postives = 109/254 (42.91%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK--MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHD----------YLKNRMNNAYTTLGRA------ALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDC 755
            ++ +V +    AGT L R  Q  EE      +TE     ++ + + +     T++++   EV LQ N          E +DK   T++     + Q+ ++    +   + +   LVK G+ + ++G A   +I+  +  ++   R  LE D K   +E ++L+N RLD D            + R   +Y TL  A      + E++ +  + EF+   E T    + V S    H   L +FVE Q  YY  C
Sbjct:    1 MDFNVKRFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLTRAECTKHWTERILKQTEVLLQPNPNVRIEEFFYEKLDKKAPTRMNNHELLGQAMIDSGNEFGPGTAYGNALVKCGETEKEIGGAEREFIQSSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMAEARAAVSYITLHLASSAYFRSAEQDLKMTQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDFVEAQTTYYAQC 254          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 80.8777 bits (198), Expect = 2.728e-16
Identity = 69/280 (24.64%), Postives = 117/280 (41.79%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------------EPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRH-----------------------------EFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            ++ +V K+ + AGT   R  Q  EE      RTE    +++ + + +     T K++   E  LQ N                 P+ + T  E  G  +    +E     + +   L+K G  Q +LG++   +I+  +  ++  LR  L+ D +   +E++ILEN RLD D  K+R+  A +   +AA E +F ++R                              EF+   E T    + + S    H   LKEFVE Q  YY  C +++  L ++L
Sbjct:    1 MDFNVRKLASDAGTFFSRAVQFTEEKLGQAERTELDAHFENLLGRAEMTRHWTDKIMRQAETLLQPNPNARIEDYFFEKLEGKAPL-RATNSEYLGQYMIEAGQEFG-PGTAYGCALIKCGTTQKELGISEKDFIQTTANGFLTPLRNFLDGDFRTIAKEKKILENKRLDLDACKSRLKKARSAEAKAATEPDFNEIRPRNYVLSASAAGLWADEVARAEQELRVTQTEFDRQAEITRLLLEGIGSTHANHHRALKEFVEAQAAYYAKCYQSMVELQKEL 278          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 60.077 bits (144), Expect = 1.689e-10
Identity = 49/181 (27.07%), Postives = 82/181 (45.30%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEF--------GTVLQSPLEETKFY----------SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRM 569
            ++ ++ K+ + AGT   R  Q  EE      RTE    +++ + + D     T+K++   EV LQ N        ++EEF        G   Q  +E    Y           + +   L+KVG+ Q  LG+A   +++  +  ++  LR  LE D K   +E ++L+N RLD D  K R+
Sbjct:    1 MDFNMKKLASDAGTFFTRAVQFTEEKLGGAERTELDAHFENLMTRADSTKNWTEKIMRQTEVVLQPNP-----TARVEEFVYEKLEKKGPARQRTVELLGQYMTDAGNDFGAGTPYGGALIKVGESQKLLGLAEKEFVQASTINFLTPLRNFLEGDYKAMAKERKLLQNKRLDLDASKTRL 176          
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Match: EDO38201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK8])

HSP 1 Score: 72.0182 bits (175), Expect = 2.542e-13
Identity = 61/242 (25.21%), Postives = 99/242 (40.91%), Query Frame = 3
Query:  117 GTTLGRIFQQA----EEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS--------------EPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKL 788
            G+T    F +A    EE       TE+   ++  +++ D     T++L+   E  LQ N               +  +++T +E  G +++    E    +S +   LVK G  + KL  A   ++ K    Y+  L+  LE D+K    E   L   RLD D  K ++  A T       E E    + EF+  YE T      + +    H   L+ F+E Q  YY  C + +  L R+L
Sbjct:   12 GSTTATFFSRAKQYTEEQLGKAEATEFDARFESLLERADRTKQWTERLLKQTEALLQPNPGIRAEEYFYSKLGEKKPERLTHLETLGKIMEDAGNELGPGTS-YGSTLVKCGATEKKLASAERDFMTKSVSHYLHPLKSFLEGDMKTISTERRTLLAKRLDLDSCKAKVRKAQTPERIQQAESELRVAQAEFDRQYEVTKLLLDGIATSHANHHRALQSFIEAQAQYYAQCFQYMQDLQRQL 252          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb1a (endophilin-B1 [Source:NCBI gene;Acc:101156208])

HSP 1 Score: 78.1814 bits (191), Expect = 6.752e-15
Identity = 69/260 (26.54%), Postives = 116/260 (44.62%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK--MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQN 821
            ++ +V +    AGT L R  Q  EE      +TE     ++ + + +     T+K++   EV LQ N          E ++K   T++     + QS +E    +   + +   L+K G+ Q ++G A   +I+  +  ++   R  LE D K   +E ++L+  RLD D  K R+  A  +  RAA E+E    + EF+   E T    + V S    H   L + VE Q  YY  C + +  L ++L   +F   F N
Sbjct:    1 MDFNVKRFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLVRAENTKQWTEKIMKQTEVLLQPNPNVRLEEFVYEKLEKKAPTRMNNHELLGQSMIESGSEFGPGTAYGNALIKCGETQKQIGGAEREFIQSAAINFLTPFRNFLEGDFKTILKERKLLQVKRLDLDAAKTRLKKARMSDARAAAEQELRMTQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDLVEAQTTYYAQCYQYMVDLQKQLG--SFPSTFSN 258          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 78.1814 bits (191), Expect = 8.127e-15
Identity = 72/280 (25.71%), Postives = 119/280 (42.50%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRH------------------------EFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNEN 800
            ++ +V K+ + AG    R  Q  EE      +TE     ++ I + D     T+K++   EV LQ N          + +DK     MT  E  G  +   L+  K +   S +   L+ VG+YQ +LG A   +++  +  ++  LR  LE D +   +E+ +LEN RLD D  K R+  A     +AA   +F++ R                         EF+   E T    + + S    H   L++F E Q  Y+  C  ++  L R+L++ N
Sbjct:    1 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPNPSARIEEFIYDKLDKKLPSRMTTAELLGQYM---LDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASAVSSAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELHSSN 277          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021068.2 (endophilin-B2 [Source:NCBI gene;Acc:101169212])

HSP 1 Score: 77.411 bits (189), Expect = 1.631e-14
Identity = 68/275 (24.73%), Postives = 115/275 (41.82%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPID-----KMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRM---------------------NNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNEN 800
            ++ +V ++   AG  L R  Q  EE      +T    ++++   + D     T+K++   E+ LQ N          E +D     ++T  E  G  ++   +E    S  +   LVKVG+ + +LG     +I+    +++  LR  LE D +   +E  +LENLRLD D  K R+                      N   +   +A E+  +  + EF+   E T    + +      H   L EFVE Q  YYR C  ++  L  +L ++N
Sbjct:    1 MDFNVKRLATEAGLFLTRAVQFTEEKLWQSEKTNLDQDFENLTVRADCTKHWTEKILRQTEILLQPNPSARIEEFLYEKLDMKAPSRVTNSELLGQHMEDAAKELGLESP-YGSTLVKVGECERRLGAVEKDFIQTADISFLSPLRNFLEGDCRIISKERRLLENLRLDLDACKTRVKKAKAAEAKVAVVPDFQETRPRNYVLSASASAAEQGLKTAQKEFDRQAEVTRLLLEGISCTHVNHLRCLHEFVEAQAAYYRQCHLHMQDLQEELRSQN 274          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 75.0998 bits (183), Expect = 1.621e-13
Identity = 72/288 (25.00%), Postives = 117/288 (40.62%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPID--------------------KMTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRH-----------------------------EFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLY 791
            ++ +V K+ + AG    R  Q  EE      +TE     ++ I + D     T+K++   EV LQ N  PID                    +MT  E  G  +   L+  K +   S +   L+ VG+YQ +LG A   +++  +  ++  LR  LE D +   +E+ +LEN RLD D  K R+  A     +AA   +F++ R                              EF+   E T    + + S    H   L++F E Q  Y+  C  ++  L R+L+
Sbjct:  100 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPN--PIDHTGARIEEFIYDKLDKKLPSRMTTAELLGQYM---LDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASALLSEEVDKAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELH 382          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 73.9442 bits (180), Expect = 3.863e-13
Identity = 71/282 (25.18%), Postives = 117/282 (41.49%), Query Frame = 3
Query:   81 LEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANS---------EPIDK-----MTQIEEFGTVLQSPLEETKFYS--SLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRH-----------------------------EFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLY 791
            ++ +V K+ + AG    R  Q  EE      +TE     ++ I + D     T+K++   EV LQ N          + +DK     MT  E  G  +   L+  K +   S +   L+ VG+YQ +LG A   +++  +  ++  LR  LE D +   +E+ +LEN RLD D  K R+  A     +AA   +F++ R                              EF+   E T    + + S    H   L++F E Q  Y+  C  ++  L R+L+
Sbjct:  100 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPNPSARIEEFIYDKLDKKLPSRMTTAELLGQYM---LDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASALLSEEVDKAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELH 378          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000043769.1 (SMESG000043769.1)

HSP 1 Score: 520.39 bits (1339), Expect = 2.327e-178
Identity = 256/256 (100.00%), Postives = 256/256 (100.00%), Query Frame = 3
Query:  102 MLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISPHHLLFYSAFWFI 869
            MLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISPHHLLFYSAFWFI
Sbjct:    1 MLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISPHHLLFYSAFWFI 256          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000043769.1 (SMESG000043769.1)

HSP 1 Score: 343.199 bits (879), Expect = 1.721e-174
Identity = 212/308 (68.83%), Postives = 219/308 (71.10%), Query Frame = 3
Query: 1809 IFIDNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQSF-----------------------------GDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDISLLTMDEEIKINLCEGPDKETDSNCSKFGLKNKIKLGIIFENLXXXXXXXXXXXXXXXXXAVTNMKMGNEENIKLAVSTNYGVSPSVEEFEVKTPEIIXXXXXXXXXXXXXTFDENISKEPEINKEIIDTVLSC 2645
            ++ DNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQS+                             GDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDIS               PD +  +N         +K+G                               NEENIKLAVSTNYGVSPSVEEFEVKTPEIINAASSSLNLENSLTFDENISKEPEINKEIIDTVLS 
Sbjct:  242 LYNDNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQSYNYEENTKETHPTVLSTEFVIKTPLYEDQIGDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDIS-----------SNSSPDIDAVTN---------MKMG-------------------------------NEENIKLAVSTNYGVSPSVEEFEVKTPEIINAASSSLNLENSLTFDENISKEPEINKEIIDTVLSL 498          

HSP 2 Score: 291.197 bits (744), Expect = 1.721e-174
Identity = 147/148 (99.32%), Postives = 148/148 (100.00%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            +NINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN
Sbjct:  498 LNINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 645          

HSP 3 Score: 511.531 bits (1316), Expect = 6.714e-163
Identity = 246/249 (98.80%), Postives = 247/249 (99.20%), Query Frame = 3
Query:   63 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWK 809
            MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN+N  K
Sbjct:    1 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNDNDRK 249          

HSP 4 Score: 109.768 bits (273), Expect = 5.150e-24
Identity = 76/162 (46.91%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ D+ +    T  E+++          PS+S+N+N      +DE        SI  DPEV  +  +        +SVNIN E  ++ +    + S   IT+PEVN+KGSDY+DTTEPSVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct:  827 VNINLEPVVKLDEVSDEFSVGSITDPEVNIKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSI-TDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSITDPEVNIKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 987          

HSP 5 Score: 107.457 bits (267), Expect = 2.934e-23
Identity = 77/162 (47.53%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ D+ +    T  E+++          PS+S+N+N      +DE        SI  DPEV  R  +        +SVNIN E  ++ +   ++ S   IT+PEVNVKGSDY+DTTE SVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct:  959 VNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSI-TDPEVNIRESDNEVTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDYEDTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 1119          

HSP 6 Score: 106.686 bits (265), Expect = 5.374e-23
Identity = 75/162 (46.30%), Postives = 103/162 (63.58%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++          PS+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +    ++S   IT+PEVN+KGSDY++TTEPSVSVNINLEPAVKLDEVS+EFSVGSITDPEVN
Sbjct:  783 VNINLEPVVKIDEVSNEVSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSI-TDPEVNIKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSITDPEVN 943          

HSP 7 Score: 100.908 bits (250), Expect = 3.158e-21
Identity = 73/162 (45.06%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISMP----------SISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++           S+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +   ++ S   IT+PEVNVKGSDY+DTTEPSVSVNINLEP VKLDEVSDE SVG ITDPE+N
Sbjct: 1003 VNINLEPVVKIDEVSNEVSVGSITDPEVNIRESDNEVTTELSVSVNINLEPVVKLDEVSDEFSVGSI-TDPEVNVKGSDYEDTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEVSVGPITDPEIN 1163          

HSP 8 Score: 98.9821 bits (245), Expect = 1.153e-20
Identity = 73/162 (45.06%), Postives = 100/162 (61.73%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++          PS+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +   ++ S   IT+PEVNVKGSD +DTTEPSVSVNINLEP VK+DEVS+E SVGSITDPEVN
Sbjct:  871 VNINLEPVVKIDEVSNEVSVGSITDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSI-TDPEVNIKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVN 1031          

HSP 9 Score: 98.9821 bits (245), Expect = 1.288e-20
Identity = 66/121 (54.55%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 2782 SISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            S+S+N+N      LDE        SI  DPE+  +  +  +     +SVNIN E  ++ +    ++S   IT+PEVNVKGSD +DTTEPSVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct:  736 SVSVNINLEPVVKLDEVSDEFSVGSI-TDPELNIKGSDYEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 855          

HSP 10 Score: 73.1738 bits (178), Expect = 1.011e-12
Identity = 68/167 (40.72%), Postives = 93/167 (55.69%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEI-QPNLGMEQISTNL----ITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNINSE E++     + ++TN  T  E+++          PS+S+N+N      LDE        SI  DPEV  R  +            + +EL + +P + ++++S       IT+PEVN++GSD + TTE SVS     EP VKLDEVSDEFSVGSITDPEVN
Sbjct:  573 VNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSI-TDPEVNIRGSDNE----------VTTELSVSEPVVKLDEVSDEFSVGSITDPEVNIRGSDNEVTTELSVS-----EPVVKLDEVSDEFSVGSITDPEVN 723          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000043769.1 (SMESG000043769.1)

HSP 1 Score: 494.967 bits (1273), Expect = 3.803e-168
Identity = 245/246 (99.59%), Postives = 246/246 (100.00%), Query Frame = 3
Query:   63 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNEN 800
            MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN+N
Sbjct:    1 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNDN 246          

HSP 2 Score: 88.5817 bits (218), Expect = 7.122e-19
Identity = 41/44 (93.18%), Postives = 43/44 (97.73%), Query Frame = 3
Query: 1809 IFIDNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQS 1940
            ++ DNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQS
Sbjct:  242 LYNDNDRKRINEIYKSLRMKYRHKARSEPIIIDNRRRKLYSKQS 285          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000043769.1 (SMESG000043769.1)

HSP 1 Score: 494.197 bits (1271), Expect = 9.521e-167
Identity = 244/258 (94.57%), Postives = 250/258 (96.90%), Query Frame = 3
Query:   63 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKIFQNEISPH 836
            MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN+ +   +  ++  +
Sbjct:    1 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNDVYRITYDTQVDGY 258          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000043769.1 (SMESG000043769.1)

HSP 1 Score: 509.22 bits (1310), Expect = 1.461e-161
Identity = 244/245 (99.59%), Postives = 245/245 (100.00%), Query Frame = 3
Query:   63 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNE 797
            MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYN+
Sbjct:    1 MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIKKVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFYSSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKEEEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTLQYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYND 245          

HSP 2 Score: 299.671 bits (766), Expect = 1.475e-161
Identity = 184/254 (72.44%), Postives = 190/254 (74.80%), Query Frame = 3
Query: 1890 EPI-IIDNRRRKLYSKQSF--GDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDISLLTMDEEIKINLCEGPDKETDSNCSKFGLKNKIKLGIIFENLXXXXXXXXXXXXXXXXXAVTNMKMGNEENIKLAVSTNYGVSPSVEEFEVKTPEIIXXXXXXXXXXXXXTFDENISKEPEINKEIIDTVLS 2642
            +PI +++N   ++  K     GDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDIS                     SN S                               DIDAVTNMKMGNEENIKLAVSTNYGVSPSVEEFEVKTPEIINAASSSLNLENSLTFDENISKEPEINKEIIDTVLS
Sbjct:  342 QPIELVNNNSERISQKSGLFVGDLENKSFSINNESYKSMSDENRDNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISNDEIIPFTDFQSNIEFPEKETTTGAQDIS---------------------SNSSP------------------------------DIDAVTNMKMGNEENIKLAVSTNYGVSPSVEEFEVKTPEIINAASSSLNLENSLTFDENISKEPEINKEIIDTVLS 544          

HSP 3 Score: 291.197 bits (744), Expect = 1.475e-161
Identity = 147/148 (99.32%), Postives = 148/148 (100.00%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            +NINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN
Sbjct:  545 LNINSEPELESLKLDDDLTTNPATGTEISMPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 692          

HSP 4 Score: 110.153 bits (274), Expect = 4.895e-24
Identity = 76/162 (46.91%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ D+ +    T  E+++          PS+S+N+N      +DE        SI  DPEV  +  +        +SVNIN E  ++ +    + S   IT+PEVN+KGSDY+DTTEPSVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct:  874 VNINLEPVVKLDEVSDEFSVGSITDPEVNIKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSI-TDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSITDPEVNIKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 1034          

HSP 5 Score: 107.457 bits (267), Expect = 2.739e-23
Identity = 77/162 (47.53%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ D+ +    T  E+++          PS+S+N+N      +DE        SI  DPEV  R  +        +SVNIN E  ++ +   ++ S   IT+PEVNVKGSDY+DTTE SVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct: 1006 VNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSI-TDPEVNIRESDNEVTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDYEDTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 1166          

HSP 6 Score: 106.686 bits (265), Expect = 4.931e-23
Identity = 75/162 (46.30%), Postives = 103/162 (63.58%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++          PS+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +    ++S   IT+PEVN+KGSDY++TTEPSVSVNINLEPAVKLDEVS+EFSVGSITDPEVN
Sbjct:  830 VNINLEPVVKIDEVSNEVSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSI-TDPEVNIKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSITDPEVN 990          

HSP 7 Score: 100.908 bits (250), Expect = 2.916e-21
Identity = 73/162 (45.06%), Postives = 99/162 (61.11%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISMP----------SISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++           S+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +   ++ S   IT+PEVNVKGSDY+DTTEPSVSVNINLEP VKLDEVSDE SVG ITDPE+N
Sbjct: 1050 VNINLEPVVKIDEVSNEVSVGSITDPEVNIRESDNEVTTELSVSVNINLEPVVKLDEVSDEFSVGSI-TDPEVNVKGSDYEDTTELSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEVSVGPITDPEIN 1210          

HSP 8 Score: 98.9821 bits (245), Expect = 1.091e-20
Identity = 73/162 (45.06%), Postives = 100/162 (61.73%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNIN EP ++  ++ ++++    T  E+++          PS+S+N+N      LDE        SI  DPEV  +  +  +     +SVNIN E  ++ +   ++ S   IT+PEVNVKGSD +DTTEPSVSVNINLEP VK+DEVS+E SVGSITDPEVN
Sbjct:  918 VNINLEPVVKIDEVSNEVSVGSITDPEVNIKGSDYENTTEPSVSVNINLEPAVKLDEVSNEFSVGSI-TDPEVNIKGSDYEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVN 1078          

HSP 9 Score: 98.9821 bits (245), Expect = 1.219e-20
Identity = 66/121 (54.55%), Postives = 81/121 (66.94%), Query Frame = 1
Query: 2782 SISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            S+S+N+N      LDE        SI  DPE+  +  +  +     +SVNIN E  ++ +    ++S   IT+PEVNVKGSD +DTTEPSVSVNINLEP VKLDEVSDEFSVGSITDPEVN
Sbjct:  783 SVSVNINLEPVVKLDEVSDEFSVGSI-TDPELNIKGSDYEDTTEPSVSVNINLEPVVKIDEVSNEVSVGSITDPEVNVKGSDNEDTTEPSVSVNINLEPVVKLDEVSDEFSVGSITDPEVN 902          

HSP 10 Score: 73.1738 bits (178), Expect = 9.251e-13
Identity = 68/167 (40.72%), Postives = 93/167 (55.69%), Query Frame = 1
Query: 2689 VNINSEPELESLKLDDDLTTNPATGTEISM----------PSISLNLNQ----SLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNINSELEI-QPNLGMEQISTNL----ITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSITDPEVN 3132
            VNINSE E++     + ++TN  T  E+++          PS+S+N+N      LDE        SI  DPEV  R  +            + +EL + +P + ++++S       IT+PEVN++GSD + TTE SVS     EP VKLDEVSDEFSVGSITDPEVN
Sbjct:  620 VNINSELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVKLDEVSDEFSVGSI-TDPEVNIRGSDNE----------VTTELSVSEPVVKLDEVSDEFSVGSITDPEVNIRGSDNEVTTELSVS-----EPVVKLDEVSDEFSVGSITDPEVN 770          
The following BLAST results are available for this feature:
BLAST of BAR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GLB13.798e-1627.16SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB12.994e-1225.76SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB14.165e-1229.77SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB12.537e-1125.00SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB25.649e-1125.95SH3 domain containing GRB2 like, endophilin B2 [So... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F35A5.87.554e-1424.90pep chromosome:WBcel235:X:3800045:3802767:-1 gene:... [more]
F35A5.89.290e-1325.19pep chromosome:WBcel235:X:3800737:3802771:-1 gene:... [more]
F35A5.82.570e-1225.19pep chromosome:WBcel235:X:3800045:3802771:-1 gene:... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
EndoB5.383e-2028.00gene:FBgn0034433 transcript:FBtr0086559[more]
EndoB2.609e-1927.82gene:FBgn0034433 transcript:FBtr0113098[more]
EndoB5.302e-1726.72gene:FBgn0034433 transcript:FBtr0086558[more]
EndoB2.311e-1626.54gene:FBgn0034433 transcript:FBtr0113097[more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb1b4.820e-1626.69SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb1b6.718e-1626.89SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb1a1.210e-1225.98SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
sh3glb1a1.210e-1225.98SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
sh3glb1b5.581e-1124.23SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb15.796e-1827.50SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb11.415e-1427.19SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb11.463e-1426.73SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb11.815e-1426.73SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb12.482e-1425.48SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3glb13.052e-1626.75SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb13.274e-1626.75SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb13.573e-1224.62SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb28.002e-1226.34SH3-domain GRB2-like endophilin B2 [Source:MGI Sym... [more]
Sh3glb29.530e-1226.34SH3-domain GRB2-like endophilin B2 [Source:MGI Sym... [more]
back to top
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32LM0|SHLB1_BOVIN2.544e-1627.57Endophilin-B1 OS=Bos taurus OX=9913 GN=SH3GLB1 PE=... [more]
sp|Q5ZIR1|SHLB1_CHICK1.001e-1528.03Endophilin-B1 OS=Gallus gallus OX=9031 GN=SH3GLB1 ... [more]
sp|Q5R8P5|SHLB1_PONAB1.824e-1527.16Endophilin-B1 OS=Pongo abelii OX=9601 GN=SH3GLB1 P... [more]
sp|Q9Y371|SHLB1_HUMAN1.824e-1527.16Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 P... [more]
sp|Q9JK48|SHLB1_MOUSE2.290e-1526.75Endophilin-B1 OS=Mus musculus OX=10090 GN=Sh3glb1 ... [more]
back to top
BLAST of BAR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182QAX58.299e-1930.56Uncharacterized protein OS=Anopheles farauti OX=69... [more]
A0A182ND829.719e-1930.56Uncharacterized protein OS=Anopheles dirus OX=7168... [more]
A0A182YE511.582e-1830.40BAR domain-containing protein OS=Anopheles stephen... [more]
A0A1B6EXW91.692e-1828.25Uncharacterized protein OS=Cuerna arida OX=1464854... [more]
A0A034VWM52.966e-1829.69Endophilin-B1 OS=Bactrocera dorsalis OX=27457 GN=S... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sh3glb2a3.808e-1429.22SH3-domain GRB2-like endophilin B2a [Source:ZFIN;A... [more]
sh3glb2b2.453e-1126.12SH3-domain GRB2-like endophilin B2b [Source:ZFIN;A... [more]
sh3glb1b9.144e-1125.00SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb1a4.502e-1024.41SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SH3GLB22.728e-1624.64SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sh3glb1a1.689e-1027.07SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO382012.542e-1325.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb1a6.752e-1526.54endophilin-B1 [Source:NCBI gene;Acc:101156208][more]
sh3glb2b8.127e-1525.71SH3 domain containing GRB2 like, endophilin B2 [So... [more]
ENSORLT00000021068.21.631e-1424.73endophilin-B2 [Source:NCBI gene;Acc:101169212][more]
sh3glb2b1.621e-1325.00SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sh3glb2b3.863e-1325.18SH3 domain containing GRB2 like, endophilin B2 [So... [more]
back to top
BLAST of BAR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043769.12.327e-178100.00SMESG000043769.1[more]
SMESG000043769.11.721e-17468.83SMESG000043769.1[more]
SMESG000043769.13.803e-16899.59SMESG000043769.1[more]
SMESG000043769.19.521e-16794.57SMESG000043769.1[more]
SMESG000043769.11.461e-16199.59SMESG000043769.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030202 ID=SMED30030202|Name=BAR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3133bp
AAAAATTGTTTTAATAGTCTAATCTTTGATAGTAAAAAGCGTAACAAATT
TGTATATTTTTCATGACTACTACGCAAAATCTTGAAATGGACGTAATCAA
AATGCTTAATGCTGCTGGAACAACTTTAGGCAGAATTTTCCAGCAAGCTG
AAGAAGCATTTCTAGACATTCCAAGAACTGAATATACAATTGAATATAAA
GACAATATTAAAAAAGTGGATTTTTTGATATTGCTGACGCAGAAGCTAAT
TAGTGATTTTGAAGTTTTCTTGCAAGCCAATTCCGAGCCAATTGATAAAA
TGACACAAATCGAAGAATTTGGAACTGTGCTTCAGAGTCCACTAGAAGAA
ACTAAATTCTATTCTTCACTGTTTAACAAAGATTTAGTTAAAGTGGGAAA
ATATCAAAACAAGTTGGGGGTGGCATTTAACGCCTACATAAAGAAAGAGT
CGGAAACCTATATCAAAAAATTGAGAAAAATGCTTGAAGTCGATCTGAAA
AGATTTAAGGAAGAAGAGGAAATTTTGGAAAATCTTAGACTTGACCACGA
TTATTTGAAGAATCGAATGAATAACGCATATACGACCCTTGGAAGAGCCG
CGCTTGAAAAAGAATTTGAAAAAGTGCGCCATGAATTTGAAAGTTATTAT
GAAAAAACTCTTCAGTATTTCAAAACCGTCGACAGTTATTTTACGATTCA
CCGAGTTTTGTTGAAAGAATTCGTTGAAATACAAAGAAATTATTACAGAG
ATTGCGATAAAAATCTTTCGATTCTTCTGAGAAAACTCTATAATGAGAAT
TTTTGGAAAATTTTCCAAAATGAAATTAGTCCTCACCATTTACTATTTTA
TTCTGCTTTTTGGTTTATCAGCAGTTTGTATGCCGTTTTACTGTATTGAG
TTAGTCTGTTAAGTATGTTTGTTCCAATACTTTTTCAATTTCTATACAAC
TAATGTTCAATGAAATAAATCATCTTACATAAAACGTTAATCCATACAAC
CAGATGTGCTACTTTGTCCCGCGGTTCTGAATGTTTGCGCACATGTGACA
GGCAAGCGACATATATTCATGTCACGAGAACAATGCGAATTCTGGAACAG
TTTTTGTCTCATACTGGAACCTAATAAATACGAGAGTGAACGCTTCCTTC
GTATTTTAACTGCGGCCAAACGTACTAAACATCCTTTGAATACAATGGCT
TGCAGAAACACATGGCGCTTTTTCGGCTGATTCCTTTATTATTTGAATTT
TATCCAAATTAATAATTATCTCAATTCTAGATTAAATTTGAATCGATATT
AAATAATATTGATTAAAGATAATTATTAATTTTAATTAAATTTTAAGTAT
TAAGCAATATGCCGAAAAATTACCCAAAATTGTCTCATTTCATTTGCTTC
TAATCATGATTTCCTGATACATCGTTAATTCTTTAAAGAGCTTTTAATCA
AAAACTCGTGGTGATGGACAATAAATGATATTTCAGCAAACAAAACCTTG
TTCCATTTACATAATATTTTGATAAATCATTTGAAATGTAAATAAATGAC
ATAATAAATACAAACATAAAGCCGATTTGAACTTAATATACGCAGAAATA
CATTCTCAAATTTCAACAAGTTAACCATATTAAAAAAAAATCATCATTAA
ACCCAAAAACTATTTCAACTAATTGTTAATTTTATAAATCCTAAAATTAA
TTTATCAAACATATTACGAAAAAAAATATCCCAATTATTATTCAACCATA
AAAAATGTCAGCCAATATAGATTAAAACATGTAAAAGAATATATAATAAC
ATTTTGTCATATTTATAGACAATGACAGAAAACGTATAAATGAAATATAC
AAATCACTTAGAATGAAATATAGACATAAAGCACGATCAGAGCCAATAAT
CATTGACAATAGACGTAGAAAATTATATTCTAAACAATCATTTGGAGATT
TGGAAAATAAATCGTTTTCCATAAATAATGAATCCTACAAATCCATGTCG
GATGAAAATCGTGACAATTCAATCGAGTTCAACGGCGATGTCATTGTGAG
TTTAAGTTCTGAAATCGTTCCACAAGAATCAAATAATTTTCCTTTTGATG
AAACCGAAACAATTTCTCCATCTGTTGTTTTAACAGAAAAAAGTGAAATG
GCCATTTCAAACGATGAAATTATTCCATTCACAGATTTCCAATCAAATAT
TGAATTTCCCGAAAAAGAAACAACAACTGGAGCACAGGATATTTCATTAC
TTACGATGGATGAAGAGATCAAAATAAATCTTTGTGAAGGCCCCGATAAA
GAAACCGATTCAAATTGTTCAAAATTTGGGTTGAAAAATAAAATAAAACT
TGGTATAATTTTTGAAAATCTTCCTGAATCAGAAAATTCTGAAATTTCTT
CCAACTCGTCCCCCGATATCGATGCCGTAACAAATATGAAAATGGGTAAC
GAAGAAAACATAAAATTAGCAGTTTCCACCAATTACGGTGTTTCTCCAAG
CGTCGAAGAATTTGAAGTAAAAACTCCTGAAATTATAAATGCGGCTTCAA
GCTCACTGAATTTGGAAAATTCTTTAACTTTTGATGAAAACATTTCCAAA
GAACCAGAAATTAATAAAGAAATAATAGACACAGTTCTTTCATGTTAGCT
TTCTTTCTCATTGAAAGTGAAATAAAAAAGAGTCTATAGTAAATATCAAT
TCAGAACCCGAGCTGGAGTCATTAAAATTAGACGACGACCTGACTACGAA
CCCCGCTACTGGGACTGAGATTTCGATGCCTTCGATTTCATTGAATCTAA
ATCAAAGTTTGGATGAAGAAGGTTGTATATGCAAGCCTGACTCAATAGAG
CTGGACCCAGAAGTTTTCCAAAGATCCATAAATACTCATGAAGCACCATC
TACCCTCATTTCAGTAAATATCAATTCAGAACTTGAAATACAGCCAAATT
TAGGCATGGAGCAAATTTCAACAAATTTAATAACTGAACCGGAAGTAAAT
GTTAAAGGATCAGACTATAAAGACACAACAGAACCTTCAGTTTCAGTGAA
CATCAATCTTGAACCGGCAGTAAAACTTGATGAAGTTTCAGACGAATTTT
CAGTGGGATCAATAACCGATCCGGAAGTAAATA
back to top

protein sequence of SMED30030202-orf-1

>SMED30030202-orf-1 ID=SMED30030202-orf-1|Name=SMED30030202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MKYRHKARSEPIIIDNRRRKLYSKQSFGDLENKSFSINNESYKSMSDENR
DNSIEFNGDVIVSLSSEIVPQESNNFPFDETETISPSVVLTEKSEMAISN
DEIIPFTDFQSNIEFPEKETTTGAQDISLLTMDEEIKINLCEGPDKETDS
NCSKFGLKNKIKLGIIFENLPESENSEISSNSSPDIDAVTNMKMGNEENI
KLAVSTNYGVSPSVEEFEVKTPEIINAASSSLNLENSLTFDENISKEPEI
NKEIIDTVLSC*
back to top

protein sequence of SMED30030202-orf-2

>SMED30030202-orf-2 ID=SMED30030202-orf-2|Name=SMED30030202-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MTTTQNLEMDVIKMLNAAGTTLGRIFQQAEEAFLDIPRTEYTIEYKDNIK
KVDFLILLTQKLISDFEVFLQANSEPIDKMTQIEEFGTVLQSPLEETKFY
SSLFNKDLVKVGKYQNKLGVAFNAYIKKESETYIKKLRKMLEVDLKRFKE
EEEILENLRLDHDYLKNRMNNAYTTLGRAALEKEFEKVRHEFESYYEKTL
QYFKTVDSYFTIHRVLLKEFVEIQRNYYRDCDKNLSILLRKLYNENFWKI
FQNEISPHHLLFYSAFWFISSLYAVLLY*
back to top

protein sequence of SMED30030202-orf-3

>SMED30030202-orf-3 ID=SMED30030202-orf-3|Name=SMED30030202-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MPSISLNLNQSLDEEGCICKPDSIELDPEVFQRSINTHEAPSTLISVNIN
SELEIQPNLGMEQISTNLITEPEVNVKGSDYKDTTEPSVSVNINLEPAVK
LDEVSDEFSVGSITDPEVN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR028503SH3GLB1
IPR004148BAR_dom
IPR027267AH/BAR_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 138..168
NoneNo IPR availableCOILSCoilCoilcoord: 178..198
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 106..243
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
IPR004148BAR domainSMARTSM007215barcoord: 14..244
e-value: 1.6E-8
score: 44.3
IPR004148BAR domainPFAMPF03114BARcoord: 23..241
e-value: 1.1E-21
score: 77.6
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 12..245
e-value: 3.0E-26
score: 94.9
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 23..242
IPR028503Endophilin-B1PANTHERPTHR14167:SF52ENDOPHILIN-B1coord: 106..243