Lamin-B receptor

Overview
NameLamin-B receptor
Smed IDSMED30030198
Length (bp)1808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lamin-B receptor (SMED30030198) t-SNE clustered cells

Violin plots show distribution of expression levels for Lamin-B receptor (SMED30030198) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lamin-B receptor (SMED30030198) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lamin-B receptor (SMED30030198) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030198

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030198SMESG000042131.1 SmedASXL_019163SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030198SMESG000042131.1 SmedASXL_019163SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030198SMESG000042131.1 dd_Smed_v4_2016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030198SMESG000042131.1 Contig51198uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030198SMESG000042131.1 Contig51198newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30030198SMESG000042131.1 SMED30030198smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030198SMESG000042131.1 SMED30030198smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30030198SMESG000042131.1 SMED_02186_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030198SMESG000042131.1 SMED_02186_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lamin-B receptor vs. Ensembl Human
Match: LBR (lamin B receptor [Source:HGNC Symbol;Acc:HGNC:6518])

HSP 1 Score: 216.853 bits (551), Expect = 8.873e-62
Identity = 117/359 (32.59%), Postives = 199/359 (55.43%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTTK-KGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAI--QINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W +       +PIGK    T    G  +KYR NG  + I+T +++ G    + +    VY ++     ++ +  VV    L ++S    +  ++     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N++  L +++ ++    + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF+++     +    N    P+  L  I V+ L GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF + ++ R  +D+  C  ++G AW  Y + VPYR+ P+++
Sbjct:  260 GVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFYAFILT-SAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAMILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASL--IIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY 615          
BLAST of Lamin-B receptor vs. Ensembl Human
Match: LBR (lamin B receptor [Source:HGNC Symbol;Acc:HGNC:6518])

HSP 1 Score: 216.853 bits (551), Expect = 8.873e-62
Identity = 117/359 (32.59%), Postives = 199/359 (55.43%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTTK-KGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAI--QINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W +       +PIGK    T    G  +KYR NG  + I+T +++ G    + +    VY ++     ++ +  VV    L ++S    +  ++     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N++  L +++ ++    + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF+++     +    N    P+  L  I V+ L GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF + ++ R  +D+  C  ++G AW  Y + VPYR+ P+++
Sbjct:  260 GVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFYAFILT-SAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAMILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASL--IIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY 615          
BLAST of Lamin-B receptor vs. Ensembl Human
Match: TM7SF2 (transmembrane 7 superfamily member 2 [Source:HGNC Symbol;Acc:HGNC:11863])

HSP 1 Score: 198.749 bits (504), Expect = 7.544e-57
Identity = 92/253 (36.36%), Postives = 155/253 (61.26%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N IY+F +GRE+N R    D K+F E RPG  GW+++N+   +K+ E R   S+  ++      Q++Y  DA+  E  +++   + +  FGF    G+   VPF ++L  + +  +   L +   + I +IN  GY I+R +N QKN+FR+NP    +  L+TI+   G ++LV GWWG++RHPNY GD+I+ L+WSL  G++  + +FY +YF   ++ R  +D+R+C  ++G AW +Y + VPYR++P+++
Sbjct:  168 NPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSL--AMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINATGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY 418          
BLAST of Lamin-B receptor vs. Ensembl Human
Match: TM7SF2 (transmembrane 7 superfamily member 2 [Source:HGNC Symbol;Acc:HGNC:11863])

HSP 1 Score: 153.68 bits (387), Expect = 6.974e-42
Identity = 74/198 (37.37%), Postives = 118/198 (59.60%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSL 1463
            N IY+F +GRE+N R    D K+F E RPG  GW+++N+   +K+ E R   S+  ++      Q++Y  DA+  E  +++   + +  FGF    G+   VPF ++L  + +  +   L +   + I +IN  GY I+R +N QKN+FR+NP    +  L+TI+   G ++LV GWWG++RHPNY GD+I+ L+WSL
Sbjct:   74 NPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSL--AMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINATGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALAWSL 269          
BLAST of Lamin-B receptor vs. Ensembl Human
Match: TM7SF2 (transmembrane 7 superfamily member 2 [Source:HGNC Symbol;Acc:HGNC:11863])

HSP 1 Score: 156.762 bits (395), Expect = 9.700e-42
Identity = 80/253 (31.62%), Postives = 138/253 (54.55%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N IY+F +GRE+N R    D K+F E RPG  GW+++N+   +K+ E R   S+  ++      Q++Y  DA+  E  +++   + +  FGF    G+   VPF ++L  + +  +   L +   + I +IN                            L+TI+   G ++LV GWWG++RHPNY GD+I+ L+WSL  G++  + +FY +YF   ++ R  +D+R+C  ++G AW +Y + VPYR++P+++
Sbjct:  168 NPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSL--AMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLIN---------------------------GLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY 391          
BLAST of Lamin-B receptor vs. Ensembl Celegans
Match: dhcr-7 (DeHydroCholesterol Reductase; Sterol reductase [Source:UniProtKB/TrEMBL;Acc:G5ED82])

HSP 1 Score: 69.3218 bits (168), Expect = 3.429e-12
Identity = 56/264 (21.21%), Postives = 108/264 (40.91%), Query Frame = 3
Query:  867 INFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHL---------CHLKTITNRHGHQILVG-GWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            +  I  F  G E + +   +DLK F   R  F  W +   +          +  I+ SL+  +  Q++Y       E   ++        FGF+    + V+ P ++T     +   N  + +        + +   +     + QK  FR++  ++ +            +T +      +L+G G WG+ RHPNY  + I   ++S + G    +     ++ +LF++ R   D+ +C +++G  W  Y   V YR +P VF
Sbjct:  196 VTTISEFWFGIENHPKILDIDLKSFIRTRFTFVIWPLF--VISAMYFHKITYGQISTSLVCLSSVQLLYIFQFHWNEDLFLNSLDSKRCDFGFYRIWADFVLGPIIYTSPVTILVATNRSVGVISNCLFCAVAIGSMVFTAKCDRQKYEFRKSKGTLKVGGVDAFFISAKYRTDSGDANTNLLLGSGHWGVCRHPNYASEAITFAAFSAFQGFPSTIAHIPSLFVILFLVARAFTDENRCLIKYGQYWAQYCSKVKYRFLPGVF 457          
BLAST of Lamin-B receptor vs. Ensembl Celegans
Match: dhcr-7 (DeHydroCholesterol Reductase; Sterol reductase [Source:UniProtKB/TrEMBL;Acc:G5ED82])

HSP 1 Score: 69.3218 bits (168), Expect = 3.429e-12
Identity = 56/264 (21.21%), Postives = 108/264 (40.91%), Query Frame = 3
Query:  867 INFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHL---------CHLKTITNRHGHQILVG-GWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            +  I  F  G E + +   +DLK F   R  F  W +   +          +  I+ SL+  +  Q++Y       E   ++        FGF+    + V+ P ++T     +   N  + +        + +   +     + QK  FR++  ++ +            +T +      +L+G G WG+ RHPNY  + I   ++S + G    +     ++ +LF++ R   D+ +C +++G  W  Y   V YR +P VF
Sbjct:  196 VTTISEFWFGIENHPKILDIDLKSFIRTRFTFVIWPLF--VISAMYFHKITYGQISTSLVCLSSVQLLYIFQFHWNEDLFLNSLDSKRCDFGFYRIWADFVLGPIIYTSPVTILVATNRSVGVISNCLFCAVAIGSMVFTAKCDRQKYEFRKSKGTLKVGGVDAFFISAKYRTDSGDANTNLLLGSGHWGVCRHPNYASEAITFAAFSAFQGFPSTIAHIPSLFVILFLVARAFTDENRCLIKYGQYWAQYCSKVKYRFLPGVF 457          
BLAST of Lamin-B receptor vs. Ensembl Fly
Match: LBR (gene:FBgn0034657 transcript:FBtr0071712)

HSP 1 Score: 69.707 bits (169), Expect = 4.740e-12
Identity = 60/217 (27.65%), Postives = 104/217 (47.93%), Query Frame = 3
Query:  861 RPINFIYNFIVGREINTRFFG-LDLKFFYEFRPGFTGWMILNIIFCLK--------DLEDRE---------FKSINY--SLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKC-LASIAVINLI--GYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDII 1442
            R  +F+ +F +GR++N ++ G +D K F ++R      +I    +  +         L ++E         + ++NY  + LF A   + Y LDA++FE  + S   + +  +G    L      P+L T  T+       ++PI C  A +AV  L+  G ++ R S   K  +R N  S    +++TI    G ++L+ G WG +R PNY GDI+
Sbjct:  441 RTGSFVVDFALGRQLNPKWLGRVDWKQF-QYRLSLVTTLIYATCYIYQTLVWPQKPQLGEQEGYLYQAKYYWNNVNYDPATLFSASCLLFYVLDAIIFEHHLSSSFELQHEGYGCLLLL-RYAATPYLLTAVTKYFYEQ--RVPISCWYAPLAVAALLSLGLLVKRFSCAYKYKYRLNSQSPIFANIETIHTYQGSRLLLSGMWGWVRQPNYLGDIV 653          
BLAST of Lamin-B receptor vs. Ensembl Fly
Match: LBR (gene:FBgn0034657 transcript:FBtr0071711)

HSP 1 Score: 69.707 bits (169), Expect = 4.740e-12
Identity = 60/217 (27.65%), Postives = 104/217 (47.93%), Query Frame = 3
Query:  861 RPINFIYNFIVGREINTRFFG-LDLKFFYEFRPGFTGWMILNIIFCLK--------DLEDRE---------FKSINY--SLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKC-LASIAVINLI--GYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDII 1442
            R  +F+ +F +GR++N ++ G +D K F ++R      +I    +  +         L ++E         + ++NY  + LF A   + Y LDA++FE  + S   + +  +G    L      P+L T  T+       ++PI C  A +AV  L+  G ++ R S   K  +R N  S    +++TI    G ++L+ G WG +R PNY GDI+
Sbjct:  441 RTGSFVVDFALGRQLNPKWLGRVDWKQF-QYRLSLVTTLIYATCYIYQTLVWPQKPQLGEQEGYLYQAKYYWNNVNYDPATLFSASCLLFYVLDAIIFEHHLSSSFELQHEGYGCLLLL-RYAATPYLLTAVTKYFYEQ--RVPISCWYAPLAVAALLSLGLLVKRFSCAYKYKYRLNSQSPIFANIETIHTYQGSRLLLSGMWGWVRQPNYLGDIV 653          
BLAST of Lamin-B receptor vs. Ensembl Fly
Match: LBR (gene:FBgn0034657 transcript:FBtr0071713)

HSP 1 Score: 69.707 bits (169), Expect = 5.053e-12
Identity = 60/217 (27.65%), Postives = 104/217 (47.93%), Query Frame = 3
Query:  861 RPINFIYNFIVGREINTRFFG-LDLKFFYEFRPGFTGWMILNIIFCLK--------DLEDRE---------FKSINY--SLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKC-LASIAVINLI--GYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDII 1442
            R  +F+ +F +GR++N ++ G +D K F ++R      +I    +  +         L ++E         + ++NY  + LF A   + Y LDA++FE  + S   + +  +G    L      P+L T  T+       ++PI C  A +AV  L+  G ++ R S   K  +R N  S    +++TI    G ++L+ G WG +R PNY GDI+
Sbjct:  466 RTGSFVVDFALGRQLNPKWLGRVDWKQF-QYRLSLVTTLIYATCYIYQTLVWPQKPQLGEQEGYLYQAKYYWNNVNYDPATLFSASCLLFYVLDAIIFEHHLSSSFELQHEGYGCLLLL-RYAATPYLLTAVTKYFYEQ--RVPISCWYAPLAVAALLSLGLLVKRFSCAYKYKYRLNSQSPIFANIETIHTYQGSRLLLSGMWGWVRQPNYLGDIV 678          
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Match: lbr (lamin B receptor [Source:ZFIN;Acc:ZDB-GENE-030804-11])

HSP 1 Score: 228.794 bits (582), Expect = 2.200e-66
Identity = 138/463 (29.81%), Postives = 243/463 (52.48%), Query Frame = 3
Query:  249 RRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPIN--FIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            RR  Q + K +  +  +E E + ++K P  +   + E                F     ++F  M    +  + LL    +  A ++    +   LQ   D +  GIV+ WL++ A L+ +P+GK       K G  +KYR NG  ++++T  + AG+   + +    ++ ++     S++L+A +    L ++S    K ++A    +   IY+F +GRE+N R    D+KFF E RPG  GW+++N    L +++ +  ++ + ++L   I Q+++ +D +  E  +++   ++   FGF    G+   VPF FT     +  +  +L +  + ++  +N +GY I+R +N QK +FR+NP    + HLKTI    G  ++V G WG +RHPNY GDII+ L+WSL  G N  V +FY IY +  ++ R  +D+R+C  ++G+AW +Y KAVPYR+ P V+
Sbjct:  175 RRKDQGDGKAVELEKAVESEPLLQTKAPAAVKTADLE----------------FGGRVGVLFL-MFLLPVAVLVLLILCGQKDASLQSFPLELPALQSVWDCQVFGIVLLWLLFQAFLSLLPVGKLVEGMPLKNGKTLKYRINGFYALLLTAVA-AGVAVYQEVDLSYIHAHFLQFYTSALLIATLLSIYLFIRSRWASKDELAPGGNSGYIIYDFFMGRELNPRIKSFDIKFFCEMRPGLMGWVLINFAMLLAEMKQQNLENPSPAMLLVNIFQLLWVIDGLWHEEKLLTMMDIMYDGFGFMLTFGDLAFVPFTFTCQAYYLVNHPNELSVFWIITLIAMNGVGYYIFRKANSQKFAFRKNPSDPAVSHLKTIPTATGKSLIVSGLWGFVRHPNYLGDIIMALAWSLPCGFNNLVPYFYLIYLVTLLVHRNARDERQCRKKYGSAWEEYCKAVPYRIFPRVY 619          
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Match: lbr (lamin B receptor [Source:ZFIN;Acc:ZDB-GENE-030804-11])

HSP 1 Score: 228.794 bits (582), Expect = 2.200e-66
Identity = 138/463 (29.81%), Postives = 243/463 (52.48%), Query Frame = 3
Query:  249 RRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPIN--FIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            RR  Q + K +  +  +E E + ++K P  +   + E                F     ++F  M    +  + LL    +  A ++    +   LQ   D +  GIV+ WL++ A L+ +P+GK       K G  +KYR NG  ++++T  + AG+   + +    ++ ++     S++L+A +    L ++S    K ++A    +   IY+F +GRE+N R    D+KFF E RPG  GW+++N    L +++ +  ++ + ++L   I Q+++ +D +  E  +++   ++   FGF    G+   VPF FT     +  +  +L +  + ++  +N +GY I+R +N QK +FR+NP    + HLKTI    G  ++V G WG +RHPNY GDII+ L+WSL  G N  V +FY IY +  ++ R  +D+R+C  ++G+AW +Y KAVPYR+ P V+
Sbjct:  175 RRKDQGDGKAVELEKAVESEPLLQTKAPAAVKTADLE----------------FGGRVGVLFL-MFLLPVAVLVLLILCGQKDASLQSFPLELPALQSVWDCQVFGIVLLWLLFQAFLSLLPVGKLVEGMPLKNGKTLKYRINGFYALLLTAVA-AGVAVYQEVDLSYIHAHFLQFYTSALLIATLLSIYLFIRSRWASKDELAPGGNSGYIIYDFFMGRELNPRIKSFDIKFFCEMRPGLMGWVLINFAMLLAEMKQQNLENPSPAMLLVNIFQLLWVIDGLWHEEKLLTMMDIMYDGFGFMLTFGDLAFVPFTFTCQAYYLVNHPNELSVFWIITLIAMNGVGYYIFRKANSQKFAFRKNPSDPAVSHLKTIPTATGKSLIVSGLWGFVRHPNYLGDIIMALAWSLPCGFNNLVPYFYLIYLVTLLVHRNARDERQCRKKYGSAWEEYCKAVPYRIFPRVY 619          
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-041212-19])

HSP 1 Score: 207.994 bits (528), Expect = 1.525e-60
Identity = 122/401 (30.42%), Postives = 214/401 (53.37%), Query Frame = 3
Query:  435 CCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEK--IKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            C  VF  +  ++LL+      A +           +  D     ++  W+   + L  +PIGK +     + G  +KY  NG  ++ IT   L  +     +    +++    L   +I V+ +    L ++S+   +  + +     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N+   +K++E R+  S+  ++L     Q++Y  DA+  E  +++   +++  FGF    G+   VPF ++L    + ++   L       I ++N IGY I+R SN QKN FR++P    + HL+TI    G ++LV GWWG +RHPNY GD+++ L+WSL  G++  + +FY IYF + +I R  +D+++C  ++G AW+ Y + VPYR+IP+V+
Sbjct:   24 CIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPATHLWDPWAAVLIAGWIALQSFLYLLPIGKVSEGLVLRDGSRLKYPINGFHALSITAVLLI-ICILLGMPLGHLFELILPLAICAIGVSYLLSMYLYIRSFWAHQHALSLGGNTGNPLYDFFMGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSPSL--AMLLVNGFQLLYVTDALWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAMFLVVHPQSLSTLGAVGIVLLNGIGYYIFRRSNSQKNQFRRDPKHKSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDLLMALAWSLPCGISHILPYFYVIYFTILLIHREARDEKQCRAKYGVAWDTYCRRVPYRIIPYVY 421          
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-041212-19])

HSP 1 Score: 207.994 bits (528), Expect = 1.525e-60
Identity = 122/401 (30.42%), Postives = 214/401 (53.37%), Query Frame = 3
Query:  435 CCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEK--IKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            C  VF  +  ++LL+      A +           +  D     ++  W+   + L  +PIGK +     + G  +KY  NG  ++ IT   L  +     +    +++    L   +I V+ +    L ++S+   +  + +     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N+   +K++E R+  S+  ++L     Q++Y  DA+  E  +++   +++  FGF    G+   VPF ++L    + ++   L       I ++N IGY I+R SN QKN FR++P    + HL+TI    G ++LV GWWG +RHPNY GD+++ L+WSL  G++  + +FY IYF + +I R  +D+++C  ++G AW+ Y + VPYR+IP+V+
Sbjct:   24 CIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPATHLWDPWAAVLIAGWIALQSFLYLLPIGKVSEGLVLRDGSRLKYPINGFHALSITAVLLI-ICILLGMPLGHLFELILPLAICAIGVSYLLSMYLYIRSFWAHQHALSLGGNTGNPLYDFFMGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSPSL--AMLLVNGFQLLYVTDALWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAMFLVVHPQSLSTLGAVGIVLLNGIGYYIFRRSNSQKNQFRRDPKHKSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDLLMALAWSLPCGISHILPYFYVIYFTILLIHREARDEKQCRAKYGVAWDTYCRRVPYRIIPYVY 421          
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-041212-19])

HSP 1 Score: 207.994 bits (528), Expect = 1.525e-60
Identity = 122/401 (30.42%), Postives = 214/401 (53.37%), Query Frame = 3
Query:  435 CCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEK--IKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            C  VF  +  ++LL+      A +           +  D     ++  W+   + L  +PIGK +     + G  +KY  NG  ++ IT   L  +     +    +++    L   +I V+ +    L ++S+   +  + +     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N+   +K++E R+  S+  ++L     Q++Y  DA+  E  +++   +++  FGF    G+   VPF ++L    + ++   L       I ++N IGY I+R SN QKN FR++P    + HL+TI    G ++LV GWWG +RHPNY GD+++ L+WSL  G++  + +FY IYF + +I R  +D+++C  ++G AW+ Y + VPYR+IP+V+
Sbjct:   24 CIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPATHLWDPWAAVLIAGWIALQSFLYLLPIGKVSEGLVLRDGSRLKYPINGFHALSITAVLLI-ICILLGMPLGHLFELILPLAICAIGVSYLLSMYLYIRSFWAHQHALSLGGNTGNPLYDFFMGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSPSL--AMLLVNGFQLLYVTDALWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAMFLVVHPQSLSTLGAVGIVLLNGIGYYIFRRSNSQKNQFRRDPKHKSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDLLMALAWSLPCGISHILPYFYVIYFTILLIHREARDEKQCRAKYGVAWDTYCRRVPYRIIPYVY 421          
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Match: rp9 (retinitis pigmentosa 9 (autosomal dominant) [Source:Xenbase;Acc:XB-GENE-944905])

HSP 1 Score: 228.024 bits (580), Expect = 8.956e-68
Identity = 132/392 (33.67%), Postives = 219/392 (55.87%), Query Frame = 3
Query:  465 VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGK-TAYSTTKKGIEVKYRFNGVISMIITITSLAG-LMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA--FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++LL   S + A +  +      L    D   + +++ W+   A L  +PIGK T   T +    +KYR N + +M++T    AG +M+   L+   VYD++  +   +  +A++    L  KS    +  +A      N +Y+F +G E+N R    DLK+F E RPG  GW ++N+ F +KD+E R   S++  L+F    Q +Y +DA+  E  I++   +++  FGF    G+   VPF ++L    +  +  +L       I ++N +GYII+R SN QKN+FR+NP    +  L+TI    G ++LV GWWGL+RHPNY GD+I+ L+WSL  GL+  + +FY IYF + ++ R  +D+ +C  ++G AW +Y + VPYR+ P+++
Sbjct:   44 LYLLVTCSTEDASVLRVPGPWPALDTLWDPFAVILLLSWVSLQAVLYMLPIGKVTEGITLRDNTRLKYRINALQAMMVTALIAAGAVMFGFPLS--YVYDHFLQMAVGAAFIALILSIFLYAKSLAAPQSALAPGGNSGNPLYDFFIGHELNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKDIELRGSPSLSMILVFG--FQALYVVDAMKHEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELSTYAAVGIILLNAVGYIIFRGSNSQKNAFRRNPADPKVVGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMALAWSLPCGLSNILPYFYVIYFTVLLVHREARDEHQCMKKYGVAWQEYCRRVPYRIFPYIY 431          
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Match: rp9 (retinitis pigmentosa 9 (autosomal dominant) [Source:Xenbase;Acc:XB-GENE-944905])

HSP 1 Score: 226.868 bits (577), Expect = 1.427e-67
Identity = 132/392 (33.67%), Postives = 219/392 (55.87%), Query Frame = 3
Query:  465 VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGK-TAYSTTKKGIEVKYRFNGVISMIITITSLAG-LMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA--FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++LL   S + A +  +      L    D   + +++ W+   A L  +PIGK T   T +    +KYR N + +M++T    AG +M+   L+   VYD++  +   +  +A++    L  KS    +  +A      N +Y+F +G E+N R    DLK+F E RPG  GW ++N+ F +KD+E R   S++  L+F    Q +Y +DA+  E  I++   +++  FGF    G+   VPF ++L    +  +  +L       I ++N +GYII+R SN QKN+FR+NP    +  L+TI    G ++LV GWWGL+RHPNY GD+I+ L+WSL  GL+  + +FY IYF + ++ R  +D+ +C  ++G AW +Y + VPYR+ P+++
Sbjct:   26 LYLLVTCSTEDASVLRVPGPWPALDTLWDPFAVILLLSWVSLQAVLYMLPIGKVTEGITLRDNTRLKYRINALQAMMVTALIAAGAVMFGFPLS--YVYDHFLQMAVGAAFIALILSIFLYAKSLAAPQSALAPGGNSGNPLYDFFIGHELNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKDIELRGSPSLSMILVFG--FQALYVVDAMKHEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELSTYAAVGIILLNAVGYIIFRGSNSQKNAFRRNPADPKVVGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMALAWSLPCGLSNILPYFYVIYFTVLLVHREARDEHQCMKKYGVAWQEYCRRVPYRIFPYIY 413          
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Match: rp9 (retinitis pigmentosa 9 (autosomal dominant) [Source:Xenbase;Acc:XB-GENE-944905])

HSP 1 Score: 227.254 bits (578), Expect = 1.919e-66
Identity = 132/392 (33.67%), Postives = 219/392 (55.87%), Query Frame = 3
Query:  465 VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGK-TAYSTTKKGIEVKYRFNGVISMIITITSLAG-LMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA--FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++LL   S + A +  +      L    D   + +++ W+   A L  +PIGK T   T +    +KYR N + +M++T    AG +M+   L+   VYD++  +   +  +A++    L  KS    +  +A      N +Y+F +G E+N R    DLK+F E RPG  GW ++N+ F +KD+E R   S++  L+F    Q +Y +DA+  E  I++   +++  FGF    G+   VPF ++L    +  +  +L       I ++N +GYII+R SN QKN+FR+NP    +  L+TI    G ++LV GWWGL+RHPNY GD+I+ L+WSL  GL+  + +FY IYF + ++ R  +D+ +C  ++G AW +Y + VPYR+ P+++
Sbjct:  136 LYLLVTCSTEDASVLRVPGPWPALDTLWDPFAVILLLSWVSLQAVLYMLPIGKVTEGITLRDNTRLKYRINALQAMMVTALIAAGAVMFGFPLS--YVYDHFLQMAVGAAFIALILSIFLYAKSLAAPQSALAPGGNSGNPLYDFFIGHELNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKDIELRGSPSLSMILVFG--FQALYVVDAMKHEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELSTYAAVGIILLNAVGYIIFRGSNSQKNAFRRNPADPKVVGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMALAWSLPCGLSNILPYFYVIYFTVLLVHREARDEHQCMKKYGVAWQEYCRRVPYRIFPYIY 523          
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Match: rp9 (retinitis pigmentosa 9 (autosomal dominant) [Source:Xenbase;Acc:XB-GENE-944905])

HSP 1 Score: 223.402 bits (568), Expect = 3.756e-66
Identity = 130/392 (33.16%), Postives = 217/392 (55.36%), Query Frame = 3
Query:  465 VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAY-STTKKGIEVKYRFNGVISMIITITSLAG-LMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA--FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++LL   S + A +  +      L    D   + +++ W+   A L  +PIGK  +         +KYR N + +M++T    AG +M+   L+   VYD++  +   +  +A++    L  KS    +  +A      N +Y+F +G E+N R    DLK+F E RPG  GW ++N+ F +KD+E R   S++  L+F    Q +Y +DA+  E  I++   +++  FGF    G+   VPF ++L    +  +  +L       I ++N +GYII+R SN QKN+FR+NP    +  L+TI    G ++LV GWWGL+RHPNY GD+I+ L+WSL  GL+  + +FY IYF + ++ R  +D+ +C  ++G AW +Y + VPYR+ P+++
Sbjct:   38 LYLLVTCSTEDASVLRVPGPWPALDTLWDPFAVILLLSWVSLQAVLYMLPIGKVFHVEYVLYNTRLKYRINALQAMMVTALIAAGAVMFGFPLS--YVYDHFLQMAVGAAFIALILSIFLYAKSLAAPQSALAPGGNSGNPLYDFFIGHELNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKDIELRGSPSLSMILVFG--FQALYVVDAMKHEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELSTYAAVGIILLNAVGYIIFRGSNSQKNAFRRNPADPKVVGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMALAWSLPCGLSNILPYFYVIYFTVLLVHREARDEHQCMKKYGVAWQEYCRRVPYRIFPYIY 425          
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Match: lbr (lamin B receptor [Source:NCBI gene;Acc:100145693])

HSP 1 Score: 221.09 bits (562), Expect = 5.191e-64
Identity = 140/446 (31.39%), Postives = 231/446 (51.79%), Query Frame = 3
Query:  318 ESKKPQ---LLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSL-IPAVF--LLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLT--EKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ES  P+   L D+G TE+  +   K     ++ F         C++F +  PA+   LL       A +    +  ++L    D +  G  + W++  A+LA +P+GK         G  +KYR NG+    +T  + A +MY   +    VY++Y     S+ L +++F   L ++SY    E++       +FIY F +GREIN R   LDLK F+ F+     W+++N +    ++E +     + S++     Q++Y LD        +  P +    FGF    G+  I+PF ++L    +  N   LP +   +I  +NL+G+IIYR +N QK++FRQNP    L HLKT+    G ++L+ GWWG +R PNY GDII+ ++W L  G N  V +FY I+ +L ++ R  +D+++C  ++G  W+ Y K V YRL+P+V+
Sbjct:  107 ESSIPKGIVLTDSGPTESLPETAEKNAENPKLAFGGTVG----CLLFMICFPALLYCLLVACGPQSASV----YPSLEL---LDAQVFGFFVLWILLQASLAILPLGKVVDGVQLGNGSRLKYRMNGIHVFFLTAATAAAMMYYYKINILYVYEHYLQFAASATLFSLLFSVYLYVRSYRVPNEELSWTANSGSFIYKFFMGREINPRIGNLDLKTFFMFQLALISWVLINAVMLFAEMEVQGRDEPSLSMILVNSLQLLYVLDGFWNLEYFLMSPDITRDGFGFLLAFGSAAILPFTYSLQAYYLVNNPVDLPWQAACAIVALNLLGFIIYRGANSQKSAFRQNPDDPRLSHLKTLPTSAGSKLLISGWWGFVRRPNYLGDIIMGVAWCLPCGFNNMVPYFYAIFLILILLDRVARDEQRCREKYGPDWDKYCKHVRYRLLPYVY 541          
BLAST of Lamin-B receptor vs. Ensembl Mouse
Match: Lbr (lamin B receptor [Source:MGI Symbol;Acc:MGI:2138281])

HSP 1 Score: 224.172 bits (570), Expect = 1.583e-64
Identity = 117/357 (32.77%), Postives = 200/357 (56.02%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W    A    +P+GK A  T    G  ++YR NG+ + I+T  +L   ++       + Y ++  L  ++   +V+    L ++S    + +++     N +Y+F +GRE+N R    DLKFF E RPG  GW+++N++  L +++ +E  + + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF ++L    +  +   L     + I  + L GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF   +I R  +D+ +C  ++G AW  Y + VPYR+ P+++
Sbjct:  271 GVYLLWFFVQALFHLLPVGKVAEGTPLVDGRRLQYRLNGLYAFILTSAALGAAVFWGVELCYL-YTHFLQLALAATGFSVLLSAYLYVRSLRAPREELSPASSGNAVYDFFIGRELNPRLGAFDLKFFCELRPGLIGWVVINLVMLLMEMKIQERAAPSLAMILVNSFQLLYVVDALWNEEALLTSMDIMHDGFGFMLAFGDLVWVPFTYSLQAFYLVSHPHDLSWPLASVIIALKLCGYVIFRCANSQKNAFRKNPTDPKLAHLKTIHTSTGKSLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHLLPYFYIIYFTALLIHREARDEHQCRRKYGLAWEKYCQRVPYRIFPYIY 626          
BLAST of Lamin-B receptor vs. Ensembl Mouse
Match: Tm7sf2 (transmembrane 7 superfamily member 2 [Source:MGI Symbol;Acc:MGI:1920416])

HSP 1 Score: 201.445 bits (511), Expect = 5.330e-58
Identity = 93/253 (36.76%), Postives = 155/253 (61.26%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N +Y+F +GRE+N R    D K+F E RPG  GW+ +N+   +++ E R   S+  ++      Q++Y  DA+ +E  +++   +++  FGF    G+   VPF ++L  + +  +   L +     I ++ +IGY I+R +N QKN+FR+NP    +  L+TI    G Q+LV GWWG++RHPNY GD+I+ L+WSL  GL+  + +FY +YF   ++ R  +D+++C  ++G AW +Y K VPYR+IP+V+
Sbjct:  168 NSMYDFFLGRELNPRLGSFDFKYFCELRPGLIGWVFINLALLMQEAELRGSPSL--AMWLVNGFQLLYVGDALWYEESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLLKVIGYYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGLSHLLPYFYVLYFTALLVHREARDEQQCLQKYGRAWQEYCKRVPYRIIPYVY 418          
BLAST of Lamin-B receptor vs. Ensembl Mouse
Match: Tm7sf2 (transmembrane 7 superfamily member 2 [Source:MGI Symbol;Acc:MGI:1920416])

HSP 1 Score: 160.229 bits (404), Expect = 3.427e-43
Identity = 82/256 (32.03%), Postives = 139/256 (54.30%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLK---TITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N +Y+F +GRE+N R    D K+F E RPG  GW+ +N+   +++ E R   S+  ++      Q++Y  DA+ +E  +++   +++  FGF    G+   VPF ++L  +                        +++Y    +        P ++ +C LK   TI    G Q+LV GWWG++RHPNY GD+I+ L+WSL  GL+  + +FY +YF   ++ R  +D+++C  ++G AW +Y K VPYR+IP+V+
Sbjct:  168 NSMYDFFLGRELNPRLGSFDFKYFCELRPGLIGWVFINLALLMQEAELRGSPSL--AMWLVNGFQLLYVGDALWYEESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQ------------------------FLLYHPQPLGL------PMALLICLLKGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGLSHLLPYFYVLYFTALLVHREARDEQQCLQKYGRAWQEYCKRVPYRIIPYVY 391          
BLAST of Lamin-B receptor vs. Ensembl Mouse
Match: Tm7sf2 (transmembrane 7 superfamily member 2 [Source:MGI Symbol;Acc:MGI:1920416])

HSP 1 Score: 158.688 bits (400), Expect = 1.573e-42
Identity = 77/207 (37.20%), Postives = 123/207 (59.42%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAI--QINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFG 1484
            N +Y+F +GRE+N R    D K+F E RPG  GW+ +N+   +++ E R   S+  ++      Q++Y  DA+ +E  +++   +++  FGF    G+   VPF ++L  + +        LP+  L  I ++ +IGY I+R +N QKN+FR+NP    +  L+TI    G Q+LV GWWG++RHPNY GD+I+ L+WSL  GL+ G
Sbjct:  168 NSMYDFFLGRELNPRLGSFDFKYFCELRPGLIGWVFINLALLMQEAELRGSPSL--AMWLVNGFQLLYVGDALWYEESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALL--ICLLKVIGYYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGLSHG 370          
BLAST of Lamin-B receptor vs. Ensembl Mouse
Match: Dhcr7 (7-dehydrocholesterol reductase [Source:MGI Symbol;Acc:MGI:1298378])

HSP 1 Score: 140.969 bits (354), Expect = 1.349e-35
Identity = 100/346 (28.90%), Postives = 170/346 (49.13%), Query Frame = 3
Query:  633 STTKKGIEVKYRFNGVISMIIT-ITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYL--TEKIKIAFRPINFIYNFIVGREINTRFF-GLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQN----------PYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            + T  G+  KY  NG+ + +IT I            +  +++DN+  L+  + ++        ++K YL  T      F   NF YN+++G E N R     D K F+  RPG   W ++N+ F  K  E   +  +  S++   + Q IY LD    E   +    + +  FG++   G+ V +P+L+TL    +  +  QL       I ++ L+GY I+R +N QK+ FR+           P ++   +      +H  ++LV G+WG+ RH NY GD++  L++ L  G    + +FY IY  + +  RC++D+ +CA ++G  W  Y  AVPYRL+P +F
Sbjct:  132 AITPAGVVNKYEVNGLQAWLITHILWFVNAYLLSWFSPTIIFDNWIPLLWCANILGYAVSTFAMIKGYLFPTSAEDCKFTG-NFFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSFAAKQQE--LYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPNALGILLLGLVGYYIFRMTNHQKDLFRRTDGRCLIWGKKPKAIECSYTSADGLKHHSKLLVSGFWGVARHFNYTGDLMGSLAYCLACGGGHLLPYFYIIYMTILLTHRCLRDEHRCANKYGRDWERYTAAVPYRLLPGIF 474          
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Match: sp|Q3U9G9|LBR_MOUSE (Delta(14)-sterol reductase LBR OS=Mus musculus OX=10090 GN=Lbr PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 1.108e-63
Identity = 117/357 (32.77%), Postives = 200/357 (56.02%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W    A    +P+GK A  T    G  ++YR NG+ + I+T  +L   ++       + Y ++  L  ++   +V+    L ++S    + +++     N +Y+F +GRE+N R    DLKFF E RPG  GW+++N++  L +++ +E  + + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF ++L    +  +   L     + I  + L GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF   +I R  +D+ +C  ++G AW  Y + VPYR+ P+++
Sbjct:  271 GVYLLWFFVQALFHLLPVGKVAEGTPLVDGRRLQYRLNGLYAFILTSAALGAAVFWGVELCYL-YTHFLQLALAATGFSVLLSAYLYVRSLRAPREELSPASSGNAVYDFFIGRELNPRLGAFDLKFFCELRPGLIGWVVINLVMLLMEMKIQERAAPSLAMILVNSFQLLYVVDALWNEEALLTSMDIMHDGFGFMLAFGDLVWVPFTYSLQAFYLVSHPHDLSWPLASVIIALKLCGYVIFRCANSQKNAFRKNPTDPKLAHLKTIHTSTGKSLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHLLPYFYIIYFTALLIHREARDEHQCRRKYGLAWEKYCQRVPYRIFPYIY 626          
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Match: sp|O08984|LBR_RAT (Delta(14)-sterol reductase LBR OS=Rattus norvegicus OX=10116 GN=Lbr PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.135e-62
Identity = 118/367 (32.15%), Postives = 204/367 (55.59%), Query Frame = 3
Query:  534 LQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            L+   + +  G+ + W    A  + +P+GK    T    G  +KYR NG+ + I+T  ++   ++   +    +Y ++     ++I+ +VV    L  +S    + +++     N +Y+F +GRE+N R    DLKFF E RPG  GW+++N++  L +++ +E  + + ++      Q++Y +DA+ FE  +++   +++  FGF    G+ V VPF ++L    +  +   L     + I  + L GY+I+R +N QKN+FR+NP    L HLKTI       +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF   +I R  +D+ +C  ++G AW  Y + VPYR+ P+++
Sbjct:  255 LRELWEARVCGVYLLWFFLQALFSLLPVGKVVEGTPLVDGRRLKYRLNGLYAFILTSAAVGTAVFWD-IELYYLYTHFLQFALAAIVFSVVLSVYLYARSLKVPRDELSPASSGNAVYDFFIGRELNPRIGAFDLKFFCELRPGLIGWVVINLVMLLAEMKVQERSAPSLAMTLVNSFQLLYVVDALWFEEALLTTMDIIHDGFGFMLAFGDLVWVPFTYSLQAFYLVNHPQDLSWPLTSVIIALKLCGYVIFRCANSQKNAFRKNPTDPKLAHLKTIPTSTWKSLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHILPYFYVIYFTALLIHREARDEHQCRRKYGLAWEKYCQRVPYRIFPYIY 620          
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Match: sp|Q14739|LBR_HUMAN (Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 4.261e-61
Identity = 117/359 (32.59%), Postives = 199/359 (55.43%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTTK-KGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAI--QINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W +       +PIGK    T    G  +KYR NG  + I+T +++ G    + +    VY ++     ++ +  VV    L ++S    +  ++     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N++  L +++ ++    + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF+++     +    N    P+  L  I V+ L GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG +RHPNY GD+I+ L+WSL  G N  + +FY IYF + ++ R  +D+  C  ++G AW  Y + VPYR+ P+++
Sbjct:  260 GVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFYAFILT-SAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAMILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASL--IIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY 615          
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Match: sp|Q5R7H4|LBR_PONAB (Delta(14)-sterol reductase LBR OS=Pongo abelii OX=9601 GN=LBR PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.310e-60
Identity = 116/359 (32.31%), Postives = 197/359 (54.87%), Query Frame = 3
Query:  564 GIVICWLMYLAALAHIPIGKTAYSTTK-KGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA-FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAI--QINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            G+ + W +       +PIGK    T    G  +KYR NG  + I+T +++ G    + +    VY ++     ++ +  VV    L ++S    +  ++     N +Y+F +GRE+N R    DLK+F E RPG  GW+++N++  L +++ ++    + +++     Q++Y +DA+  E  +++   +++  FGF    G+ V VPF+++     +    N    P+  L  I V+   GY+I+R +N QKN+FR+NP    L HLKTI    G  +LV GWWG  RHPNY GD+I+ L+WSL  G N  + +FY IYF + ++ R  +D+  C  ++G AW  Y + VPYR+ P+++
Sbjct:  260 GVYLLWFLIQVVFYLLPIGKVVEGTPLIDGRRLKYRLNGFYAFILT-SAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAMILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASL--IIVLKFCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFARHPNYLGDLIMALAWSLACGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY 615          
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Match: sp|P23913|LBR_CHICK (Delta(14)-sterol reductase LBR OS=Gallus gallus OX=9031 GN=LBR PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.150e-57
Identity = 114/364 (31.32%), Postives = 191/364 (52.47%), Query Frame = 3
Query:  534 LQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLT--EKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLI 1616
            L+   + K  G+ + W  + A    +PIGK           +++YR NG  + ++T  ++  L+Y +      +YD++     S+   ++     L ++S     E +         +Y+F  G E+N R    DLK+F E RPG  GW+++N+   L +++       + S++     Q++Y +DA+  E  +++   + +  FGF    G+ V VPF+++L    +  +   +     A+I ++N IGY I+RS+N QKN+FR+NP    L +LK I    G  +LV GWWG +RHPNY GDII+ L+WSL  G N  + +FY IYF+  ++ R  +D+  C  ++G AW  Y + VPY  I
Sbjct:  242 LESLWETKVFGVFLLWFFFQALFYLLPIGKVVEGLPLSNPRKLQYRINGFYAFLLTAAAIGTLLYFQ-FELHYLYDHFVQFAVSAAAFSMALSIYLYIRSLKAPEEDLAPGGNSGYLVYDFFTGHELNPRIGSFDLKYFCELRPGLIGWVVINLAMLLAEMKIHNQSMPSLSMILVNSFQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLVGHPIAISWPVAAAITILNCIGYYIFRSANSQKNNFRRNPADPKLSYLKVIPTATGKGLLVTGWWGFVRHPNYLGDIIMALAWSLPCGFNHILPYFYVIYFICLLVHREARDEHHCKKKYGLAWERYCQRVPYTHI 604          
BLAST of Lamin-B receptor vs. TrEMBL
Match: V3ZS14 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_118629 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.928e-74
Identity = 148/401 (36.91%), Postives = 231/401 (57.61%), Query Frame = 3
Query:  441 MVFSLIPAVFLLN-KMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIA--FRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQIN-NFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++F L   V+LLN   ++    I  I     +L +F D +   I + W  + A LA IP GK A     + G ++KYR NG IS+II++ +    +Y K L   +++  ++ ++ ++ + +V     L +KS L  + K+A      N +Y+F +G E+N R    DLKFF E RPG  GW+ILN+ F  K   D        +L  CA  QI Y  DA+  E  I++   +++  FGF    G+ V VPF++ L TR +  N    +   CLA IAVINL+GY I+R +N QK+++R+NP++  L HL+T+    G ++LV GWWG+ R PNY GD+++  +WSL  GL+  + +FYPIYFL+ ++ RC +DD  C  ++G  W  Y + VPY++IP+++
Sbjct:   26 LIFLLPATVYLLNFACNKKRCTIMEIPKLPSRLSFFIDLQATYIFLGWFFFQAILAIIPFGKLAEGQPLRSGQKLKYRCNGFISLIISMVAFGIAVYYK-LPVTIIHTKFFQIMTAATIFSVSLSLFLYIKSLLIPQDKLAPGGNTGNHVYDFFMGHELNPRIGMFDLKFFCELRPGLIGWVILNMAFVYKAYLDNN-NVFPPALTMCAAFQIFYVADALFAEEAILTTMDIVHDGFGFMLIFGDLVWVPFIYCLQTRFLLENPQNDMYWYCLAFIAVINLVGYYIFRGANSQKDAYRRNPHNPALAHLETLPTSTGRKLLVSGWWGICRKPNYLGDLLMATAWSLCCGLHHVLPYFYPIYFLILLVHRCQRDDVICRKKYGAVWTRYCQRVPYKIIPYIY 424          
BLAST of Lamin-B receptor vs. TrEMBL
Match: A0A1S3HT82 (delta(14)-sterol reductase isoform X3 OS=Lingula unguis OX=7574 GN=LOC106157959 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 8.438e-74
Identity = 159/467 (34.05%), Postives = 260/467 (55.67%), Query Frame = 3
Query:  246 TRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKV-KVLSKFQIYFKSMKSIMFCCMVFSLIPA-VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIE-VKYRFNGVISMIITITSLA-GLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPI-NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTI-TNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            TR+S ++  K     + +E +   E K         T   DKP   K ++  +  F       FC +   L+PA V+++N M  + +    I     KL  + D K + I + W ++   LA +P+GK       KG++ ++YR NG I++++++ +L  G  Y K +    V+  +  LI ++I+ +VV   +L +++   +   +AF    N IY+F +GRE+N R    D KFF E RPG  GW+ +N+ F L +    +    NY L+     Q++Y  DA+  E  I++   +++  FGF  C G+   VPFL++L  R +  +   LP   L+++A++N+IG++I+R SN QKN FR+NPY   L HL+++ TN  G ++LV GWWGL RHPNY GD+II L+WSL  G +  + +FYPIYF + ++ R ++DD  C  ++G  W+ Y + V Y +IP+V+
Sbjct:   65 TRQSARLAEKQTNGPEEVEKKPEMERKPSPARPAVATPVADKPVADKPVADSE--FGGPVGAFFCIV---LLPATVYVINIMCTEKSCTLAIPSIPKKLSNYFDSKAVMIGLGWFVFQVVLAVLPVGKVVSGQPVKGLQRLQYRCNGFIALMVSLVALGVGQAYFK-VDLSTVHTLWLQLITTAIVFSVVLSLVLYIRARSAKPNALAFAASGNAIYDFWMGRELNPRIGSFDWKFFCELRPGLIGWVAINMCF-LAEAYGSKSGWPNYPLIMVCGFQLLYVADALWSEEAILTTMDIIHEGFGFMLCFGDLAWVPFLYSLQPRFLLEHPQSLPWWALSAVALLNMIGFLIFRGSNSQKNMFRKNPYDPALAHLESMPTNVPGKRLLVSGWWGLCRHPNYLGDLIIGLAWSLPCGFSSLLPYFYPIYFFILLVHRAMRDDAMCRKKYGAHWDHYCERVKYVIIPYVY 524          
BLAST of Lamin-B receptor vs. TrEMBL
Match: A0A1S3HT59 (delta(14)-sterol reductase isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157959 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 1.186e-73
Identity = 159/467 (34.05%), Postives = 260/467 (55.67%), Query Frame = 3
Query:  246 TRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKV-KVLSKFQIYFKSMKSIMFCCMVFSLIPA-VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIE-VKYRFNGVISMIITITSLA-GLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPI-NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTI-TNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            TR+S ++  K     + +E +   E K         T   DKP   K ++  +  F       FC +   L+PA V+++N M  + +    I     KL  + D K + I + W ++   LA +P+GK       KG++ ++YR NG I++++++ +L  G  Y K +    V+  +  LI ++I+ +VV   +L +++   +   +AF    N IY+F +GRE+N R    D KFF E RPG  GW+ +N+ F L +    +    NY L+     Q++Y  DA+  E  I++   +++  FGF  C G+   VPFL++L  R +  +   LP   L+++A++N+IG++I+R SN QKN FR+NPY   L HL+++ TN  G ++LV GWWGL RHPNY GD+II L+WSL  G +  + +FYPIYF + ++ R ++DD  C  ++G  W+ Y + V Y +IP+V+
Sbjct:   77 TRQSARLAEKQTNGPEEVEKKPEMERKPSPARPAVATPVADKPVADKPVADSE--FGGPVGAFFCIV---LLPATVYVINIMCTEKSCTLAIPSIPKKLSNYFDSKAVMIGLGWFVFQVVLAVLPVGKVVSGQPVKGLQRLQYRCNGFIALMVSLVALGVGQAYFK-VDLSTVHTLWLQLITTAIVFSVVLSLVLYIRARSAKPNALAFAASGNAIYDFWMGRELNPRIGSFDWKFFCELRPGLIGWVAINMCF-LAEAYGSKSGWPNYPLIMVCGFQLLYVADALWSEEAILTTMDIIHEGFGFMLCFGDLAWVPFLYSLQPRFLLEHPQSLPWWALSAVALLNMIGFLIFRGSNSQKNMFRKNPYDPALAHLESMPTNVPGKRLLVSGWWGLCRHPNYLGDLIIGLAWSLPCGFSSLLPYFYPIYFFILLVHRAMRDDAMCRKKYGAHWDHYCERVKYVIIPYVY 536          
BLAST of Lamin-B receptor vs. TrEMBL
Match: A0A3S0ZQQ3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011701 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.198e-73
Identity = 155/472 (32.84%), Postives = 251/472 (53.18%), Query Frame = 3
Query:  231 VARRVTRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQY---FTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAF--RPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
             A    R S +I S  L   +      + E  K +++ N  T     PK K       +++ M  I    ++F L+PA      M+    K   +    +   +   F D +   I   W+ + A LA +P+G+       K G ++KYR NG +++++++  L   +Y K    K+V D ++ L+  + + +  F   L + S+     K+A      NFIY+F +GRE+N R   LDLKFF E RPG  GW++++ I  LK  +  E  +   +L+   + Q +Y  DA+ FE  I++   +++  FGF  C G+ V VPFL++L  R +  + F LP  CLA I VINLIGY+I+R SN QKN FR++P       ++T+  + G ++L  GWWG+   PNY GD+I+ L+WSL +G      +FYP+YFL+ +I R  +D+ +CA ++G +W  Y + V YR+ P+++
Sbjct:  110 AAHTPVRSSSRIAS--LIEKEKEASYLIKEQMKSEMITNMKTPPPSAPKKKEKGP---HYEFMGPIGAFLLIF-LLPATVYYVNMACRKTKCSILIVPSLPRNFVAAFFDTEACLIFFGWMAFQALLAVLPVGRLVDGQPLKSGGKLKYRCNGFLALVVSLAGLGVAVYLKLPVTKVV-DKFFKLMTVATIFSFAFSICLYVSSHFVSSKKLAPGGNSGNFIYDFFIGRELNPRVGPLDLKFFCELRPGLIGWVMMDWIMVLKAYQ--ETGTFPPNLVLVTVFQTLYVADALWFEDAILTTMDIIHDGFGFMLCFGDLVWVPFLYSLQPRFLLESGFTLPWYCLAPIVVINLIGYMIFRLSNSQKNLFRKDPKHPVFSGMETVPTQTGRKLLASGWWGICHKPNYLGDLIMALAWSLTTGFGHIFTYFYPLYFLVLLIHRERRDNEQCAAKYGASWERYCQRVKYRIFPYIY 572          
BLAST of Lamin-B receptor vs. TrEMBL
Match: A0A1S3HT56 (delta(14)-sterol reductase isoform X1 OS=Lingula unguis OX=7574 GN=LOC106157959 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 5.190e-73
Identity = 159/467 (34.05%), Postives = 260/467 (55.67%), Query Frame = 3
Query:  246 TRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKV-KVLSKFQIYFKSMKSIMFCCMVFSLIPA-VFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIE-VKYRFNGVISMIITITSLA-GLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPI-NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTI-TNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            TR+S ++  K     + +E +   E K         T   DKP   K ++  +  F       FC +   L+PA V+++N M  + +    I     KL  + D K + I + W ++   LA +P+GK       KG++ ++YR NG I++++++ +L  G  Y K +    V+  +  LI ++I+ +VV   +L +++   +   +AF    N IY+F +GRE+N R    D KFF E RPG  GW+ +N+ F L +    +    NY L+     Q++Y  DA+  E  I++   +++  FGF  C G+   VPFL++L  R +  +   LP   L+++A++N+IG++I+R SN QKN FR+NPY   L HL+++ TN  G ++LV GWWGL RHPNY GD+II L+WSL  G +  + +FYPIYF + ++ R ++DD  C  ++G  W+ Y + V Y +IP+V+
Sbjct:  123 TRQSARLAEKQTNGPEEVEKKPEMERKPSPARPAVATPVADKPVADKPVADSE--FGGPVGAFFCIV---LLPATVYVINIMCTEKSCTLAIPSIPKKLSNYFDSKAVMIGLGWFVFQVVLAVLPVGKVVSGQPVKGLQRLQYRCNGFIALMVSLVALGVGQAYFK-VDLSTVHTLWLQLITTAIVFSVVLSLVLYIRARSAKPNALAFAASGNAIYDFWMGRELNPRIGSFDWKFFCELRPGLIGWVAINMCF-LAEAYGSKSGWPNYPLIMVCGFQLLYVADALWSEEAILTTMDIIHEGFGFMLCFGDLAWVPFLYSLQPRFLLEHPQSLPWWALSAVALLNMIGFLIFRGSNSQKNMFRKNPYDPALAHLESMPTNVPGKRLLVSGWWGLCRHPNYLGDLIIGLAWSLPCGFSSLLPYFYPIYFFILLVHRAMRDDAMCRKKYGAHWDHYCERVKYVIIPYVY 582          
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Match: lbr (lamin-B receptor [Source:NCBI gene;Acc:103032852])

HSP 1 Score: 219.55 bits (558), Expect = 3.735e-63
Identity = 117/384 (30.47%), Postives = 216/384 (56.25%), Query Frame = 3
Query:  486 SEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLT--EKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            ++  A + + S     L+   D +  GIV+ WL++ A L+ +PIGK       K G  +KYR NG  ++II+  ++ G +Y + +    V+ ++     S++L++++    L ++S     ++   A    + +Y+F +GRE+N R    D+KFF E RPG  GW+++N    L +++ +   + + ++L     Q+++  D +  E  +++   +++  FGF    G+   VPF FT     +  +   L +  + +I ++N++GY I+R +N QK +FR+NP    L +LKTI    G  ++V G WG +RHPNY GD+I+ L+WSL  G +  + +FY IY ++ ++ R  +D+ +C  ++G+AW +Y K V YR++P ++
Sbjct:  222 AQTDASLLNFSLSPPLLEPLWDWQVFGIVVLWLLFQAVLSLLPIGKVVEGMPLKNGKTLKYRINGFSALIISALAVGGAVYYE-VDLSYVHAHFLQFYTSALLLSILLSIYLFIRSRCASEDERAPAGNTGHVVYDFFMGRELNPRIKSFDIKFFCEMRPGLIGWLVINFAMLLAEMKHKNLDTPSPAMLLVNGFQLLWVADGLWHEEKLLTMMDIVHDGFGFMLAFGDLAWVPFTFTCQAYYLVSHTSDLSVFWIVAIIIMNVVGYYIFRQANSQKFAFRRNPSDPALSYLKTIPTATGKNLIVSGLWGFVRHPNYLGDLIMALAWSLSCGFSHVIPYFYLIYLVVLLVHRDARDEHQCRKKYGSAWEEYCKVVRYRILPGIY 604          
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-041212-19])

HSP 1 Score: 209.92 bits (533), Expect = 3.028e-62
Identity = 113/331 (34.14%), Postives = 191/331 (57.70%), Query Frame = 3
Query:  642 KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAF--RPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            + G  +KY+ NG  ++ +T   L GL  +  +    ++D    L   +I V+ +    L + S+      +A      N +Y+F +GRE+N R    DLKFF E RPG  GW++LN+   +K++E R+  S+  ++L     Q++Y +DA+  E  +++   +++  FGF    G+   VPF + L    + ++   L    +  I ++N +GY I+R SN QKN FR++P    + HL+TI    G ++LV GWWG +RHPNY GDI++ L+WSL  G +  + +FY IYF + ++ R  +D+R+C  ++G AW++Y + VPYR+IP+++
Sbjct:    6 RDGTRLKYQINGFHALCMT-AMLLGLCVSLGMPLGYLFDLILPLAVCAICVSYLLALYLYIGSFWAPAHALALGGNTGNPLYDFFIGRELNPRIGSFDLKFFCELRPGLIGWVVLNMAMMMKEVELRDSPSL--AMLLVNGFQLLYVMDALWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYGLQAMFLVVHPRSLSPPTVIGIILLNGLGYYIFRKSNSQKNQFRRDPNHRSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDILMALAWSLPCGFSHILPYFYVIYFSILLVHREARDERQCRAKYGIAWDNYCRRVPYRIIPYIY 333          
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Match: si:ch1073-429i10.1 (delta(14)-sterol reductase-like [Source:NCBI gene;Acc:103022427])

HSP 1 Score: 155.606 bits (392), Expect = 2.774e-41
Identity = 100/361 (27.70%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  567 IVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLI--GSSXXXXXXXXXXXXXKSYLTEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLP--IKCLASIAVINLIGY--IIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            IV+ + +   AL ++P+G+        +   +KY  NG+ +  + +  L G      L A  V      L+  G ++ + +     L   S  + +         F+ +F++GRE + R   +D+K F   R GF GW ++++ + L+ +E     S++ +LL     Q++Y LD ++ E  ++     +    GF   LG  + +PF  +L    +     Q P  I  L+++ VI L G+  ++Y  SN QK+ FR+NP++     L+TI +  G  +LV GW+G +RHPNY GD+++ L+W L  G    + +   +     +  R  + +  C  +HG+AW +Y + VPY+LIP+++
Sbjct:   82 IVVIFTVLQGALYYLPVGQVVEGKMGNQEKRLKYSLNGLHAFGVCVVLLVGAWQGGWLVAGSVTGRVLPLVSAGCAVALLISVCLYLRPDSAHSHENTTG----GFLQDFLLGREADPRLGKIDVKQFAMVRIGFIGWGLMDVCYVLRGVES---DSVSSALLLTTTFQLVYILDFLIDEDTVLDTKEFMEDSIGFLMVLGEYIWIPFFSSLPVYFL----LQRPNHIHFLSAVPVILLFGFGFLVYYLSNEQKSGFRRNPHNPAYSRLETIRSPSGRNLLVSGWFGWVRHPNYLGDVVMMLAWCLPCGFCSVLPYLPALQCFNLLRKRSTEVEESCREKHGSAWAEYCRRVPYKLIPYIY 431          
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Match: si:ch1073-429i10.1 (delta(14)-sterol reductase-like [Source:NCBI gene;Acc:103022427])

HSP 1 Score: 155.606 bits (392), Expect = 4.388e-41
Identity = 100/361 (27.70%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  567 IVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLI--GSSXXXXXXXXXXXXXKSYLTEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLP--IKCLASIAVINLIGY--IIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            IV+ + +   AL ++P+G+        +   +KY  NG+ +  + +  L G      L A  V      L+  G ++ + +     L   S  + +         F+ +F++GRE + R   +D+K F   R GF GW ++++ + L+ +E     S++ +LL     Q++Y LD ++ E  ++     +    GF   LG  + +PF  +L    +     Q P  I  L+++ VI L G+  ++Y  SN QK+ FR+NP++     L+TI +  G  +LV GW+G +RHPNY GD+++ L+W L  G    + +   +     +  R  + +  C  +HG+AW +Y + VPY+LIP+++
Sbjct:   96 IVVIFTVLQGALYYLPVGQVVEGKMGNQEKRLKYSLNGLHAFGVCVVLLVGAWQGGWLVAGSVTGRVLPLVSAGCAVALLISVCLYLRPDSAHSHENTTG----GFLQDFLLGREADPRLGKIDVKQFAMVRIGFIGWGLMDVCYVLRGVES---DSVSSALLLTTTFQLVYILDFLIDEDTVLDTKEFMEDSIGFLMVLGEYIWIPFFSSLPVYFL----LQRPNHIHFLSAVPVILLFGFGFLVYYLSNEQKSGFRRNPHNPAYSRLETIRSPSGRNLLVSGWFGWVRHPNYLGDVVMMLAWCLPCGFCSVLPYLPALQCFNLLRKRSTEVEESCREKHGSAWAEYCRRVPYKLIPYIY 445          
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Match: dhcr7 (7-dehydrocholesterol reductase [Source:NCBI gene;Acc:103033332])

HSP 1 Score: 150.599 bits (379), Expect = 4.101e-39
Identity = 98/348 (28.16%), Postives = 171/348 (49.14%), Query Frame = 3
Query:  633 STTKKGIEVKYRFNGVISMIIT-ITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYL----TEKIKIAFRPINFIYNFIVGREINTRFF-GLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQN----------PYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            + T  G+  KY  NG+   IIT    +A   Y    +  +++DN+  L+  + ++         +K+YL     E  K      N  YN+++G E N R     D K F+  RPG   W ++N+ +  K  E   +  +  S++   + Q IY +D    E   +    + +  FG++   G+ V +PFL+TL    +  N  QL    +A + ++ L+GY I+RS+N QK+ FR+           P  +   +       H  +++  G+WG+ RH NY GD++  L++ L  G    + +FY IY  + ++ RC++D+ +C+ ++G  W  Y +AVP RL+P +F
Sbjct:  136 ARTPAGLINKYEINGLQCWIITHALWVANAYYFHWFSPTIIFDNWIPLLWCTNILGYAVSTFAFIKAYLFPTNPEDCKYTG---NIFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSYAAKQQE--LYGYVTNSMILVNVLQAIYVVDFFWNEAWYLKTIDICHDHFGWYLGWGDCVWLPFLYTLQGLYLVYNPVQLSTPNVAGVLILGLLGYYIFRSANHQKDLFRRTEGKCTIWGRKPAYIECSYRSADGGTHKSKLMTSGFWGVTRHMNYTGDLMGSLAYCLACGGGHLLPYFYIIYMTILLVHRCIRDEHRCSNKYGKDWKRYTEAVPQRLLPGIF 478          
BLAST of Lamin-B receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002700.1 (pep scaffold:Pmarinus_7.0:GL480753:6556:12779:-1 gene:ENSPMAG00000002452.1 transcript:ENSPMAT00000002700.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 3.025e-37
Identity = 74/253 (29.25%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N  Y+F++GRE+N R   L++K F E R G  GW++L  +  L   + R+  +   +L   A  QI+Y   A+  EG +++         GF     +    P + +L    +     QLP+   AS+A++  +G  IY  ++ ++ +F+  P   H    ++I    G ++LV GWWG+LRHP+  G +++ ++W+L  G+   + W   +Y    ++ R V  ++ C   +G AW +Y   VPYRL+P ++
Sbjct:  179 NMAYDFVLGRELNPRMGALNVKHFCELRLGLLGWVVL--VLGLVAAQTRDAGTPCSALALVATFQIVYVAAALWNEGKLVAALDTSPLGAGFLLLFIDLAWTPLVCSLPAAYLVQQPLQLPLYHSASLALLYGLGLYIYCRASAERRAFQHKPSLAHSSRKESIPTATGKRLLVSGWWGVLRHPDTLGQLLMTMAWTLPCGVQAALPWVQAVYVCGALLVRGVHTEQACVRRYGAAWAEYCHRVPYRLLPGLY 429          
BLAST of Lamin-B receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000142.1 (pep scaffold:Pmarinus_7.0:GL476617:408941:423101:1 gene:ENSPMAG00000000122.1 transcript:ENSPMAT00000000142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 2.013e-33
Identity = 97/327 (29.66%), Postives = 169/327 (51.68%), Query Frame = 3
Query:  567 IVIC--WLMYLAALAHIPIG-KTAYSTTKKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAF--RPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITR 1532
            +V+C  W ++ A L H+P+G  T          +KYR NG+ +++++I++ +   Y +   A  V+D +  L  S++L+A +    L +++     I +A   RP N  Y+F  GRE+N R   +DLK F+E RPGF GW I++++  L+DL+  E  + + +LL     Q IY  D +  E   +S   + +  FGF     N   +PF  +L    +  ++ +L     A+I ++ L+GY+I R ++ QKN+   +         K   +R      V G WG LRHP   G++++ L+WSL  G +  + +   +Y L+ ++ R
Sbjct:  281 LVLCLGWCLFQALLCHLPLGYVTERVPPNTEQRLKYRLNGIHALVLSISAFSLAKYKEAYVA-YVHDKFLQLAVSAVLLAYLLSAYLFVRARCASHIAVATTRRPGNIFYDFFFGRELNPRIGNMDLKSFFELRPGFIGWAIISLVMVLEDLQKNE--AFSPALLLYVALQFIYVADVLWNEERSLSTGDIPHKYFGFLLAFTNLAWIPFASSLPAYYLVHHHQELTAYWAAAICLLYLVGYVISRRAHTQKNAQSDSAGD----RGKPADSRSSP---VLGSWGRLRHPELLGELLMLLAWSLPCGFSHPLPYIPVVYSLVMLLHR 597          
BLAST of Lamin-B receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000385.1 (pep scaffold:Pmarinus_7.0:GL488468:1897:4392:1 gene:ENSPMAG00000000348.1 transcript:ENSPMAT00000000385.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.182e-23
Identity = 55/146 (37.67%), Postives = 81/146 (55.48%), Query Frame = 3
Query: 1038 SLLFCAISQIIYCLDAVMFEG-DIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSG 1472
             L+   I  + Y  D V+ E  D+ ++  +  G  G+    G    VPF++ +    +  +   L     A+IA +  IG+ IYRSSN +KN FR+NP      HL+ I+ +HG  +LV GWWG LRHPNY GDII+ ++W+L  G
Sbjct:   19 PLILITIFHVTYTADLVLEEDFDLTTRESISTG-LGYAVVCGELTWVPFVYIIQAYFLLRHPQPLSWPGAAAIAALFFIGFWIYRSSNAEKNGFRKNPNHPDYAHLQKISTKHGKSLLVSGWWGWLRHPNYLGDIIMAVAWALPCG 163          
BLAST of Lamin-B receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000387.1 (pep scaffold:Pmarinus_7.0:GL488468:1954:4347:1 gene:ENSPMAG00000000348.1 transcript:ENSPMAT00000000387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 3.657e-22
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 1041 LLFCAISQIIYCLDAVMFEG-DIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSG 1472
            L+   I  + Y  D V+ E  D+ ++  +  G  G+    G    VPF++ +    +  +   L     A+IA +  IG+ IYRSSN +KN FR+NP   H  + + I+ +HG  +LV GWWG LRHPNY GDII+ ++W+L  G
Sbjct:    1 LILITIFHVTYTADLVLEEDFDLTTRESISTG-LGYAVVCGELTWVPFVYIIQAYFLLRHPQPLSWPGAAAIAALFFIGFWIYRSSNAEKNGFRKNPN--HPDYARKISTKHGKSLLVSGWWGWLRHPNYLGDIIMAVAWALPCG 142          
BLAST of Lamin-B receptor vs. Ensembl Yeast
Match: ERG24 (C-14 sterol reductase; acts in ergosterol biosynthesis; mutants accumulate the abnormal sterol ignosterol (ergosta-8,14 dienol), and are viable under anaerobic growth conditions but inviable on rich medium under aerobic conditions [Source:SGD;Acc:S000005224])

HSP 1 Score: 165.622 bits (418), Expect = 1.096e-45
Identity = 114/383 (29.77%), Postives = 193/383 (50.39%), Query Frame = 3
Query:  534 LQYFTDGKNIGIVIC-WLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKT----LTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLT-----------EKI-KIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            L+Y+   + +  V C W   LA L  I  G+       + G ++ Y+ NG I+M  T+  +  + +  T       + +Y+N+  L   SIL +        + S++            EKI  +     N IY++ +GRE+N R   LD+K F E RPG   W+++N+  CL     +  K IN +L+     Q  Y  D V+ E  +++   +    FGF    G+  +VPF ++L  R + ++  +L    +  I  I  +G+ I+ S+N QK+ FRQ      L +LK+I  + G ++L  GWW   +H NYFGD +I LSW L +     + ++Y +YF   ++ R  +D+ KC +++G  W +Y + VPY++IP+V+
Sbjct:   63 LRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKING-IAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLS-CLHHHYLKTGK-INDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQG----KLENLKSIQTKRGTKLLCDGWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGENWEEYERKVPYKIIPYVY 438          
BLAST of Lamin-B receptor vs. Ensembl Yeast
Match: ERG4 (C-24(28) sterol reductase; catalyzes the final step in ergosterol biosynthesis; mutants are viable, but lack ergosterol [Source:SGD;Acc:S000002980])

HSP 1 Score: 95.5153 bits (236), Expect = 2.187e-21
Identity = 81/271 (29.89%), Postives = 127/271 (46.86%), Query Frame = 3
Query:  870 NFIYNFIVGREINTRFFGLDLKFFYEFR-PGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLF---TLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQN--------------PYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            N +Y+F +G  +N R+  LDLK F+E R P FT + I  +  CLK  E   +  +   L    ++  +Y       E  I+    M   +FGF     N   VP+ +   TL       + +        S+ V+ L  Y  + ++N QKN+FR+               PY + L + K +   +G  +L+ GW+ L R  +Y  D    L W+L  G N    WF+P++FL+ +I R  +D  KC  ++G  W++Y K  PY  IP+VF
Sbjct:  207 NHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFI-TLGACLKQWET--YGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQI-LKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF 473          
BLAST of Lamin-B receptor vs. Ensembl Nematostella
Match: EDO31599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI1])

HSP 1 Score: 222.246 bits (565), Expect = 2.658e-66
Identity = 122/356 (34.27%), Postives = 196/356 (55.06%), Query Frame = 3
Query:  567 IVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLT-EKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            +   W++Y   L  +P G          G ++ YR N + +++ TI     LM  K +    VYDN+  LI ++IL +VV    L +K+      +       N IY+F +G ++N R    D KFF E RPG  GWM++N  FCL   E  ++ S++ ++L     Q IY  D ++FE  I+S   M++  FG+    G+   VPF+++L  R +  +   L    + SI  + ++GY+I+R SN+QK+ FRQ+P        +TI    G +++V GWWGL+RHPNY GDI++ ++WSL  G +  + WFYP+Y  + +I R  +D+   + ++G  W++Y + VPYR+ P VF
Sbjct:   73 VYAAWMLYQVLLYMLPFGNVIKGPQLADGSQLDYRINSLFALLGTIALFFALMANK-IPVTFVYDNFLSLITATILWSVVISVFLFVKAKRQGSGLSSGGNTGNAIYDFFMGHQLNPRIGNFDFKFFCEMRPGLLGWMMIN--FCLAVKESNDYGSLSPAMLLVCAFQFIYVADCLLFEASILSTIDMVHEGFGYMLAFGDLAFVPFMYSLQGRFLVDHRTHLHWAAIVSIVALKVVGYVIFRGSNLQKDYFRQHPEDPEFKDRETILTPSGKRLMVFGWWGLVRHPNYLGDILMAIAWSLPCGFSHAIPWFYPLYLTVLLIHREFRDEALNSHKYGKLWDEYCRRVPYRIFPKVF 425          
BLAST of Lamin-B receptor vs. Ensembl Nematostella
Match: EDO38405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ5])

HSP 1 Score: 144.436 bits (363), Expect = 6.614e-38
Identity = 106/383 (27.68%), Postives = 186/383 (48.56%), Query Frame = 3
Query:  555 KNIGIVICWL-----MYLAALAHIPIGKTAYSTTKKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYL--TEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINY---SLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINL--IGYIIYRSSNIQKNSFRQNPYSVHLCHL-----KTITNRHGHQ--------ILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
              +G+ + WL     +YLA    I  G    + T  G  + Y+ NG+ + I T      L Y   +   ++Y+ +  L+  + ++ ++    + +K++   T K    F   +F Y+F +G E N R   LD K F+  RPG   W ++N+      +  R+++ + Y   S+L   I Q +Y +D    E   +    + +  FGF+   G+ V +PF++TL  +A+ +    + +  +AS  ++ L   GY+I+R  N QK+ FR        C +     K +T  +           +L  GWWGL RH NY GD++ CL++    G    + +FY IY  + ++ R  +DD +C  ++G  W +Y K VPYR++P++F
Sbjct:   28 SGVGLFLTWLTLQLVLYLALPGRIATG----NPTPAGNILSYKCNGLNAWIFTHALFIALAYFDLMKMTVIYNYWGSLLVLANILGILLTAFVYVKAHYFPTHKEDRCFSG-SFFYDFYMGIEANPRIGNLDFKLFFNGRPGIVAWTLINL-----SMAARQYEQLGYVTNSMLLVNILQGMYVVDFFAHEAWYLRTIDIAHDHFGFYLAWGDCVWLPFMYTL--QAVYLVYHPVRLSWIASFVILALGISGYLIFRLVNSQKDYFRCQMKRTGSCEIWGEPAKYVTAEYTTSDGEVKTSWLLSSGWWGLSRHFNYVGDLMGCLAYCAACGTGHVLPYFYLIYMTVLLVHRSYRDDVRCREKYGKYWAEYTKLVPYRIVPYLF 398          
BLAST of Lamin-B receptor vs. Ensembl Medaka
Match: lbr (lamin B receptor [Source:NCBI gene;Acc:101159885])

HSP 1 Score: 225.713 bits (574), Expect = 1.650e-65
Identity = 117/365 (32.05%), Postives = 205/365 (56.16%), Query Frame = 3
Query:  549 DGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXX----XXKSYLTEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            D + +G+V  W+++ A L  +P+GK +     + G  +KYR NG  +   +  ++A  +Y   L A + Y + +FL  ++    +  L  L           E++ +     N + +F  GRE+N R   LDLKFF E RPG  GW ++N+   L +++ +  ++ +Y ++   + Q++Y LD++  E  +++   +L+  FGF    G+ V VPF ++L    +  +   L I  LA+   + L+GY I+R SN +KN FR++P    L HLK+I    G  +LV GWWG++RHPNY GD+++ L+WSL  G +  + W Y I+F++ ++ R  +    C   +G+AW++Y + VPYR++P+++
Sbjct:  236 DPQAVGLVFLWILFQALLYVLPVGKLSEGVPLRSGQRLKYRTNGFFATAASAAAVAAAVY---LGADLTYIHSHFLQLAAASFLLSVLLGLFLYVRSGHAAPEELAVGGNSGNVVCDFSKGRELNPRIRNLDLKFFCEMRPGLIGWCLINLALALTEMKQQGLQAPSYPMILVTLFQLLYVLDSLWNEEAVLTSMDLLHEGFGFMLAFGDLVWVPFTYSLQAFYLVEHPSPLNIPVLAASVALQLVGYYIFRKSNSEKNRFRRDPSDPRLSHLKSIPTATGRSLLVSGWWGMVRHPNYLGDLMMALAWSLPCGFSHLLPWHYLIHFMVLLVHRDSRITTVCRRTYGSAWDEYCRTVPYRIVPYLY 597          
BLAST of Lamin-B receptor vs. Ensembl Medaka
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:NCBI gene;Acc:101162861])

HSP 1 Score: 207.223 bits (526), Expect = 2.903e-60
Identity = 119/401 (29.68%), Postives = 210/401 (52.37%), Query Frame = 3
Query:  435 CCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTT-KKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAF--RPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            C  +F  +  +FL+       A +              D     +++ W+     L H+P+GK +     + G  +KY  NG+  + +++  L+ LM+        +++    L  S+I V+ +    L ++S+      +A      N +Y+F +GRE+N R    DLK+F E RPG  GW+++N    +K++E R   S+  +++     Q++Y  DA+  E  +++   +++  FGF    G+   VPF + L    + ++   L       I ++N +GY I+R SN QKN FR++P    +  L+TI    G ++LV GWWG +RHPNY GD+++ L+WSL  G +  + +FY IYF + ++ R  +D+R+C  ++G AW+ Y + VPYR+ PF++
Sbjct:   28 CIPIFLPLTVLFLIGLSRSPEASVLQWPPSLPSYNQLLDPLAPVLLLGWIALHILLYHLPLGKVSEGLVLRDGTRLKYPINGIHGLCVSVALLSLLMWLGA-PLGYLFELLLPLAASAIAVSFLLSIYLYIRSFWAPSHALALGGNTGNPLYDFFIGRELNPRIGNFDLKYFCELRPGLIGWVVINFGMLMKEVELRGSPSL--AMILVNSFQLLYVADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQTLTWLKAVFILLLNGMGYYIFRKSNSQKNQFRRDPTHPSVTGLETIATATGKRLLVSGWWGFVRHPNYLGDLLMALAWSLPCGFSHLLPYFYVIYFTVLLVHREARDERQCKAKYGLAWDAYCRRVPYRIFPFIY 425          
BLAST of Lamin-B receptor vs. Ensembl Medaka
Match: tm7sf2 (transmembrane 7 superfamily member 2 [Source:NCBI gene;Acc:101162861])

HSP 1 Score: 191.045 bits (484), Expect = 3.536e-54
Identity = 117/407 (28.75%), Postives = 208/407 (51.11%), Query Frame = 3
Query:  435 CCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIEVK-----YRF--NGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAF--RPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            C  +F  +  +FL+       A +              D     +++ W+     L H+P+GK       +   ++     Y F   G+  + +++  L+ LM+        +++    L  S+I V+ +    L ++S+      +A      N +Y+F +GRE+N R    DLK+F E RPG  GW+++N    +K++E R   S+  +++     Q++Y  DA+  E  +++   +++  FGF    G+   VPF + L    + ++   L       I ++N +GY I+R SN QKN FR++P    +  L+TI    G ++LV GWWG +RHPNY GD+++ L+WSL  G +  + +FY IYF + ++ R  +D+R+C  ++G AW+ Y + VPYR+ PF++
Sbjct:   28 CIPIFLPLTVLFLIGLSRSPEASVLQWPPSLPSYNQLLDPLAPVLLLGWIALHILLYHLPLGKVRNIVLCRLFLLRRHICCYLFLPQGIHGLCVSVALLSLLMWLGA-PLGYLFELLLPLAASAIAVSFLLSIYLYIRSFWAPSHALALGGNTGNPLYDFFIGRELNPRIGNFDLKYFCELRPGLIGWVVINFGMLMKEVELRGSPSL--AMILVNSFQLLYVADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQTLTWLKAVFILLLNGMGYYIFRKSNSQKNQFRRDPTHPSVTGLETIATATGKRLLVSGWWGFVRHPNYLGDLLMALAWSLPCGFSHLLPYFYVIYFTVLLVHREARDERQCKAKYGLAWDAYCRRVPYRIFPFIY 431          
BLAST of Lamin-B receptor vs. Ensembl Medaka
Match: dhcr7 (7-dehydrocholesterol reductase [Source:NCBI gene;Acc:101175471])

HSP 1 Score: 139.428 bits (350), Expect = 5.714e-35
Identity = 100/346 (28.90%), Postives = 171/346 (49.42%), Query Frame = 3
Query:  633 STTKKGIEVKYRFNGVISMIIT-ITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYL--TEKIKIAFRPINFIYNFIVGREINTRFF-GLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQN----------PYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            + T  G+  KY  NG+   +IT     A   Y    +  +++DN+  L+  + L+         +K+Y+  T      F   N  YN+++G E N R     D K F+  RPG   W ++N+ +  K  E   + ++  S++   I Q IY LD    E   +    + +  FG++   G+ V +P+L+TL    +  +  QL      ++ ++ L+GY I+RS+N QK+ FR++          P  +   +       H  ++L  G+WG+ RH NY GD++  L++    GL   + +FY +Y  + ++ RCV+D+ +C+ ++G  W  Y  AVPYRLIP VF
Sbjct:  176 ARTPAGLINKYEINGLQCWLITHALWFANARYFHWFSPTIIFDNWIPLMWCANLLGYAVSTFAFVKAYIFPTNPEDCKFTG-NVFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSYMSKQQE--LYGTVTNSMILVNILQGIYVLDFFWNEAWYLKTIDICHDHFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSDASALAVLLLGLLGYYIFRSTNHQKDLFRRHDGSCTIWGRKPSFIECSYRSADGGLHRSKLLTSGFWGVARHFNYTGDLMGSLAYCAACGLGHILPYFYIVYMTILLVHRCVRDEHRCSSKYGKDWKRYTDAVPYRLIPGVF 518          
BLAST of Lamin-B receptor vs. Planmine SMEST
Match: SMESG000042131.1 (SMESG000042131.1)

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 513/515 (99.61%), Postives = 513/515 (99.61%), Query Frame = 3
Query:   84 MVEKYXXXXXXXXXXXXXXXXXXXXXIVLSRTKKSMEVSEKPTSSNLAYVARRVTRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSXXXXXXXXXXXXXKSYLTEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 1628
            MVEKYTRKRSKSAPRRRSRSTSKSKPIVLSRTKKSMEVSEKPTSSNLAYVARRVTRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSILVAVVFLFILLLKSYLTEKIK AFRPINFIYNFIVGREINTR FGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF
Sbjct:    1 MVEKYTRKRSKSAPRRRSRSTSKSKPIVLSRTKKSMEVSEKPTSSNLAYVARRVTRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVKVLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIKLQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIEVKYRFNGVISMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSILVAVVFLFILLLKSYLTEKIKKAFRPINFIYNFIVGREINTRCFGLDLKFFYEFRPGFTGWMILNIIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNGQFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYIIYRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFGDIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWNDYRKAVPYRLIPFVF 515          
The following BLAST results are available for this feature:
BLAST of Lamin-B receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LBR8.873e-6232.59lamin B receptor [Source:HGNC Symbol;Acc:HGNC:6518... [more]
LBR8.873e-6232.59lamin B receptor [Source:HGNC Symbol;Acc:HGNC:6518... [more]
TM7SF27.544e-5736.36transmembrane 7 superfamily member 2 [Source:HGNC ... [more]
TM7SF26.974e-4237.37transmembrane 7 superfamily member 2 [Source:HGNC ... [more]
TM7SF29.700e-4231.62transmembrane 7 superfamily member 2 [Source:HGNC ... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhcr-73.429e-1221.21DeHydroCholesterol Reductase; Sterol reductase [S... [more]
dhcr-73.429e-1221.21DeHydroCholesterol Reductase; Sterol reductase [S... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LBR4.740e-1227.65gene:FBgn0034657 transcript:FBtr0071712[more]
LBR4.740e-1227.65gene:FBgn0034657 transcript:FBtr0071711[more]
LBR5.053e-1227.65gene:FBgn0034657 transcript:FBtr0071713[more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lbr2.200e-6629.81lamin B receptor [Source:ZFIN;Acc:ZDB-GENE-030804-... [more]
lbr2.200e-6629.81lamin B receptor [Source:ZFIN;Acc:ZDB-GENE-030804-... [more]
tm7sf21.525e-6030.42transmembrane 7 superfamily member 2 [Source:ZFIN;... [more]
tm7sf21.525e-6030.42transmembrane 7 superfamily member 2 [Source:ZFIN;... [more]
tm7sf21.525e-6030.42transmembrane 7 superfamily member 2 [Source:ZFIN;... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rp98.956e-6833.67retinitis pigmentosa 9 (autosomal dominant) [Sourc... [more]
rp91.427e-6733.67retinitis pigmentosa 9 (autosomal dominant) [Sourc... [more]
rp91.919e-6633.67retinitis pigmentosa 9 (autosomal dominant) [Sourc... [more]
rp93.756e-6633.16retinitis pigmentosa 9 (autosomal dominant) [Sourc... [more]
lbr5.191e-6431.39lamin B receptor [Source:NCBI gene;Acc:100145693][more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lbr1.583e-6432.77lamin B receptor [Source:MGI Symbol;Acc:MGI:213828... [more]
Tm7sf25.330e-5836.76transmembrane 7 superfamily member 2 [Source:MGI S... [more]
Tm7sf23.427e-4332.03transmembrane 7 superfamily member 2 [Source:MGI S... [more]
Tm7sf21.573e-4237.20transmembrane 7 superfamily member 2 [Source:MGI S... [more]
Dhcr71.349e-3528.907-dehydrocholesterol reductase [Source:MGI Symbol;... [more]
back to top
BLAST of Lamin-B receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3U9G9|LBR_MOUSE1.108e-6332.77Delta(14)-sterol reductase LBR OS=Mus musculus OX=... [more]
sp|O08984|LBR_RAT2.135e-6232.15Delta(14)-sterol reductase LBR OS=Rattus norvegicu... [more]
sp|Q14739|LBR_HUMAN4.261e-6132.59Delta(14)-sterol reductase LBR OS=Homo sapiens OX=... [more]
sp|Q5R7H4|LBR_PONAB1.310e-6032.31Delta(14)-sterol reductase LBR OS=Pongo abelii OX=... [more]
sp|P23913|LBR_CHICK2.150e-5731.32Delta(14)-sterol reductase LBR OS=Gallus gallus OX... [more]
back to top
BLAST of Lamin-B receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZS141.928e-7436.91Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HT828.438e-7434.05delta(14)-sterol reductase isoform X3 OS=Lingula u... [more]
A0A1S3HT591.186e-7334.05delta(14)-sterol reductase isoform X2 OS=Lingula u... [more]
A0A3S0ZQQ34.198e-7332.84Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3HT565.190e-7334.05delta(14)-sterol reductase isoform X1 OS=Lingula u... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lbr3.735e-6330.47lamin-B receptor [Source:NCBI gene;Acc:103032852][more]
tm7sf23.028e-6234.14transmembrane 7 superfamily member 2 [Source:ZFIN;... [more]
si:ch1073-429i10.12.774e-4127.70delta(14)-sterol reductase-like [Source:NCBI gene;... [more]
si:ch1073-429i10.14.388e-4127.70delta(14)-sterol reductase-like [Source:NCBI gene;... [more]
dhcr74.101e-3928.167-dehydrocholesterol reductase [Source:NCBI gene;A... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002700.13.025e-3729.25pep scaffold:Pmarinus_7.0:GL480753:6556:12779:-1 g... [more]
ENSPMAT00000000142.12.013e-3329.66pep scaffold:Pmarinus_7.0:GL476617:408941:423101:1... [more]
ENSPMAT00000000385.11.182e-2337.67pep scaffold:Pmarinus_7.0:GL488468:1897:4392:1 gen... [more]
ENSPMAT00000000387.13.657e-2237.24pep scaffold:Pmarinus_7.0:GL488468:1954:4347:1 gen... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERG241.096e-4529.77C-14 sterol reductase; acts in ergosterol biosynth... [more]
ERG42.187e-2129.89C-24(28) sterol reductase; catalyzes the final ste... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315992.658e-6634.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384056.614e-3827.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lamin-B receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lbr1.650e-6532.05lamin B receptor [Source:NCBI gene;Acc:101159885][more]
tm7sf22.903e-6029.68transmembrane 7 superfamily member 2 [Source:NCBI ... [more]
tm7sf23.536e-5428.75transmembrane 7 superfamily member 2 [Source:NCBI ... [more]
dhcr75.714e-3528.907-dehydrocholesterol reductase [Source:NCBI gene;A... [more]
back to top
BLAST of Lamin-B receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042131.10.000e+099.61SMESG000042131.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030198 ID=SMED30030198|Name=Lamin-B receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1808bp
GTTTGTTTTAATAAATGCCTTAGTTTCTTTATCCCATTATGAAACAAAGC
TTGAATTCTGCAGTTTAAGTTAGGCGTTATTAAATGGTAGAAAAATACAC
AAGAAAGCGTTCTAAAAGTGCTCCTCGGAGAAGATCTCGTTCAACTTCAA
AATCTAAACCTATAGTTTTATCCAGGACAAAGAAGTCGATGGAAGTCAGT
GAAAAACCCACCTCCTCTAACCTTGCATATGTAGCAAGGCGCGTTACTCG
TCGATCTAAGCAAATTGAATCTAAATTTTTGGGAAATGACGATAATATGG
AAATAGAAACTGTAACTGAAAGTAAAAAACCTCAGTTGTTAGATAATGGA
AACACAGAAAACTTTGATAAGCCAAAAGTCAAAGTTCTATCAAAATTTCA
AATTTATTTCAAATCAATGAAGTCTATTATGTTTTGTTGTATGGTTTTCT
CTTTAATTCCAGCCGTGTTTCTATTAAATAAAATGTCTGAAGATGGTGCC
AAAATAAGACATATCAGTTTCAAAGAAATTAAATTACAATATTTCACAGA
TGGCAAAAATATAGGAATTGTCATTTGTTGGTTAATGTATTTAGCAGCCT
TAGCTCACATCCCCATTGGAAAAACAGCATATTCTACAACTAAAAAAGGC
ATTGAAGTTAAATATAGATTTAATGGTGTTATTTCCATGATAATAACCAT
AACTAGTTTAGCAGGTCTTATGTATACCAAAACTCTCACGGCAAAAATGG
TTTACGATAATTATTATTTTTTAATTGGGAGTTCTATTTTGGTTGCAGTG
GTCTTTTTATTTATATTATTGTTGAAATCATATTTAACTGAAAAAATCAA
GATAGCGTTTAGACCTATAAATTTTATTTATAATTTCATCGTTGGTCGTG
AAATTAATACAAGATTTTTTGGGTTAGATCTGAAATTTTTTTATGAATTC
CGACCCGGTTTCACTGGTTGGATGATATTAAATATTATTTTCTGTCTGAA
GGATTTAGAAGATCGTGAGTTTAAATCAATTAATTATTCACTACTATTTT
GTGCAATAAGTCAAATAATATATTGTCTCGATGCTGTGATGTTCGAGGGA
GATATTATTTCTAAACCGTTTATGTTAAACGGACAATTTGGTTTCTTTCA
CTGCCTTGGAAATCAAGTCATAGTTCCATTTTTGTTTACTTTGACCACTC
GAGCTATACAAATTAATAACTTCCAACTGCCTATCAAATGTTTAGCGAGT
ATTGCCGTCATTAATCTGATTGGATACATTATTTATCGATCATCAAATAT
ACAGAAAAATAGTTTCCGTCAAAATCCCTACAGTGTTCACCTATGCCATT
TAAAAACAATTACAAATCGTCATGGTCATCAAATACTCGTTGGTGGATGG
TGGGGATTATTGAGACATCCGAATTATTTTGGTGATATAATTATCTGTTT
ATCTTGGTCTCTATATTCCGGGCTAAATTTCGGTGTGTGCTGGTTCTATC
CAATATATTTTTTACTTTTTATAATTACTCGTTGCGTTCAAGATGATCGG
AAATGTGCGGTTGAGCACGGCACAGCATGGAATGATTATCGCAAGGCTGT
GCCGTATCGATTAATTCCTTTTGTATTTTAAATTGTATTTAATGTTTTAT
GTATTGATTGGGCATGCTTATTCATTTCTTTATGGCAGCTGTTTTGATTG
AATTTATGTCCGTATATTTTTTATGTAATTCGATTTGTAATTTATATATT
TAAATTTTTCACTATTTATGCTTGGTTGTGAATTTCATGAGTTGGTGAGA
TCGGAAGA
back to top

protein sequence of SMED30030198-orf-1

>SMED30030198-orf-1 ID=SMED30030198-orf-1|Name=SMED30030198-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MVEKYTRKRSKSAPRRRSRSTSKSKPIVLSRTKKSMEVSEKPTSSNLAYV
ARRVTRRSKQIESKFLGNDDNMEIETVTESKKPQLLDNGNTENFDKPKVK
VLSKFQIYFKSMKSIMFCCMVFSLIPAVFLLNKMSEDGAKIRHISFKEIK
LQYFTDGKNIGIVICWLMYLAALAHIPIGKTAYSTTKKGIEVKYRFNGVI
SMIITITSLAGLMYTKTLTAKMVYDNYYFLIGSSILVAVVFLFILLLKSY
LTEKIKIAFRPINFIYNFIVGREINTRFFGLDLKFFYEFRPGFTGWMILN
IIFCLKDLEDREFKSINYSLLFCAISQIIYCLDAVMFEGDIISKPFMLNG
QFGFFHCLGNQVIVPFLFTLTTRAIQINNFQLPIKCLASIAVINLIGYII
YRSSNIQKNSFRQNPYSVHLCHLKTITNRHGHQILVGGWWGLLRHPNYFG
DIIICLSWSLYSGLNFGVCWFYPIYFLLFIITRCVQDDRKCAVEHGTAWN
DYRKAVPYRLIPFVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016126sterol biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR001171Ergosterol_biosynth_ERG4_ERG24
Vocabulary: molecular function
TermDefinition
GO:0016628oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001171Ergosterol biosynthesis ERG4/ERG24PFAMPF01222ERG4_ERG24coord: 106..515
e-value: 6.1E-77
score: 259.2
NoneNo IPR availableGENE3DG3DSA:1.20.120.1630coord: 318..515
e-value: 5.2E-11
score: 44.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..42
NoneNo IPR availablePANTHERPTHR21257:SF17DELTA(14)-STEROL REDUCTASEcoord: 108..515
NoneNo IPR availablePANTHERPTHR21257STEROL REDUCTASE/LAMIN B RECEPTORcoord: 108..515
NoneNo IPR availableTMHMMTMhelixcoord: 352..370
NoneNo IPR availableTMHMMTMhelixcoord: 382..401
NoneNo IPR availableTMHMMTMhelixcoord: 315..337
NoneNo IPR availableTMHMMTMhelixcoord: 114..131
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 458..480
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 160..179