SMED30030173

Overview
NameSMED30030173
Smed IDSMED30030173
Length (bp)1015
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030173 (SMED30030173) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030173 (SMED30030173) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030173

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030173SMESG000012437.1 SmedASXL_004116SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030173SMESG000012437.1 dd_Smed_v6_2937_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030173SMESG000012437.1 dd_Smed_v6_2937_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30030173SMESG000012437.1 dd_Smed_v4_2937_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030173 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000482:114183..115240 -4964
Homology
BLAST of SMED30030173 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 61.2326 bits (147), Expect = 4.433e-10
Identity = 45/145 (31.03%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  112 LHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKK--CSYQSTIAELCQHIRVCDNRPM------ICPYESIGCT-VGEIQKDSLLEHLRIDIHNHNTLII 519
            L D ++ C IC   + +    SCG  +CR C+T +  +N +Q CP   K  ++++  F  DN+  R I +L   CP     CS  ++  EL +H+  C  R         CP+  I C  VG  + + L EHL+ D+ +H  L++
Sbjct:   97 LLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKN-NQCCPMDNKRLSAEHDIFP-DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLML 239          
BLAST of SMED30030173 vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 49.6766 bits (117), Expect = 2.176e-6
Identity = 36/142 (25.35%), Postives = 67/142 (47.18%), Query Frame = 1
Query:   85 WNM-MRKYKFLH--DGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKL-FFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGE----IQKDSLLEHLR 486
            W++  R  +F+   + Q+ C  C  ++++  Q  CG ++C QC+  YT   GS  CP  +     + +    DN   R +L L  F     +C+ + ++  L  H++        CP+E + C+  +    + + +LLEH R
Sbjct:   22 WDLDSRTLRFVSRLEQQFICPSCGGIVLNPHQTGCGHIFCAQCVKAYTENGGSSKCPLDSIPIKPEEI--FQDNCCKRELLNLEVFCTNAPECTQRFSLCNLQDHLKA-------CPHERVRCSHSDCSDIVLRKNLLEHQR 154          
BLAST of SMED30030173 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 9.247e-21
Identity = 51/166 (30.72%), Postives = 89/166 (53.61%), Query Frame = 1
Query:   76 QEVWNMMRKYKFLHDG----QWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNV----KFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNEM 549
            +++  ++  Y F  +G       C +CK+L+++ACQ  CGC +C +CI +Y +  G+ YCPGGT +C  +N+       TD   NR I K+   CP + C     + ++ +H+R+C  +   CP+  +GC   ++    L  HL+     H+ LII  I+++ N+ 
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSR-GNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDF 168          
BLAST of SMED30030173 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.826e-14
Identity = 46/144 (31.94%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  133 CMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHAN----RTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNEMS 552
            C++C  L+ DAC+ +CGC YC  CI  Y ++N + YCPG   +C    +    D   N      I ++   CP  +C+Y S +  L +H+  C    + CP  +IGC    + KD + +HL   +  H  LI+   N+L +E++
Sbjct:   31 CILCNKLMRDACESACGCHYCYTCIRIYLSQNHN-YCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEIN 173          
BLAST of SMED30030173 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.708e-9
Identity = 33/107 (30.84%), Postives = 57/107 (53.27%), Query Frame = 1
Query:  100 KYKFLHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMIC 420
            K++F  +    C++C+ +++DA Q  CGC YC++CI +Y  ENG + C    +DC S    +  D   N+ I  L   C  + C ++ T+  +  H+  C+ R  +C
Sbjct:   20 KWRFTINDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYL-ENGEKECVAEYEDCRSVITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMC 125          
BLAST of SMED30030173 vs. TrEMBL
Match: A0A3S0Z2M9 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_022811 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.084e-7
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  115 HDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDC-NSKNVKFSTDNHANRTILKLFFACPLK--KCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEH 480
             D ++ C++   L+ +  Q SCG   C+ C+  Y   N S+ CP G +DC   +      D    R I  +   CP K   C  +  + +L  H + C  R ++CPY S GC V E+    L EH
Sbjct:   49 RDEKYFCLVHGGLLKEPIQTSCGHRICKDCVEVYLGPNESKLCPAGEEDCMEVRRDNVYPDPGFRREINHVLVFCPFKHNGCPVKIKLGKLKDHKQECQYREVLCPYASRGC-VAEVLLKDLDEH 172          
BLAST of SMED30030173 vs. TrEMBL
Match: W5XLH0 (TNF receptor-associated factor 6 OS=Mytilus galloprovincialis OX=29158 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 7.982e-7
Identity = 37/108 (34.26%), Postives = 51/108 (47.22%), Query Frame = 1
Query:  112 LHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKK--CSYQSTIAELCQHIRVCDNRPMICPYE 429
            L D ++ C IC  ++ D  Q  CG  +C +CI  + +E+G Q CP          V    DN A R IL L   CP  K  C     + +L +H+ VC   P+ CP E
Sbjct:   40 LKDDKYDCPICLLILRDPVQTPCGHRFCHKCIHRWLSESGEQRCPVDNTTVIRDQV--FPDNFAKREILSLQVKCPKSKEGCKVIEVLKQLPKHLEVCGYVPIPCPNE 145          
BLAST of SMED30030173 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 54.6842 bits (130), Expect = 2.209e-8
Identity = 34/127 (26.77%), Postives = 58/127 (45.67%), Query Frame = 1
Query:  124 QWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCT----VGEIQKDSLLEHLRID 492
            ++TC IC   +    Q  CG  +C++C+ + +       CP   +  + K   F  D  A RTIL     CP K C +++ + +L  H R CD       YE + C+      ++ +  + EHL ++
Sbjct:   22 EYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREPLDLKKDVF-LDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCD-------YELVTCSNPMCSAQLPRMDVDEHLLVE 140          
BLAST of SMED30030173 vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 46.9802 bits (110), Expect = 1.827e-6
Identity = 25/92 (27.17%), Postives = 43/92 (46.74%), Query Frame = 1
Query:  124 QWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVC 399
            ++TC IC   +    Q  CG  +C++C+ + +       CP   +  + K   F  D  A RTIL     CP K C +++ + +L   ++ C
Sbjct:   22 EYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREPLDLKKDVF-LDKAAERTILSFLVKCPCKGCKWEAELRDLEVSMKGC 112          
BLAST of SMED30030173 vs. Planmine SMEST
Match: SMESG000012437.1 (SMESG000012437.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 293/298 (98.32%), Postives = 295/298 (98.99%), Query Frame = 1
Query:   64 MADNQEVWNMMRKYKFLHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNEMSEIMKTKILPSQQLPXXXXXXXXXXXXXXXKMSKIFKSLETFHEEIKYVNEMHSKKVEQMESTISHQGNEITCXXXXXXXXXXXXXMGNKPNEHREKSDLLTADCEKPNRMPEICTLTESFNPIIVRREYKSKLNK 957
            MADNQEVWNMMRKYKFLHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNE+SEIMKTKILPSQQLPIESNSNYISSENDDEK+SKIFKSLET HEEIKYVNEMHSKKVEQMESTISHQGNEITCLKNELELLRKNLKMGNKPNEHREKSDLL ADCEKPNRMPEICTLTESFNPIIVRREYKSKL K
Sbjct:    1 MADNQEVWNMMRKYKFLHDGQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNEISEIMKTKILPSQQLPIESNSNYISSENDDEKISKIFKSLETCHEEIKYVNEMHSKKVEQMESTISHQGNEITCLKNELELLRKNLKMGNKPNEHREKSDLLAADCEKPNRMPEICTLTESFNPIIVRREYKSKLKK 298          
BLAST of SMED30030173 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 137.887 bits (346), Expect = 8.164e-37
Identity = 71/168 (42.26%), Postives = 99/168 (58.93%), Query Frame = 1
Query:   64 MADNQEVWNMMRKYKFLHDGQWT----CMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVK-FST---DNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSN 543
            MA    +W MM +Y+F  D Q +    C+IC +L+ DACQG CGCLYC++CI  Y   N  ++CPG  KDC S  +  FS    DN AN  + KL   CP + C++QST+ E+  H++ CD  P  CPY  IGCT   +  D L++HL+ +I  HN L++  I   S+
Sbjct:    1 MAHYLFMWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYL-ANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKWITSASD 167          
BLAST of SMED30030173 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.147e-36
Identity = 69/162 (42.59%), Postives = 97/162 (59.88%), Query Frame = 1
Query:   82 VWNMMRKYKFLHDGQWT----CMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVK-FST---DNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSN 543
            +W MM +Y+F  D Q +    C+IC +L+ DACQG CGCLYC++CI  Y   N  ++CPG  KDC S  +  FS    DN AN  + KL   CP + C++QST+ E+  H++ CD  P  CPY  IGCT   +  D L++HL+ +I  HN L++  I   S+
Sbjct:    1 MWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYL-ANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKWITSASD 161          
BLAST of SMED30030173 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 133.265 bits (334), Expect = 3.543e-35
Identity = 68/159 (42.77%), Postives = 95/159 (59.75%), Query Frame = 1
Query:   91 MMRKYKFLHDGQWT----CMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVK-FST---DNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSN 543
            MM +Y+F  D Q +    C+IC +L+ DACQG CGCLYC++CI  Y   N  ++CPG  KDC S  +  FS    DN AN  + KL   CP + C++QST+ E+  H++ CD  P  CPY  IGCT   +  D L++HL+ +I  HN L++  I   S+
Sbjct:    1 MMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYL-ANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKWITSASD 158          
BLAST of SMED30030173 vs. Planmine SMEST
Match: SMESG000016849.1 (SMESG000016849.1)

HSP 1 Score: 131.339 bits (329), Expect = 4.544e-35
Identity = 63/169 (37.28%), Postives = 95/169 (56.21%), Query Frame = 1
Query:   76 QEVWNMMRKYKFLHD----GQWTCMICKHLIIDACQGSCGCLYCRQCITDYTNENGSQYCPGGTKDCNSKNVKFS----TDNHANRTILKLFFACPLKKCSYQSTIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTLIIGRINDLSNEMSEI 558
            +  W +MRKYKF  D      ++C IC  L+I A    CGC +C  CI +Y   N  ++CPG +KDCN K + +     +DN  N  I ++   CP++ C +++ ++ +  HIR+CD RP+ CP+   GC   E+ KD +  HL  D + HN L+IG IN   +E+  I
Sbjct:    3 ESTWKIMRKYKFEIDYPINNDFSCGICNELMIHASSAPCGCRFCADCIKNYLIGN-DKFCPGKSKDCNKKMINYQNDILSDNPVNIRISRISVKCPMRNCQFRNEMSLIENHIRICDQRPISCPFLEFGCPANEMVKDEMKNHLSTDSYGHNKLLIGFINIFQSEIESI 170          
The following BLAST results are available for this feature:
BLAST of SMED30030173 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf64.433e-1031.03gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of SMED30030173 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf52.176e-625.35Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30030173 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID89.247e-2130.72TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1014.826e-1431.94TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK63.708e-930.84TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A3S0Z2M93.084e-731.20Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
W5XLH07.982e-734.26TNF receptor-associated factor 6 OS=Mytilus gallop... [more]
back to top
BLAST of SMED30030173 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO412432.209e-826.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274261.827e-627.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30030173 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030173 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012437.10.000e+098.32SMESG000012437.1[more]
SMESG000012339.18.164e-3742.26SMESG000012339.1[more]
SMESG000012339.11.147e-3642.59SMESG000012339.1[more]
SMESG000012339.13.543e-3542.77SMESG000012339.1[more]
SMESG000016849.14.544e-3537.28SMESG000016849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030173 ID=SMED30030173|Name=SMED30030173|organism=Schmidtea mediterranea sexual|type=transcript|length=1015bp
CAACAGATGAAGAATTAAGTCATTTTGCGGACATATTTTCAATAAGAATT
AAACATAGGTAAAATGGCAGATAATCAAGAAGTGTGGAATATGATGAGAA
AGTATAAATTTCTACATGATGGTCAATGGACTTGCATGATTTGCAAGCAT
TTAATAATAGATGCTTGCCAAGGATCTTGCGGTTGTCTATACTGCCGACA
ATGCATTACCGACTATACAAATGAGAATGGTTCTCAATATTGCCCAGGGG
GCACAAAAGATTGTAACTCAAAAAACGTTAAATTCTCCACAGATAACCAC
GCTAATAGAACAATACTAAAATTATTTTTCGCTTGTCCATTGAAAAAATG
TTCTTACCAATCTACAATTGCAGAATTGTGTCAGCACATTCGAGTTTGTG
ACAATAGACCGATGATTTGTCCATACGAATCAATCGGATGCACTGTAGGT
GAAATCCAAAAGGATTCATTATTAGAACACCTACGAATTGATATCCATAA
TCACAACACATTGATAATAGGACGGATCAACGACTTGTCGAACGAGATGT
CAGAAATCATGAAGACCAAAATTCTGCCTTCACAACAATTACCAATAGAA
TCAAATTCTAACTACATATCCAGTGAAAATGATGACGAGAAAATGTCAAA
AATATTTAAAAGTTTGGAAACTTTCCATGAAGAAATCAAATATGTCAATG
AAATGCACAGTAAAAAGGTAGAACAAATGGAATCTACAATTTCTCACCAA
GGAAATGAAATCACTTGCTTGAAAAATGAATTGGAACTTCTAAGAAAGAA
TCTGAAAATGGGTAACAAACCAAACGAACATCGAGAAAAGAGTGATTTAC
TCACTGCAGATTGTGAAAAACCAAATAGGATGCCAGAAATTTGTACTTTG
ACTGAGAGCTTTAATCCAATTATCGTTCGTCGGGAATATAAATCAAAACT
AAACAAATGATATTTCTAATGTTATGCTTTATTTTTTAAAATTATGTTTC
GGTTCTAAAAAAAAA
back to top

protein sequence of SMED30030173-orf-1

>SMED30030173-orf-1 ID=SMED30030173-orf-1|Name=SMED30030173-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MADNQEVWNMMRKYKFLHDGQWTCMICKHLIIDACQGSCGCLYCRQCITD
YTNENGSQYCPGGTKDCNSKNVKFSTDNHANRTILKLFFACPLKKCSYQS
TIAELCQHIRVCDNRPMICPYESIGCTVGEIQKDSLLEHLRIDIHNHNTL
IIGRINDLSNEMSEIMKTKILPSQQLPIESNSNYISSENDDEKMSKIFKS
LETFHEEIKYVNEMHSKKVEQMESTISHQGNEITCLKNELELLRKNLKMG
NKPNEHREKSDLLTADCEKPNRMPEICTLTESFNPIIVRREYKSKLNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027130TRAF5
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: biological process
TermDefinition
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 226..246
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 16..71
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..123
e-value: 5.9E-10
score: 41.1
IPR027130TNF receptor-associated factor 5PANTHERPTHR10131:SF83TNF RECEPTOR-ASSOCIATED FACTOR 5coord: 13..91
IPR027130TNF receptor-associated factor 5PANTHERPTHR10131:SF83TNF RECEPTOR-ASSOCIATED FACTOR 5coord: 66..227
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 66..227
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 13..91
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 24..61
score: 9.229
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 86..150